F470098

General Info

Members Datasets Scaffolds Average Seq Length
622 320 1244 120

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10658469|Ga0157375_106584691
Length 144
Sequence MGGRGGGAEQPAASSSFREHCMHTHEQATEHKTFTQPDEVRSFPNGRAEIVRVGGAEVGRLVFQPGWRWSTDVKPLAKTSSCEAPHFQYHVSGKLAIRMDDGTELIAGPGDITSLPRGHDAWVVGDEPVVVVDWYGASNYAKRA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
294 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
295 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 2.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 4.5
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10658469 3300013308 Bacteria 1203
2 MBSR1b_contig_3493839 2162886012 Bacteria 1354
3 JGI25406J46586_10203829 3300003203 Unclassified 578
4 Ga0065712_10148453 3300005290 Bacteria 1389
5 Ga0065715_10212711 3300005293 Bacteria 1307
6 Ga0065715_10381403 3300005293 Bacteria 896
7 Ga0065707_10230766 3300005295 Bacteria 1190
8 Ga0070658_10082132 3300005327 Bacteria 2648
9 Ga0070683_100084594 3300005329 Bacteria 2972
10 Ga0070683_100119758 3300005329 Bacteria 2486
11 Ga0070690_100009726 3300005330 Bacteria 5576
12 Ga0070690_100896841 3300005330 Bacteria 693
13 Ga0070677_10039884 3300005333 Bacteria 1845
14 Ga0068869_100428902 3300005334 Bacteria 1092
15 Ga0068869_100474881 3300005334 Bacteria 1040
16 Ga0070666_10302314 3300005335 Bacteria 1139
17 Ga0070680_100011353 3300005336 Bacteria 6889
18 Ga0070682_100146942 3300005337 Bacteria 1613
19 Ga0070682_100233263 3300005337 Bacteria 1317
20 Ga0070682_101068556 3300005337 Bacteria 674
21 Ga0068868_100058137 3300005338 Bacteria 3056
22 Ga0070660_100049151 3300005339 Bacteria 3241
23 Ga0070689_100134044 3300005340 Bacteria 1988
24 Ga0070689_100293771 3300005340 Bacteria 1351
25 Ga0070691_10043437 3300005341 Bacteria 2129
26 Ga0070687_100058927 3300005343 Bacteria 2019
27 Ga0070687_100271455 3300005343 Bacteria 1063
28 Ga0070661_100047912 3300005344 Bacteria 3128
29 Ga0070692_10183275 3300005345 Bacteria 1215
30 Ga0070692_10480647 3300005345 Bacteria 801
31 Ga0070668_100202035 3300005347 Bacteria 1632
32 Ga0070668_100683055 3300005347 Bacteria 904
33 Ga0070668_100887757 3300005347 Bacteria 796
34 Ga0070669_100238472 3300005353 Bacteria 1444
35 Ga0070675_100006962 3300005354 Bacteria 8685
36 Ga0070671_100519556 3300005355 Bacteria 1025
37 Ga0070671_100727545 3300005355 Bacteria 862
38 Ga0070674_100014238 3300005356 Bacteria 4940
39 Ga0070674_100152671 3300005356 Bacteria 1744
40 Ga0070674_100336574 3300005356 Bacteria 1214
41 Ga0070688_100002101 3300005365 Bacteria 10054
42 Ga0070659_101314067 3300005366 Bacteria 641
43 Ga0070667_100722139 3300005367 Bacteria 923
44 Ga0070709_10004965 3300005434 Bacteria 7187
45 Ga0070709_10341722 3300005434 Bacteria 1104
46 Ga0070714_100009913 3300005435 Bacteria 7513
47 Ga0070714_100018236 3300005435 Bacteria 5697
48 Ga0070714_100336461 3300005435 Bacteria 1415
49 Ga0070713_100078431 3300005436 Bacteria 2811
50 Ga0070710_10221271 3300005437 Bacteria 1204
51 Ga0070701_10179852 3300005438 Bacteria 1237
52 Ga0070701_10742441 3300005438 Bacteria 664
53 Ga0070711_100022822 3300005439 Bacteria 4060
54 Ga0070711_100223909 3300005439 Bacteria 1464
55 Ga0070711_100223912 3300005439 Bacteria 1464
56 Ga0070711_100276632 3300005439 Bacteria 1327
57 Ga0070705_100104080 3300005440 Bacteria 1799
58 Ga0070700_100101169 3300005441 Bacteria 1899
59 Ga0070694_100036212 3300005444 Bacteria 3268
60 Ga0070694_100271885 3300005444 Bacteria 1289
61 Ga0070708_100061050 3300005445 Bacteria 3367
62 Ga0070708_100066416 3300005445 Bacteria 3238
63 Ga0070708_100566426 3300005445 Bacteria 1071
64 Ga0070708_100891513 3300005445 Unclassified 835
65 Ga0070678_100005206 3300005456 Bacteria 7482
66 Ga0070678_100312566 3300005456 Bacteria 1339
67 Ga0070678_100975486 3300005456 Bacteria 778
68 Ga0070681_10368118 3300005458 Bacteria 1347
69 Ga0068867_100108654 3300005459 Bacteria 2128
70 Ga0070685_10006067 3300005466 Bacteria 6161
71 Ga0070706_100021897 3300005467 Bacteria 5885
72 Ga0070706_100056456 3300005467 Unclassified 3623
73 Ga0070707_100040008 3300005468 Bacteria 4484
74 Ga0070707_100081392 3300005468 Bacteria 3126
75 Ga0070707_100229410 3300005468 Unclassified 1808
76 Ga0070707_100946803 3300005468 Unclassified 826
77 Ga0070698_100005989 3300005471 Bacteria 13257
78 Ga0070698_100058543 3300005471 Bacteria 3895
79 Ga0070698_100504311 3300005471 Bacteria 1148
80 Ga0070698_101695975 3300005471 Bacteria 584
81 Ga0070699_100012415 3300005518 Bacteria 7350
82 Ga0070699_100226009 3300005518 Bacteria 1669
83 Ga0070699_100382315 3300005518 Bacteria 1271
84 Ga0070679_100339467 3300005530 Bacteria 1450
85 Ga0070679_100588410 3300005530 Bacteria 1056
86 Ga0070684_100181887 3300005535 Bacteria 1912
87 Ga0070684_100442684 3300005535 Bacteria 1200
88 Ga0070684_101924100 3300005535 Bacteria 558
89 Ga0070684_102319164 3300005535 Bacteria 506
90 Ga0070697_100112657 3300005536 Bacteria 2269
91 Ga0070697_100136423 3300005536 Archaea 2061
92 Ga0070697_101214159 3300005536 Bacteria 672
93 Ga0070686_100006406 3300005544 Bacteria 6539
94 Ga0070686_100083615 3300005544 Bacteria 2119
95 Ga0070686_100190022 3300005544 Bacteria 1465
96 Ga0070695_100012579 3300005545 Bacteria 5080
97 Ga0070695_100040195 3300005545 Bacteria 2960
98 Ga0070696_100012995 3300005546 Bacteria 5586
99 Ga0070696_100266489 3300005546 Bacteria 1301
100 Ga0070696_100568124 3300005546 Bacteria 911
101 Ga0070704_100008220 3300005549 Bacteria 6242
102 Ga0070704_100189515 3300005549 Bacteria 1652
103 Ga0070704_100261194 3300005549 Bacteria 1427
104 Ga0070704_101184730 3300005549 Bacteria 696
105 Ga0070664_100999819 3300005564 Bacteria 786
106 Ga0068857_100149525 3300005577 Bacteria 2115
107 Ga0068854_100382553 3300005578 Bacteria 1160
108 Ga0068854_101581959 3300005578 Bacteria 597
109 Ga0068856_100100503 3300005614 Bacteria 2884
110 Ga0068856_100363584 3300005614 Bacteria 1466
111 Ga0070702_100218790 3300005615 Bacteria 1272
112 Ga0070702_100302767 3300005615 Bacteria 1107
113 Ga0070702_100639276 3300005615 Bacteria 803
114 Ga0068852_100007831 3300005616 Bacteria 7820
115 Ga0068859_100015971 3300005617 Bacteria 7547
116 Ga0068866_10046614 3300005718 Bacteria 2181
117 Ga0068861_100777528 3300005719 Bacteria 897
118 Ga0068863_102340361 3300005841 Bacteria 544
119 Ga0068858_100507242 3300005842 Bacteria 1166
120 Ga0068858_101852004 3300005842 Bacteria 596
121 Ga0068860_100047578 3300005843 Bacteria 4087
122 Ga0068860_101824728 3300005843 Bacteria 630
123 Ga0081455_10009022 3300005937 Bacteria 10292
124 Ga0081538_10228377 3300005981 Bacteria 730
125 Ga0081538_10291972 3300005981 Bacteria 602
126 Ga0081539_10092261 3300005985 Bacteria 1562
127 Ga0081539_10216704 3300005985 Bacteria 873
128 Ga0081539_10220164 3300005985 Unclassified 864
129 Ga0070717_10768854 3300006028 Bacteria 876
130 Ga0075364_10608030 3300006051 Bacteria 747
131 Ga0075432_10003502 3300006058 Bacteria 5317
132 Ga0075432_10043705 3300006058 Bacteria 1570
133 Ga0070715_10075099 3300006163 Bacteria 1520
134 Ga0070716_100099965 3300006173 Bacteria 1776
135 Ga0070712_100016681 3300006175 Bacteria 4746
136 Ga0070712_100282415 3300006175 Bacteria 1337
137 Ga0097621_100033744 3300006237 Bacteria 4078
138 Ga0075428_100006302 3300006844 Bacteria 13189
139 Ga0075428_100093332 3300006844 Bacteria 3281
140 Ga0075428_100229188 3300006844 Bacteria 2004
141 Ga0075430_100010912 3300006846 Bacteria 7696
142 Ga0075430_100037281 3300006846 Bacteria 4121
143 Ga0075430_100081686 3300006846 Bacteria 2707
144 Ga0075430_100387921 3300006846 Bacteria 1153
145 Ga0075430_101000425 3300006846 Bacteria 689
146 Ga0075431_100076349 3300006847 Bacteria 3457
147 Ga0075431_100183278 3300006847 Bacteria 2148
148 Ga0075431_100261453 3300006847 Bacteria 1756
149 Ga0075431_100426091 3300006847 Bacteria 1325
150 Ga0075431_100439701 3300006847 Bacteria 1301
151 Ga0075433_10040994 3300006852 Bacteria 4010
152 Ga0075434_100012776 3300006871 Bacteria 7970
153 Ga0075434_101215628 3300006871 Bacteria 765
154 Ga0075429_100012102 3300006880 Bacteria 7477
155 Ga0075429_100059015 3300006880 Bacteria 3342
156 Ga0075429_100079382 3300006880 Bacteria 2861
157 Ga0075429_100205314 3300006880 Bacteria 1726
158 Ga0075429_100320975 3300006880 Bacteria 1355
159 Ga0075436_100007639 3300006914 Bacteria 7387
160 Ga0075436_100061647 3300006914 Bacteria 2591
161 Ga0097620_100015971 3300006931 Bacteria 7547
162 Ga0075435_100005144 3300007076 Bacteria 9094
163 Ga0075435_100022599 3300007076 Bacteria 4852
164 Ga0075435_100061337 3300007076 Bacteria 3050
165 Ga0105240_10101991 3300009093 Bacteria 3488
166 Ga0111539_10003502 3300009094 Bacteria 20702
167 Ga0111539_10029464 3300009094 Bacteria 6685
168 Ga0111539_10060072 3300009094 Bacteria 4506
169 Ga0111539_10065416 3300009094 Bacteria 4296
170 Ga0111539_10391761 3300009094 Bacteria 1618
171 Ga0111539_10625692 3300009094 Bacteria 1253
172 Ga0111539_11331819 3300009094 Unclassified 833
173 Ga0105245_10140384 3300009098 Bacteria 2275
174 Ga0105245_10359280 3300009098 Bacteria 1445
175 Ga0105245_12366309 3300009098 Bacteria 585
176 Ga0105247_10043713 3300009101 Bacteria 2745
177 Ga0114129_10009365 3300009147 Bacteria 13966
178 Ga0114129_10011069 3300009147 Bacteria 12851
179 Ga0114129_10152331 3300009147 Bacteria 3164
180 Ga0114129_10263634 3300009147 Bacteria 2308
181 Ga0114129_10314421 3300009147 Bacteria 2084
182 Ga0114129_10610355 3300009147 Bacteria 1412
183 Ga0114129_10679328 3300009147 Unclassified 1326
184 Ga0114129_10856213 3300009147 Bacteria 1155
185 Ga0114129_11592277 3300009147 Unclassified 800
186 Ga0114129_11596330 3300009147 Bacteria 799
187 Ga0105243_10006745 3300009148 Bacteria 8859
188 Ga0105243_10008950 3300009148 Bacteria 7653
189 Ga0105243_10021907 3300009148 Bacteria 4853
190 Ga0105243_10171969 3300009148 Bacteria 1877
191 Ga0105243_12670574 3300009148 Bacteria 539
192 Ga0105241_10023225 3300009174 Bacteria 4598
193 Ga0105242_10006694 3300009176 Bacteria 8894
194 Ga0105242_10011432 3300009176 Bacteria 6825
195 Ga0105242_10023168 3300009176 Bacteria 4894
196 Ga0105248_10032145 3300009177 Bacteria 5865
197 Ga0105237_10041255 3300009545 Bacteria 4655
198 Ga0105238_10012331 3300009551 Bacteria 8620
199 Ga0105249_10084353 3300009553 Bacteria 2959
200 Ga0105249_10132465 3300009553 Bacteria 2381
201 Ga0105249_10342207 3300009553 Bacteria 1513
202 Ga0105239_11543817 3300010375 Bacteria 768
203 Ga0105246_10221937 3300011119 Bacteria 1482
204 Ga0105246_11146559 3300011119 Bacteria 712
205 Ga0157347_1029025 3300012502 Unclassified 685
206 Ga0157370_10050656 3300013104 Bacteria 3968
207 Ga0157369_10269840 3300013105 Bacteria 1773
208 Ga0157378_10012432 3300013297 Bacteria 7454
209 Ga0157378_10320681 3300013297 Bacteria 1505
210 Ga0157378_12650877 3300013297 Bacteria 554
211 Ga0163162_10178508 3300013306 Bacteria 2249
212 Ga0163162_10227715 3300013306 Unclassified 1994
213 Ga0163162_10462083 3300013306 Bacteria 1401
214 Ga0163162_12948434 3300013306 Bacteria 547
215 Ga0157372_10103617 3300013307 Bacteria 3251
216 Ga0157372_11626323 3300013307 Bacteria 743
217 Ga0157375_10004626 3300013308 Bacteria 11961
218 Ga0157375_12757118 3300013308 Bacteria 588
219 Ga0157380_10100108 3300014326 Bacteria 2412
220 Ga0157380_11213199 3300014326 Bacteria 798
221 Ga0157377_10475439 3300014745 Bacteria 868
222 Ga0157379_10018413 3300014968 Bacteria 6158
223 Ga0157376_10173322 3300014969 Bacteria 1966
224 Ga0157376_10300300 3300014969 Bacteria 1520
225 Ga0163161_11039913 3300017792 Bacteria 701
226 Ga0197907_11187969 3300020069 Bacteria 941
227 Ga0206356_11649257 3300020070 Bacteria 945
228 Ga0206349_1189951 3300020075 Bacteria 938
229 Ga0206351_10316504 3300020077 Bacteria 941
230 Ga0206352_10429268 3300020078 Bacteria 942
231 Ga0206350_11578042 3300020080 Bacteria 906
232 Ga0206354_11493155 3300020081 Bacteria 1074
233 Ga0206353_10530369 3300020082 Bacteria 4320
234 Ga0206353_10731401 3300020082 Bacteria 693
235 Ga0213873_10093614 3300021358 Bacteria 856
236 Ga0213873_10102409 3300021358 Bacteria 825
237 Ga0213873_10110381 3300021358 Bacteria 799
238 Ga0213873_10134721 3300021358 Unclassified 734
239 Ga0213874_10192862 3300021377 Bacteria 730
240 Ga0213876_10007374 3300021384 Bacteria 5982
241 Ga0213876_10009623 3300021384 Bacteria 5200
242 Ga0213876_10448866 3300021384 Bacteria 686
243 Ga0213875_10006050 3300021388 Bacteria 6407
244 Ga0213875_10169329 3300021388 Unclassified 1025
245 Ga0224712_10178545 3300022467 Bacteria 955
246 Ga0224712_10188051 3300022467 Bacteria 934
247 Ga0228598_1002791 3300024227 Bacteria 3785
248 Ga0207682_10004555 3300025893 Bacteria 5773
249 Ga0207692_10181779 3300025898 Bacteria 1226
250 Ga0207692_10259957 3300025898 Bacteria 1043
251 Ga0207642_10219667 3300025899 Bacteria 1061
252 Ga0207710_10073724 3300025900 Bacteria 1570
253 Ga0207680_10077436 3300025903 Bacteria 2080
254 Ga0207699_10002143 3300025906 Bacteria 9340
255 Ga0207699_10200686 3300025906 Unclassified 1351
256 Ga0207705_10024461 3300025909 Bacteria 4310
257 Ga0207705_10758668 3300025909 Bacteria 754
258 Ga0207684_10048138 3300025910 Bacteria 3616
259 Ga0207684_10976032 3300025910 Bacteria 710
260 Ga0207654_10393103 3300025911 Bacteria 963
261 Ga0207707_10031066 3300025912 Bacteria 4672
262 Ga0207707_10282253 3300025912 Bacteria 1438
263 Ga0207707_11032500 3300025912 Bacteria 673
264 Ga0207695_10083982 3300025913 Bacteria 3216
265 Ga0207671_10088848 3300025914 Bacteria 2325
266 Ga0207693_10022438 3300025915 Bacteria 5015
267 Ga0207693_10361518 3300025915 Bacteria 1136
268 Ga0207693_10976189 3300025915 Bacteria 648
269 Ga0207663_10029479 3300025916 Bacteria 3223
270 Ga0207663_10289864 3300025916 Bacteria 1219
271 Ga0207663_10721174 3300025916 Bacteria 790
272 Ga0207660_10255277 3300025917 Bacteria 1384
273 Ga0207660_10518128 3300025917 Bacteria 968
274 Ga0207662_10067179 3300025918 Bacteria 2162
275 Ga0207662_10166049 3300025918 Bacteria 1413
276 Ga0207662_10901501 3300025918 Bacteria 626
277 Ga0207657_10015071 3300025919 Bacteria 7508
278 Ga0207649_10245415 3300025920 Bacteria 1287
279 Ga0207652_10018200 3300025921 Bacteria 5759
280 Ga0207646_10009116 3300025922 Bacteria 9847
281 Ga0207646_10043339 3300025922 Archaea 4042
282 Ga0207646_10183758 3300025922 Bacteria 1888
283 Ga0207646_10805046 3300025922 Unclassified 837
284 Ga0207646_11444120 3300025922 Bacteria 597
285 Ga0207681_10961319 3300025923 Bacteria 716
286 Ga0207694_10096787 3300025924 Bacteria 2335
287 Ga0207659_10016529 3300025926 Bacteria 4804
288 Ga0207659_10858736 3300025926 Bacteria 780
289 Ga0207687_10892318 3300025927 Bacteria 761
290 Ga0207687_11864462 3300025927 Bacteria 514
291 Ga0207700_10123421 3300025928 Bacteria 2103
292 Ga0207700_10163192 3300025928 Bacteria 1852
293 Ga0207664_10012995 3300025929 Bacteria 5965
294 Ga0207664_10043000 3300025929 Bacteria 3531
295 Ga0207664_10204515 3300025929 Bacteria 1706
296 Ga0207686_10026098 3300025934 Bacteria 3406
297 Ga0207686_10092643 3300025934 Bacteria 1998
298 Ga0207709_10087563 3300025935 Bacteria 2025
299 Ga0207709_10252952 3300025935 Bacteria 1288
300 Ga0207709_10623772 3300025935 Bacteria 856
301 Ga0207669_10037265 3300025937 Bacteria 2788
302 Ga0207669_10082315 3300025937 Bacteria 2066
303 Ga0207669_10203325 3300025937 Bacteria 1440
304 Ga0207669_10754384 3300025937 Bacteria 804
305 Ga0207704_10032674 3300025938 Bacteria 2948
306 Ga0207704_11713764 3300025938 Bacteria 540
307 Ga0207665_10441186 3300025939 Bacteria 997
308 Ga0207691_11000664 3300025940 Bacteria 698
309 Ga0207711_10043297 3300025941 Bacteria 3839
310 Ga0207689_10117172 3300025942 Bacteria 2190
311 Ga0207689_11117611 3300025942 Bacteria 664
312 Ga0207689_11194212 3300025942 Bacteria 640
313 Ga0207661_10042041 3300025944 Bacteria 3602
314 Ga0207661_10289569 3300025944 Bacteria 1465
315 Ga0207712_10081924 3300025961 Bacteria 2351
316 Ga0207712_10169929 3300025961 Bacteria 1703
317 Ga0207668_10165355 3300025972 Bacteria 1729
318 Ga0207640_10417105 3300025981 Bacteria 1097
319 Ga0207640_10732797 3300025981 Bacteria 851
320 Ga0207703_10134432 3300026035 Bacteria 2139
321 Ga0207678_10036754 3300026067 Bacteria 4263
322 Ga0207708_10080187 3300026075 Bacteria 2508
323 Ga0207708_10169470 3300026075 Bacteria 1728
324 Ga0207708_10896439 3300026075 Bacteria 767
325 Ga0207702_10735487 3300026078 Bacteria 973
326 Ga0207641_11778219 3300026088 Bacteria 618
327 Ga0207648_10003843 3300026089 Bacteria 15690
328 Ga0207648_10726199 3300026089 Bacteria 922
329 Ga0207674_10226625 3300026116 Bacteria 1817
330 Ga0207675_100055389 3300026118 Bacteria 3699
331 Ga0207675_100274300 3300026118 Bacteria 1637
332 Ga0207683_10003328 3300026121 Bacteria 14006
333 Ga0207683_10308113 3300026121 Bacteria 1449
334 Ga0207683_10632715 3300026121 Bacteria 991
335 Ga0207683_10668898 3300026121 Bacteria 962
336 Ga0207698_10262179 3300026142 Bacteria 1588
337 Ga0207428_10003020 3300027907 Bacteria 16576
338 Ga0207428_10003077 3300027907 Bacteria 16411
339 Ga0207428_10062545 3300027907 Bacteria 2943
340 Ga0207428_10176975 3300027907 Bacteria 1613
341 Ga0268264_10547785 3300028381 Bacteria 1134
342 Ga0268264_11993833 3300028381 Bacteria 590
343 Ga0265318_10024197 3300028577 Bacteria 2412
344 Ga0265324_10245697 3300029957 Bacteria 608
345 Ga0265762_1032362 3300030760 Bacteria 997
346 Ga0265760_10017386 3300031090 Bacteria 2065
347 Ga0265320_10214407 3300031240 Bacteria 858
348 Ga0307408_100034641 3300031548 Bacteria 3538
349 Ga0307408_101357197 3300031548 Bacteria 668
350 Ga0307508_10824368 3300031616 Bacteria 547
351 Ga0307405_10001535 3300031731 Bacteria 9772
352 Ga0307405_10914174 3300031731 Bacteria 743
353 Ga0307413_10013152 3300031824 Bacteria 4146
354 Ga0307410_10000299 3300031852 Bacteria 19248
355 Ga0307410_10391155 3300031852 Bacteria 1121
356 Ga0307410_10444846 3300031852 Bacteria 1056
357 Ga0307410_11642814 3300031852 Bacteria 568
358 Ga0307406_10026004 3300031901 Bacteria 3509
359 Ga0307406_10539068 3300031901 Bacteria 953
360 Ga0307406_10851600 3300031901 Bacteria 773
361 Ga0307407_10004393 3300031903 Bacteria 5979
362 Ga0307407_11455151 3300031903 Bacteria 541
363 Ga0307412_10068639 3300031911 Unclassified 2411
364 Ga0307409_100043751 3300031995 Bacteria 3366
365 Ga0307409_100336206 3300031995 Bacteria 1419
366 Ga0307409_100955486 3300031995 Bacteria 873
367 Ga0307409_101293445 3300031995 Bacteria 754
368 Ga0307416_100007581 3300032002 Bacteria 6919
369 Ga0307416_101324777 3300032002 Bacteria 826
370 Ga0307416_102395826 3300032002 Unclassified 627
371 Ga0307414_10038669 3300032004 Bacteria 3207
372 Ga0307411_10007544 3300032005 Bacteria 5555
373 Ga0307415_100001873 3300032126 Bacteria 10324
374 Ga0307415_100948100 3300032126 Bacteria 796
375 Ga0373923_0214393 3300035111 Unclassified 893
376 Ga0373939_0192255 3300035114 Bacteria 767
377 Ga0373956_0053494 3300035119 Bacteria 1817
378 Ga0373957_0258715 3300035120 Unclassified 733
379 Ga0373961_0164054 3300035241 Bacteria 765
380 Ga0373935_0116768 3300035692 Bacteria 1778
381 Ga0373935_0239654 3300035692 Bacteria 1266
382 Ga0373933_0010869 3300035724 Bacteria 4996
383 Ga0373947_0132588 3300035725 Bacteria 1592
384 Ga0373947_0516781 3300035725 Bacteria 812
385 Ga0373925_0274659 3300037068 Bacteria 1356
386 Ga0373925_0617300 3300037068 Bacteria 893
387 Ga0395900_0459520 3300037418 Bacteria 1228
388 Ga0395898_1362125 3300037466 Bacteria 638
389 Ga0436364_0507893 3300037853 Bacteria 50699
390 Ga0436364_0571319 3300037853 Bacteria 1358
391 Ga0436364_0718230 3300037853 Unclassified 1210
392 Ga0436364_0912106 3300037853 Bacteria 776
393 Ga0436364_1464743 3300037853 Unclassified 617
394 Ga0436364_1523838 3300037853 Bacteria 2081
395 Ga0436365_0009952 3300039437 Bacteria 1644
396 Ga0436365_0148245 3300039437 Bacteria 13881
397 Ga0436365_0434757 3300039437 Bacteria 975
398 Ga0436365_0716929 3300039437 Bacteria 12555
399 Ga0436365_0740890 3300039437 Bacteria 1359
400 Ga0436365_1295859 3300039437 Bacteria 13419
401 Ga0436360_0398132 3300039438 Bacteria 682
402 Ga0436360_0911708 3300039438 Bacteria 959
403 Ga0436360_1178628 3300039438 Bacteria 1053
404 Ga0436361_0025781 3300039447 Bacteria 1245
405 Ga0436363_0063930 3300039450 Bacteria 5294
406 Ga0436363_0431896 3300039450 Bacteria 542
407 Ga0436363_0763765 3300039450 Bacteria 3747
408 Ga0436363_1111064 3300039450 Bacteria 4427
409 Ga0436363_1154611 3300039450 Bacteria 1846
410 Ga0436362_0038805 3300039453 Bacteria 1597
411 Ga0436362_0214587 3300039453 Bacteria 654
412 Ga0436362_0281223 3300039453 Bacteria 2828
413 Ga0436362_0441445 3300039453 Bacteria 1001
414 Ga0436362_0866337 3300039453 Unclassified 1631
415 Ga0436362_0916566 3300039453 Bacteria 2987
416 Ga0439465_0184444 3300041413 Bacteria 756
417 Ga0451853_3141489 3300041512 Bacteria 1087
418 Ga0439435_0300896 3300042436 Unclassified 549
419 Ga0439460_0021584 3300042461 Bacteria 1761
420 Ga0451577_0589750 3300042876 Unclassified 1009
421 Ga0466966_0899957 3300044684 Bacteria 534
422 Ga0466961_0015127 3300044693 Bacteria 4953
423 Ga0466963_0032138 3300044694 Bacteria 3397
424 Ga0453684_1638975 3300044712 Unclassified 659
425 Ga0466971_0001849 3300044719 Bacteria 9003
426 Ga0466957_0022038 3300044842 Bacteria 3756
427 Ga0466959_0035307 3300045049 Bacteria 3699
428 Ga0466959_0541016 3300045049 Bacteria 786
429 Ga0451576_2290959 3300045051 Unclassified 554
430 Ga0466958_0006297 3300045836 Bacteria 6450
431 Ga0466967_0062492 3300045976 Bacteria 3306
432 Ga0466967_0404242 3300045976 Bacteria 1329
433 Ga0466967_1011902 3300045976 Bacteria 827
434 Ga0466967_1207472 3300045976 Bacteria 753
435 Ga0466967_1629410 3300045976 Bacteria 643
436 Ga0495603_0004543 3300046455 Bacteria 8280
437 Ga0495603_0020238 3300046455 Unclassified 4034
438 Ga0495603_0131996 3300046455 Bacteria 1454
439 Ga0495629_0201735 3300046459 Bacteria 1375
440 Ga0495641_0397871 3300046461 Bacteria 625
441 Ga0495653_0096247 3300046463 Bacteria 2153
442 Ga0495582_0347339 3300046473 Bacteria 854
443 Ga0495639_0002723 3300046475 Bacteria 7685
444 Ga0495639_0200550 3300046475 Bacteria 976
445 Ga0495639_0399018 3300046475 Bacteria 695
446 Ga0495662_0078847 3300046476 Bacteria 1601
447 Ga0495584_0106071 3300046491 Bacteria 1421
448 Ga0495618_0111604 3300046514 Bacteria 1751
449 Ga0495628_0417585 3300046516 Unclassified 978
450 Ga0495652_0159117 3300046529 Bacteria 1756
451 Ga0495665_0018217 3300046531 Bacteria 3774
452 Ga0495640_0008981 3300046533 Bacteria 7803
453 Ga0495640_0482514 3300046533 Bacteria 755
454 Ga0495587_0042234 3300046536 Bacteria 2719
455 Ga0495587_0341680 3300046536 Bacteria 835
456 Ga0495621_0219082 3300046539 Bacteria 770
457 Ga0495645_0686978 3300046543 Bacteria 622
458 Ga0495622_0224568 3300046557 Bacteria 831
459 Ga0495588_0289966 3300046674 Bacteria 862
460 Ga0495599_0044758 3300046678 Bacteria 2775
461 Ga0495646_0067349 3300046680 Bacteria 2116
462 Ga0495647_0022169 3300046681 Bacteria 2293
463 Ga0495647_0060323 3300046681 Bacteria 1495
464 Ga0495658_0021795 3300046683 Bacteria 3382
465 Ga0495613_0005277 3300046689 Bacteria 9704
466 Ga0495624_0176558 3300046690 Bacteria 1302
467 Ga0495670_0494734 3300046691 Bacteria 664
468 Ga0495581_0001300 3300047315 Bacteria 13769
469 Ga0495581_0090486 3300047315 Bacteria 1775
470 Ga0495581_0188508 3300047315 Bacteria 1206
471 Ga0495604_0314779 3300047317 Bacteria 1047
472 Ga0495674_0013410 3300047319 Bacteria 7707
473 Ga0495674_0023275 3300047319 Bacteria 5711
474 Ga0495674_0105990 3300047319 Bacteria 2388
475 Ga0495674_0201584 3300047319 Bacteria 1650
476 Ga0495676_0131368 3300047321 Bacteria 1807
477 Ga0495676_0168339 3300047321 Bacteria 1544
478 Ga0495676_0725238 3300047321 Bacteria 642
479 Ga0495680_0881545 3300047322 Bacteria 579
480 Ga0495677_0107724 3300047445 Bacteria 1058
481 Ga0495684_0104352 3300047471 Bacteria 2142
482 Ga0495614_0019432 3300048089 Bacteria 2939
483 Ga0496100_0040516 3300048903 Bacteria 2964
484 Ga0496101_0028549 3300048904 Bacteria 3895
485 Ga0496101_0066085 3300048904 Bacteria 2637
486 Ga0496101_0106656 3300048904 Bacteria 2104
487 Ga0496102_0018000 3300048905 Bacteria 6201
488 Ga0496102_0053934 3300048905 Bacteria 3665
489 Ga0496102_0299871 3300048905 Bacteria 1514
490 Ga0496103_0137701 3300048906 Bacteria 1560
491 Ga0496104_0023149 3300048907 Bacteria 5711
492 Ga0496104_0365785 3300048907 Bacteria 1355
493 Ga0496105_0131373 3300048908 Bacteria 2064
494 Ga0496106_0007260 3300048909 Bacteria 8184
495 Ga0496106_0026494 3300048909 Bacteria 4318
496 Ga0496106_0322917 3300048909 Bacteria 1239
497 Ga0496106_1041686 3300048909 Bacteria 642
498 Ga0496107_0008176 3300048910 Bacteria 7233
499 Ga0496107_0059858 3300048910 Bacteria 2756
500 Ga0496107_1055991 3300048910 Bacteria 588
501 Ga0496108_0269387 3300048911 Bacteria 1482
502 Ga0496108_1444925 3300048911 Bacteria 574
503 Ga0496109_0162953 3300048912 Bacteria 2089
504 Ga0496110_0138248 3300048913 Bacteria 2202
505 Ga0496111_0100855 3300048914 Bacteria 2121
506 Ga0496112_1286900 3300048915 Bacteria 647
507 Ga0496113_0282175 3300048916 Bacteria 1328
508 Ga0496114_0034202 3300048917 Bacteria 4191
509 Ga0496114_0460802 3300048917 Bacteria 1125
510 Ga0496114_1369623 3300048917 Bacteria 595
511 Ga0496126_0000539 3300048929 Bacteria 73256
512 Ga0501308_071833 3300049128 Unclassified 539
513 Ga0501033_0402184 3300049570 Bacteria 955
514 Ga0501034_0743430 3300049571 Bacteria 877
515 Ga0501036_0034845 3300049572 Bacteria 4259
516 Ga0501036_0644439 3300049572 Bacteria 877
517 Ga0501036_1037681 3300049572 Unclassified 671
518 Ga0501038_0406798 3300049574 Bacteria 1052
519 Ga0501038_1286982 3300049574 Unclassified 528
520 Ga0501039_0067611 3300049575 Bacteria 2775
521 Ga0501040_0062535 3300049576 Bacteria 2561
522 Ga0501040_0515226 3300049576 Bacteria 862
523 Ga0501040_0927969 3300049576 Bacteria 631
524 Ga0501041_0034256 3300049577 Bacteria 3074
525 Ga0501041_0138510 3300049577 Bacteria 1517
526 Ga0501041_1029599 3300049577 Bacteria 530
527 Ga0501042_0028539 3300049578 Bacteria 3933
528 Ga0501042_0264898 3300049578 Bacteria 1241
529 Ga0501042_0793075 3300049578 Bacteria 689
530 Ga0501043_1270383 3300049579 Bacteria 515
531 Ga0501046_0866407 3300049580 Bacteria 631
532 Ga0501048_0845853 3300049582 Bacteria 658
533 Ga0501067_0143662 3300049583 Bacteria 1329
534 Ga0501068_0020409 3300049584 Bacteria 3860
535 Ga0501071_0223764 3300049587 Bacteria 1417
536 Ga0501071_0344478 3300049587 Bacteria 1134
537 Ga0501071_1214552 3300049587 Bacteria 582
538 Ga0501071_1454771 3300049587 Bacteria 529
539 Ga0501072_0242926 3300049588 Bacteria 1434
540 Ga0501072_0288756 3300049588 Bacteria 1304
541 Ga0501072_1549078 3300049588 Bacteria 511
542 Ga0501073_1148234 3300049589 Bacteria 534
543 Ga0501075_0123630 3300049591 Bacteria 1970
544 Ga0501075_0128560 3300049591 Bacteria 1929
545 Ga0501075_0294657 3300049591 Bacteria 1236
546 Ga0501075_0586216 3300049591 Bacteria 851
547 Ga0501075_0624946 3300049591 Bacteria 821
548 Ga0501076_0145879 3300049592 Bacteria 1924
549 Ga0501076_1042038 3300049592 Unclassified 674
550 Ga0501206_088538 3300049653 Unclassified 547
551 Ga0501216_143141 3300049660 Unclassified 563
552 Ga0501245_045413 3300049708 Bacteria 766
553 Ga0501079_0152221 3300049741 Bacteria 1803
554 Ga0501080_1247417 3300049742 Unclassified 638
555 Ga0501081_0114748 3300049743 Bacteria 1914
556 Ga0501283_082693 3300049779 Bacteria 606
557 Ga0501035_0300673 3300049822 Bacteria 1352
558 Ga0501035_0514808 3300049822 Bacteria 984
559 Ga0501045_0108036 3300049824 Bacteria 2062
560 Ga0501045_0234179 3300049824 Bacteria 1367
561 Ga0501045_0600410 3300049824 Bacteria 815
562 nmdc:mga00v17_777404_c1 3300050491 Bacteria 611
563 nmdc:mga05p37_1291131_c1 3300050507 Bacteria 745
564 nmdc:mga05p37_1921983_c1 3300050507 Bacteria 564
565 nmdc:mga05p37_242017_c1 3300050507 Bacteria 2169
566 nmdc:mga05p37_276619_c1 3300050507 Unclassified 2004
567 nmdc:mga05p37_479520_c1 3300050507 Bacteria 1433
568 nmdc:mga05p37_488738_c1 3300050507 Bacteria 1416
569 nmdc:mga09592_120918_c1 3300050508 Bacteria 2249
570 nmdc:mga09592_192249_c1 3300050508 Bacteria 1766
571 nmdc:mga09592_371497_c1 3300050508 Bacteria 1237
572 nmdc:mga09592_37733_c1 3300050508 Unclassified 4054
573 nmdc:mga0qj67_133119_c1 3300050509 Bacteria 2014
574 nmdc:mga0qj67_2206_c1 3300050509 Bacteria 13843
575 nmdc:mga0qj67_990258_c1 3300050509 Bacteria 660
576 nmdc:mga06r32_1338661_c1 3300050510 Bacteria 659
577 nmdc:mga06r32_150974_c1 3300050510 Bacteria 2302
578 nmdc:mga06r32_1522948_c1 3300050510 Unclassified 609
579 nmdc:mga06r32_204201_c1 3300050510 Bacteria 1964
580 nmdc:mga06r32_232877_c1 3300050510 Bacteria 1830
581 nmdc:mga06r32_294935_c1 3300050510 Bacteria 1608
582 nmdc:mga06r32_355888_c1 3300050510 Bacteria 1448
583 nmdc:mga06r32_54835_c1 3300050510 Bacteria 3823
584 nmdc:mga08y16_173976_c1 3300050511 Bacteria 2235
585 nmdc:mga08y16_288713_c1 3300050511 Bacteria 1691
586 nmdc:mga08y16_4777_c1 3300050511 Bacteria 14136
587 nmdc:mga08y16_521438_c1 3300050511 Bacteria 1205
588 nmdc:mga08y16_58157_c1 3300050511 Unclassified 4040
589 nmdc:mga08y16_71625_c1 3300050511 Bacteria 3612
590 nmdc:mga08y16_988169_c1 3300050511 Unclassified 822
591 nmdc:mga0n895_327911_c1 3300050512 Bacteria 1551
592 nmdc:mga0n895_7152_c1 3300050512 Bacteria 9548
593 nmdc:mga0n895_843_c1 3300050512 Bacteria 21999
594 nmdc:mga0rr50_1196982_c1 3300050513 Bacteria 645
595 nmdc:mga0rr50_3648_c1 3300050513 Bacteria 8904
596 nmdc:mga0rr50_68240_c1 3300050513 Bacteria 2704
597 nmdc:mga0rr50_9388_c1 3300050513 Bacteria 6145
598 nmdc:mga08x19_1015178_c1 3300050514 Bacteria 589
599 nmdc:mga08x19_11078_c1 3300050514 Bacteria 5428
600 nmdc:mga08x19_217684_c1 3300050514 Bacteria 1312
601 nmdc:mga08x19_335271_c1 3300050514 Unclassified 1054
602 nmdc:mga0a205_17317_c1 3300050515 Bacteria 6752
603 nmdc:mga0a205_1756_c1 3300050515 Bacteria 18761
604 nmdc:mga0a205_2421_c1 3300050515 Bacteria 16450
605 Ga0495601_0271952 3300053077 Bacteria 1105
606 Ga0495612_0334121 3300053078 Bacteria 683
607 Ga0495655_0156222 3300053083 Bacteria 721
608 Ga0495595_0180862 3300053084 Bacteria 1045
609 Ga0501084_0125507 3300054114 Bacteria 2160
610 Ga0501084_0447353 3300054114 Bacteria 1092
611 Ga0501084_0578513 3300054114 Bacteria 949
612 Ga0501084_0590670 3300054114 Bacteria 938
613 Ga0501084_0969302 3300054114 Bacteria 715
614 Ga0587105_020419 3300059651 Bacteria 577
615 Ga0501082_0394810 3300060353 Bacteria 1207
616 Ga0501082_0406566 3300060353 Bacteria 1188
617 Ga0501082_0651395 3300060353 Unclassified 922
618 Ga0501082_0939145 3300060353 Bacteria 756
619 Ga0501082_1187357 3300060353 Bacteria 667
620 Ga0466962_0006680 3300061719 Bacteria 5531
621 Ga0530510_0084374 3300061734 Bacteria 2314
622 Ga0530510_0331408 3300061734 Bacteria 1142
623 Ga0157375_10658469
624 MBSR1b_contig_3493839
625 JGI25406J46586_10203829
626 Ga0065712_10148453
627 Ga0065715_10212711
628 Ga0065715_10381403
629 Ga0065707_10230766
630 Ga0070658_10082132
631 Ga0070683_100084594
632 Ga0070683_100119758
633 Ga0070690_100009726
634 Ga0070690_100896841
635 Ga0070677_10039884
636 Ga0068869_100428902
637 Ga0068869_100474881
638 Ga0070666_10302314
639 Ga0070680_100011353
640 Ga0070682_100146942
641 Ga0070682_100233263
642 Ga0070682_101068556
643 Ga0068868_100058137
644 Ga0070660_100049151
645 Ga0070689_100134044
646 Ga0070689_100293771
647 Ga0070691_10043437
648 Ga0070687_100058927
649 Ga0070687_100271455
650 Ga0070661_100047912
651 Ga0070692_10183275
652 Ga0070692_10480647
653 Ga0070668_100202035
654 Ga0070668_100683055
655 Ga0070668_100887757
656 Ga0070669_100238472
657 Ga0070675_100006962
658 Ga0070671_100519556
659 Ga0070671_100727545
660 Ga0070674_100014238
661 Ga0070674_100152671
662 Ga0070674_100336574
663 Ga0070688_100002101
664 Ga0070659_101314067
665 Ga0070667_100722139
666 Ga0070709_10004965
667 Ga0070709_10341722
668 Ga0070714_100009913
669 Ga0070714_100018236
670 Ga0070714_100336461
671 Ga0070713_100078431
672 Ga0070710_10221271
673 Ga0070701_10179852
674 Ga0070701_10742441
675 Ga0070711_100022822
676 Ga0070711_100223909
677 Ga0070711_100223912
678 Ga0070711_100276632
679 Ga0070705_100104080
680 Ga0070700_100101169
681 Ga0070694_100036212
682 Ga0070694_100271885
683 Ga0070708_100061050
684 Ga0070708_100066416
685 Ga0070708_100566426
686 Ga0070708_100891513
687 Ga0070678_100005206
688 Ga0070678_100312566
689 Ga0070678_100975486
690 Ga0070681_10368118
691 Ga0068867_100108654
692 Ga0070685_10006067
693 Ga0070706_100021897
694 Ga0070706_100056456
695 Ga0070707_100040008
696 Ga0070707_100081392
697 Ga0070707_100229410
698 Ga0070707_100946803
699 Ga0070698_100005989
700 Ga0070698_100058543
701 Ga0070698_100504311
702 Ga0070698_101695975
703 Ga0070699_100012415
704 Ga0070699_100226009
705 Ga0070699_100382315
706 Ga0070679_100339467
707 Ga0070679_100588410
708 Ga0070684_100181887
709 Ga0070684_100442684
710 Ga0070684_101924100
711 Ga0070684_102319164
712 Ga0070697_100112657
713 Ga0070697_100136423
714 Ga0070697_101214159
715 Ga0070686_100006406
716 Ga0070686_100083615
717 Ga0070686_100190022
718 Ga0070695_100012579
719 Ga0070695_100040195
720 Ga0070696_100012995
721 Ga0070696_100266489
722 Ga0070696_100568124
723 Ga0070704_100008220
724 Ga0070704_100189515
725 Ga0070704_100261194
726 Ga0070704_101184730
727 Ga0070664_100999819
728 Ga0068857_100149525
729 Ga0068854_100382553
730 Ga0068854_101581959
731 Ga0068856_100100503
732 Ga0068856_100363584
733 Ga0070702_100218790
734 Ga0070702_100302767
735 Ga0070702_100639276
736 Ga0068852_100007831
737 Ga0068859_100015971
738 Ga0068866_10046614
739 Ga0068861_100777528
740 Ga0068863_102340361
741 Ga0068858_100507242
742 Ga0068858_101852004
743 Ga0068860_100047578
744 Ga0068860_101824728
745 Ga0081455_10009022
746 Ga0081538_10228377
747 Ga0081538_10291972
748 Ga0081539_10092261
749 Ga0081539_10216704
750 Ga0081539_10220164
751 Ga0070717_10768854
752 Ga0075364_10608030
753 Ga0075432_10003502
754 Ga0075432_10043705
755 Ga0070715_10075099
756 Ga0070716_100099965
757 Ga0070712_100016681
758 Ga0070712_100282415
759 Ga0097621_100033744
760 Ga0075428_100006302
761 Ga0075428_100093332
762 Ga0075428_100229188
763 Ga0075430_100010912
764 Ga0075430_100037281
765 Ga0075430_100081686
766 Ga0075430_100387921
767 Ga0075430_101000425
768 Ga0075431_100076349
769 Ga0075431_100183278
770 Ga0075431_100261453
771 Ga0075431_100426091
772 Ga0075431_100439701
773 Ga0075433_10040994
774 Ga0075434_100012776
775 Ga0075434_101215628
776 Ga0075429_100012102
777 Ga0075429_100059015
778 Ga0075429_100079382
779 Ga0075429_100205314
780 Ga0075429_100320975
781 Ga0075436_100007639
782 Ga0075436_100061647
783 Ga0097620_100015971
784 Ga0075435_100005144
785 Ga0075435_100022599
786 Ga0075435_100061337
787 Ga0105240_10101991
788 Ga0111539_10003502
789 Ga0111539_10029464
790 Ga0111539_10060072
791 Ga0111539_10065416
792 Ga0111539_10391761
793 Ga0111539_10625692
794 Ga0111539_11331819
795 Ga0105245_10140384
796 Ga0105245_10359280
797 Ga0105245_12366309
798 Ga0105247_10043713
799 Ga0114129_10009365
800 Ga0114129_10011069
801 Ga0114129_10152331
802 Ga0114129_10263634
803 Ga0114129_10314421
804 Ga0114129_10610355
805 Ga0114129_10679328
806 Ga0114129_10856213
807 Ga0114129_11592277
808 Ga0114129_11596330
809 Ga0105243_10006745
810 Ga0105243_10008950
811 Ga0105243_10021907
812 Ga0105243_10171969
813 Ga0105243_12670574
814 Ga0105241_10023225
815 Ga0105242_10006694
816 Ga0105242_10011432
817 Ga0105242_10023168
818 Ga0105248_10032145
819 Ga0105237_10041255
820 Ga0105238_10012331
821 Ga0105249_10084353
822 Ga0105249_10132465
823 Ga0105249_10342207
824 Ga0105239_11543817
825 Ga0105246_10221937
826 Ga0105246_11146559
827 Ga0157347_1029025
828 Ga0157370_10050656
829 Ga0157369_10269840
830 Ga0157378_10012432
831 Ga0157378_10320681
832 Ga0157378_12650877
833 Ga0163162_10178508
834 Ga0163162_10227715
835 Ga0163162_10462083
836 Ga0163162_12948434
837 Ga0157372_10103617
838 Ga0157372_11626323
839 Ga0157375_10004626
840 Ga0157375_12757118
841 Ga0157380_10100108
842 Ga0157380_11213199
843 Ga0157377_10475439
844 Ga0157379_10018413
845 Ga0157376_10173322
846 Ga0157376_10300300
847 Ga0163161_11039913
848 Ga0197907_11187969
849 Ga0206356_11649257
850 Ga0206349_1189951
851 Ga0206351_10316504
852 Ga0206352_10429268
853 Ga0206350_11578042
854 Ga0206354_11493155
855 Ga0206353_10530369
856 Ga0206353_10731401
857 Ga0213873_10093614
858 Ga0213873_10102409
859 Ga0213873_10110381
860 Ga0213873_10134721
861 Ga0213874_10192862
862 Ga0213876_10007374
863 Ga0213876_10009623
864 Ga0213876_10448866
865 Ga0213875_10006050
866 Ga0213875_10169329
867 Ga0224712_10178545
868 Ga0224712_10188051
869 Ga0228598_1002791
870 Ga0207682_10004555
871 Ga0207692_10181779
872 Ga0207692_10259957
873 Ga0207642_10219667
874 Ga0207710_10073724
875 Ga0207680_10077436
876 Ga0207699_10002143
877 Ga0207699_10200686
878 Ga0207705_10024461
879 Ga0207705_10758668
880 Ga0207684_10048138
881 Ga0207684_10976032
882 Ga0207654_10393103
883 Ga0207707_10031066
884 Ga0207707_10282253
885 Ga0207707_11032500
886 Ga0207695_10083982
887 Ga0207671_10088848
888 Ga0207693_10022438
889 Ga0207693_10361518
890 Ga0207693_10976189
891 Ga0207663_10029479
892 Ga0207663_10289864
893 Ga0207663_10721174
894 Ga0207660_10255277
895 Ga0207660_10518128
896 Ga0207662_10067179
897 Ga0207662_10166049
898 Ga0207662_10901501
899 Ga0207657_10015071
900 Ga0207649_10245415
901 Ga0207652_10018200
902 Ga0207646_10009116
903 Ga0207646_10043339
904 Ga0207646_10183758
905 Ga0207646_10805046
906 Ga0207646_11444120
907 Ga0207681_10961319
908 Ga0207694_10096787
909 Ga0207659_10016529
910 Ga0207659_10858736
911 Ga0207687_10892318
912 Ga0207687_11864462
913 Ga0207700_10123421
914 Ga0207700_10163192
915 Ga0207664_10012995
916 Ga0207664_10043000
917 Ga0207664_10204515
918 Ga0207686_10026098
919 Ga0207686_10092643
920 Ga0207709_10087563
921 Ga0207709_10252952
922 Ga0207709_10623772
923 Ga0207669_10037265
924 Ga0207669_10082315
925 Ga0207669_10203325
926 Ga0207669_10754384
927 Ga0207704_10032674
928 Ga0207704_11713764
929 Ga0207665_10441186
930 Ga0207691_11000664
931 Ga0207711_10043297
932 Ga0207689_10117172
933 Ga0207689_11117611
934 Ga0207689_11194212
935 Ga0207661_10042041
936 Ga0207661_10289569
937 Ga0207712_10081924
938 Ga0207712_10169929
939 Ga0207668_10165355
940 Ga0207640_10417105
941 Ga0207640_10732797
942 Ga0207703_10134432
943 Ga0207678_10036754
944 Ga0207708_10080187
945 Ga0207708_10169470
946 Ga0207708_10896439
947 Ga0207702_10735487
948 Ga0207641_11778219
949 Ga0207648_10003843
950 Ga0207648_10726199
951 Ga0207674_10226625
952 Ga0207675_100055389
953 Ga0207675_100274300
954 Ga0207683_10003328
955 Ga0207683_10308113
956 Ga0207683_10632715
957 Ga0207683_10668898
958 Ga0207698_10262179
959 Ga0207428_10003020
960 Ga0207428_10003077
961 Ga0207428_10062545
962 Ga0207428_10176975
963 Ga0268264_10547785
964 Ga0268264_11993833
965 Ga0265318_10024197
966 Ga0265324_10245697
967 Ga0265762_1032362
968 Ga0265760_10017386
969 Ga0265320_10214407
970 Ga0307408_100034641
971 Ga0307408_101357197
972 Ga0307508_10824368
973 Ga0307405_10001535
974 Ga0307405_10914174
975 Ga0307413_10013152
976 Ga0307410_10000299
977 Ga0307410_10391155
978 Ga0307410_10444846
979 Ga0307410_11642814
980 Ga0307406_10026004
981 Ga0307406_10539068
982 Ga0307406_10851600
983 Ga0307407_10004393
984 Ga0307407_11455151
985 Ga0307412_10068639
986 Ga0307409_100043751
987 Ga0307409_100336206
988 Ga0307409_100955486
989 Ga0307409_101293445
990 Ga0307416_100007581
991 Ga0307416_101324777
992 Ga0307416_102395826
993 Ga0307414_10038669
994 Ga0307411_10007544
995 Ga0307415_100001873
996 Ga0307415_100948100
997 Ga0373923_0214393
998 Ga0373939_0192255
999 Ga0373956_0053494
1000 Ga0373957_0258715
1001 Ga0373961_0164054
1002 Ga0373935_0116768
1003 Ga0373935_0239654
1004 Ga0373933_0010869
1005 Ga0373947_0132588
1006 Ga0373947_0516781
1007 Ga0373925_0274659
1008 Ga0373925_0617300
1009 Ga0395900_0459520
1010 Ga0395898_1362125
1011 Ga0436364_0507893
1012 Ga0436364_0571319
1013 Ga0436364_0718230
1014 Ga0436364_0912106
1015 Ga0436364_1464743
1016 Ga0436364_1523838
1017 Ga0436365_0009952
1018 Ga0436365_0148245
1019 Ga0436365_0434757
1020 Ga0436365_0716929
1021 Ga0436365_0740890
1022 Ga0436365_1295859
1023 Ga0436360_0398132
1024 Ga0436360_0911708
1025 Ga0436360_1178628
1026 Ga0436361_0025781
1027 Ga0436363_0063930
1028 Ga0436363_0431896
1029 Ga0436363_0763765
1030 Ga0436363_1111064
1031 Ga0436363_1154611
1032 Ga0436362_0038805
1033 Ga0436362_0214587
1034 Ga0436362_0281223
1035 Ga0436362_0441445
1036 Ga0436362_0866337
1037 Ga0436362_0916566
1038 Ga0439465_0184444
1039 Ga0451853_3141489
1040 Ga0439435_0300896
1041 Ga0439460_0021584
1042 Ga0451577_0589750
1043 Ga0466966_0899957
1044 Ga0466961_0015127
1045 Ga0466963_0032138
1046 Ga0453684_1638975
1047 Ga0466971_0001849
1048 Ga0466957_0022038
1049 Ga0466959_0035307
1050 Ga0466959_0541016
1051 Ga0451576_2290959
1052 Ga0466958_0006297
1053 Ga0466967_0062492
1054 Ga0466967_0404242
1055 Ga0466967_1011902
1056 Ga0466967_1207472
1057 Ga0466967_1629410
1058 Ga0495603_0004543
1059 Ga0495603_0020238
1060 Ga0495603_0131996
1061 Ga0495629_0201735
1062 Ga0495641_0397871
1063 Ga0495653_0096247
1064 Ga0495582_0347339
1065 Ga0495639_0002723
1066 Ga0495639_0200550
1067 Ga0495639_0399018
1068 Ga0495662_0078847
1069 Ga0495584_0106071
1070 Ga0495618_0111604
1071 Ga0495628_0417585
1072 Ga0495652_0159117
1073 Ga0495665_0018217
1074 Ga0495640_0008981
1075 Ga0495640_0482514
1076 Ga0495587_0042234
1077 Ga0495587_0341680
1078 Ga0495621_0219082
1079 Ga0495645_0686978
1080 Ga0495622_0224568
1081 Ga0495588_0289966
1082 Ga0495599_0044758
1083 Ga0495646_0067349
1084 Ga0495647_0022169
1085 Ga0495647_0060323
1086 Ga0495658_0021795
1087 Ga0495613_0005277
1088 Ga0495624_0176558
1089 Ga0495670_0494734
1090 Ga0495581_0001300
1091 Ga0495581_0090486
1092 Ga0495581_0188508
1093 Ga0495604_0314779
1094 Ga0495674_0013410
1095 Ga0495674_0023275
1096 Ga0495674_0105990
1097 Ga0495674_0201584
1098 Ga0495676_0131368
1099 Ga0495676_0168339
1100 Ga0495676_0725238
1101 Ga0495680_0881545
1102 Ga0495677_0107724
1103 Ga0495684_0104352
1104 Ga0495614_0019432
1105 Ga0496100_0040516
1106 Ga0496101_0028549
1107 Ga0496101_0066085
1108 Ga0496101_0106656
1109 Ga0496102_0018000
1110 Ga0496102_0053934
1111 Ga0496102_0299871
1112 Ga0496103_0137701
1113 Ga0496104_0023149
1114 Ga0496104_0365785
1115 Ga0496105_0131373
1116 Ga0496106_0007260
1117 Ga0496106_0026494
1118 Ga0496106_0322917
1119 Ga0496106_1041686
1120 Ga0496107_0008176
1121 Ga0496107_0059858
1122 Ga0496107_1055991
1123 Ga0496108_0269387
1124 Ga0496108_1444925
1125 Ga0496109_0162953
1126 Ga0496110_0138248
1127 Ga0496111_0100855
1128 Ga0496112_1286900
1129 Ga0496113_0282175
1130 Ga0496114_0034202
1131 Ga0496114_0460802
1132 Ga0496114_1369623
1133 Ga0496126_0000539
1134 Ga0501308_071833
1135 Ga0501033_0402184
1136 Ga0501034_0743430
1137 Ga0501036_0034845
1138 Ga0501036_0644439
1139 Ga0501036_1037681
1140 Ga0501038_0406798
1141 Ga0501038_1286982
1142 Ga0501039_0067611
1143 Ga0501040_0062535
1144 Ga0501040_0515226
1145 Ga0501040_0927969
1146 Ga0501041_0034256
1147 Ga0501041_0138510
1148 Ga0501041_1029599
1149 Ga0501042_0028539
1150 Ga0501042_0264898
1151 Ga0501042_0793075
1152 Ga0501043_1270383
1153 Ga0501046_0866407
1154 Ga0501048_0845853
1155 Ga0501067_0143662
1156 Ga0501068_0020409
1157 Ga0501071_0223764
1158 Ga0501071_0344478
1159 Ga0501071_1214552
1160 Ga0501071_1454771
1161 Ga0501072_0242926
1162 Ga0501072_0288756
1163 Ga0501072_1549078
1164 Ga0501073_1148234
1165 Ga0501075_0123630
1166 Ga0501075_0128560
1167 Ga0501075_0294657
1168 Ga0501075_0586216
1169 Ga0501075_0624946
1170 Ga0501076_0145879
1171 Ga0501076_1042038
1172 Ga0501206_088538
1173 Ga0501216_143141
1174 Ga0501245_045413
1175 Ga0501079_0152221
1176 Ga0501080_1247417
1177 Ga0501081_0114748
1178 Ga0501283_082693
1179 Ga0501035_0300673
1180 Ga0501035_0514808
1181 Ga0501045_0108036
1182 Ga0501045_0234179
1183 Ga0501045_0600410
1184 nmdc:mga00v17_777404_c1
1185 nmdc:mga05p37_1291131_c1
1186 nmdc:mga05p37_1921983_c1
1187 nmdc:mga05p37_242017_c1
1188 nmdc:mga05p37_276619_c1
1189 nmdc:mga05p37_479520_c1
1190 nmdc:mga05p37_488738_c1
1191 nmdc:mga09592_120918_c1
1192 nmdc:mga09592_192249_c1
1193 nmdc:mga09592_371497_c1
1194 nmdc:mga09592_37733_c1
1195 nmdc:mga0qj67_133119_c1
1196 nmdc:mga0qj67_2206_c1
1197 nmdc:mga0qj67_990258_c1
1198 nmdc:mga06r32_1338661_c1
1199 nmdc:mga06r32_150974_c1
1200 nmdc:mga06r32_1522948_c1
1201 nmdc:mga06r32_204201_c1
1202 nmdc:mga06r32_232877_c1
1203 nmdc:mga06r32_294935_c1
1204 nmdc:mga06r32_355888_c1
1205 nmdc:mga06r32_54835_c1
1206 nmdc:mga08y16_173976_c1
1207 nmdc:mga08y16_288713_c1
1208 nmdc:mga08y16_4777_c1
1209 nmdc:mga08y16_521438_c1
1210 nmdc:mga08y16_58157_c1
1211 nmdc:mga08y16_71625_c1
1212 nmdc:mga08y16_988169_c1
1213 nmdc:mga0n895_327911_c1
1214 nmdc:mga0n895_7152_c1
1215 nmdc:mga0n895_843_c1
1216 nmdc:mga0rr50_1196982_c1
1217 nmdc:mga0rr50_3648_c1
1218 nmdc:mga0rr50_68240_c1
1219 nmdc:mga0rr50_9388_c1
1220 nmdc:mga08x19_1015178_c1
1221 nmdc:mga08x19_11078_c1
1222 nmdc:mga08x19_217684_c1
1223 nmdc:mga08x19_335271_c1
1224 nmdc:mga0a205_17317_c1
1225 nmdc:mga0a205_1756_c1
1226 nmdc:mga0a205_2421_c1
1227 Ga0495601_0271952
1228 Ga0495612_0334121
1229 Ga0495655_0156222
1230 Ga0495595_0180862
1231 Ga0501084_0125507
1232 Ga0501084_0447353
1233 Ga0501084_0578513
1234 Ga0501084_0590670
1235 Ga0501084_0969302
1236 Ga0587105_020419
1237 Ga0501082_0394810
1238 Ga0501082_0406566
1239 Ga0501082_0651395
1240 Ga0501082_0939145
1241 Ga0501082_1187357
1242 Ga0466962_0006680
1243 Ga0530510_0084374
1244 Ga0530510_0331408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7952 35 116
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7947 35 116
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.7919 35 116
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.7907 24 114
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.7904 35 116
ID Description Score Start End Superfamily
af_Q59WJ5_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8145 60 115 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7885 23 113 2.60.120.10
af_Q20340_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7866 60 114 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7842 24 114 2.60.120.10
3lwcA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7703 23 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A428YSW6-F1-model_v4 Cupin 0.9993 5 121
AF-A0A2X0IWS0-F1-model_v4 Nuclear transport factor 2 family protein 0.9929 5 120
AF-A0A4S4ATR5-F1-model_v4 Cupin 0.9928 5 123
AF-A0A133LL57-F1-model_v4 Cupin domain-containing protein 0.9922 7 123
AF-A0A1G1H6Q6-F1-model_v4 Cupin 0.992 7 123

Map