F470094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 622 | 336 | 602 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10007472|Ga0105238_100074728 |
| Length | 296 |
| Sequence | MPLLFFVRVGAAARMLDFPFIQQKREGRMGRLAGKKAVILGASSPGNMGQHIARRFLAEGASVLVSGRKADVIEAFADETGSAWLACDLTDEASIAALGEGAMAQLGGVEIAVNATGWGFLKPFLDNDRAELEAITALQFIGPFQFFQAMIRKMGTAHGGRGGSLIQISSATATIMLNDHAAYMGTKAGTDHVIRCIAHEFGKEGIRANSISPGLTETPMTVDATAVPGLVEAFLPGYPLGRIGTSDDIAAAAVWLASDECFMTGENLQVNGGLTLRRNPTPEEMAASMARAAGQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 4 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 9 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 10 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 11 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 12 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 13 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 14 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 15 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 16 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 17 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 18 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 19 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 20 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 21 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 25 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 232 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 301 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 302 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 307 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 308 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 315 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 316 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 319 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 320 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 336 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.95 |
| Metatranscriptomes | 0 |
| Isolates | 3.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.89 |
| Nodule | 0.48 |
| Rhizoplane | 5.95 |
| Rhizosphere | 81.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_949771 | 2162886007 | Bacteria | 4752 |
| 2 | JGI24736J21556_1000085 | 3300001904 | Bacteria | 15412 |
| 3 | JGI24736J21556_1019188 | 3300001904 | Bacteria | 1080 |
| 4 | JGI24741J21665_1000031 | 3300001915 | Bacteria | 33403 |
| 5 | JGI24741J21665_1010126 | 3300001915 | Bacteria | 1702 |
| 6 | JGI24752J21851_1000158 | 3300001976 | Bacteria | 9244 |
| 7 | JGI24740J21852_10000098 | 3300001979 | Bacteria | 30614 |
| 8 | JGI24739J22299_10002627 | 3300001989 | Bacteria | 6923 |
| 9 | JGI24739J22299_10029189 | 3300001989 | Bacteria | 1919 |
| 10 | JGI24737J22298_10000085 | 3300001990 | Bacteria | 27466 |
| 11 | JGI24750J21931_1003840 | 3300002070 | Bacteria | 1808 |
| 12 | JGI24748J21848_1000086 | 3300002074 | Bacteria | 27519 |
| 13 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 14 | JGI24742J22300_10001489 | 3300002244 | Bacteria | 3703 |
| 15 | JGI24751J29686_10001596 | 3300002459 | Bacteria | 4685 |
| 16 | rootH1_10115529 | 3300003323 | Bacteria | 3027 |
| 17 | Ga0065704_10001355 | 3300005289 | Bacteria | 15867 |
| 18 | Ga0065712_10211592 | 3300005290 | Unclassified | 1071 |
| 19 | Ga0065715_10026849 | 3300005293 | Bacteria | 1188 |
| 20 | Ga0070658_10002088 | 3300005327 | Bacteria | 16743 |
| 21 | Ga0070658_10016771 | 3300005327 | Bacteria | 5863 |
| 22 | Ga0070658_10059168 | 3300005327 | Bacteria | 3120 |
| 23 | Ga0070658_10291477 | 3300005327 | Bacteria | 1391 |
| 24 | Ga0070676_10000512 | 3300005328 | Bacteria | 18570 |
| 25 | Ga0070683_100186020 | 3300005329 | Bacteria | 1972 |
| 26 | Ga0070690_100000006 | 3300005330 | Bacteria | 132992 |
| 27 | Ga0070690_100040550 | 3300005330 | Bacteria | 2945 |
| 28 | Ga0070670_100000046 | 3300005331 | Bacteria | 138621 |
| 29 | Ga0070670_100088333 | 3300005331 | Bacteria | 2665 |
| 30 | Ga0070677_10059409 | 3300005333 | Bacteria | 1572 |
| 31 | Ga0068869_100003432 | 3300005334 | Bacteria | 9689 |
| 32 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 33 | Ga0070666_10004720 | 3300005335 | Bacteria | 8333 |
| 34 | Ga0070680_100041415 | 3300005336 | Bacteria | 3735 |
| 35 | Ga0068868_100052835 | 3300005338 | Bacteria | 3199 |
| 36 | Ga0070660_100000403 | 3300005339 | Bacteria | 28790 |
| 37 | Ga0070660_100103557 | 3300005339 | Bacteria | 2257 |
| 38 | Ga0070689_100360482 | 3300005340 | Bacteria | 1221 |
| 39 | Ga0070661_100000046 | 3300005344 | Bacteria | 92262 |
| 40 | Ga0070661_100000720 | 3300005344 | Bacteria | 24214 |
| 41 | Ga0070668_100000066 | 3300005347 | Bacteria | 65221 |
| 42 | Ga0070668_100017348 | 3300005347 | Bacteria | 5392 |
| 43 | Ga0070669_100000116 | 3300005353 | Bacteria | 75907 |
| 44 | Ga0070669_100005421 | 3300005353 | Bacteria | 9201 |
| 45 | Ga0070669_100034012 | 3300005353 | Bacteria | 3689 |
| 46 | Ga0070675_100007411 | 3300005354 | Bacteria | 8474 |
| 47 | Ga0070671_100006317 | 3300005355 | Bacteria | 9451 |
| 48 | Ga0070671_100006590 | 3300005355 | Bacteria | 9280 |
| 49 | Ga0070671_100117104 | 3300005355 | Bacteria | 2240 |
| 50 | Ga0070671_100333157 | 3300005355 | Bacteria | 1294 |
| 51 | Ga0070674_100035748 | 3300005356 | Bacteria | 3329 |
| 52 | Ga0070674_100371928 | 3300005356 | Bacteria | 1160 |
| 53 | Ga0070673_100006452 | 3300005364 | Bacteria | 7625 |
| 54 | Ga0070659_100001027 | 3300005366 | Bacteria | 20434 |
| 55 | Ga0070659_100071295 | 3300005366 | Bacteria | 2762 |
| 56 | Ga0070667_100010853 | 3300005367 | Bacteria | 7533 |
| 57 | Ga0070667_100022623 | 3300005367 | Bacteria | 5212 |
| 58 | Ga0070667_100092462 | 3300005367 | Bacteria | 2603 |
| 59 | Ga0070709_10373977 | 3300005434 | Bacteria | 1058 |
| 60 | Ga0070709_10376230 | 3300005434 | Bacteria | 1055 |
| 61 | Ga0070714_100094079 | 3300005435 | Bacteria | 2630 |
| 62 | Ga0070713_100001372 | 3300005436 | Bacteria | 15583 |
| 63 | Ga0070711_100014843 | 3300005439 | Bacteria | 4919 |
| 64 | Ga0070678_100530970 | 3300005456 | Bacteria | 1042 |
| 65 | Ga0070662_100003634 | 3300005457 | Bacteria | 9627 |
| 66 | Ga0070662_100425994 | 3300005457 | Bacteria | 1098 |
| 67 | Ga0068867_100004028 | 3300005459 | Bacteria | 10336 |
| 68 | Ga0068867_100024296 | 3300005459 | Bacteria | 4342 |
| 69 | Ga0068867_100170745 | 3300005459 | Bacteria | 1722 |
| 70 | Ga0068867_100220811 | 3300005459 | Unclassified | 1527 |
| 71 | Ga0070707_100113693 | 3300005468 | Bacteria | 2627 |
| 72 | Ga0070707_100146208 | 3300005468 | Bacteria | 2301 |
| 73 | Ga0068853_100008767 | 3300005539 | Bacteria | 8135 |
| 74 | Ga0068853_100680318 | 3300005539 | Bacteria | 980 |
| 75 | Ga0070672_100024584 | 3300005543 | Bacteria | 4455 |
| 76 | Ga0070672_100061098 | 3300005543 | Bacteria | 2969 |
| 77 | Ga0070686_100000012 | 3300005544 | Bacteria | 176038 |
| 78 | Ga0070696_100200912 | 3300005546 | Unclassified | 1488 |
| 79 | Ga0070665_100012084 | 3300005548 | Bacteria | 8711 |
| 80 | Ga0070665_100083473 | 3300005548 | Bacteria | 3199 |
| 81 | Ga0068855_100000336 | 3300005563 | Bacteria | 58477 |
| 82 | Ga0068855_100241539 | 3300005563 | Bacteria | 2018 |
| 83 | Ga0070664_100007227 | 3300005564 | Bacteria | 8958 |
| 84 | Ga0070664_100142237 | 3300005564 | Bacteria | 2113 |
| 85 | Ga0070664_100171531 | 3300005564 | Bacteria | 1924 |
| 86 | Ga0068857_100005710 | 3300005577 | Bacteria | 10641 |
| 87 | Ga0068857_100079703 | 3300005577 | Bacteria | 2923 |
| 88 | Ga0068857_100115427 | 3300005577 | Bacteria | 2415 |
| 89 | Ga0068857_100140954 | 3300005577 | Bacteria | 2179 |
| 90 | Ga0068854_100000276 | 3300005578 | Bacteria | 34585 |
| 91 | Ga0068854_100075851 | 3300005578 | Bacteria | 2470 |
| 92 | Ga0068854_100088908 | 3300005578 | Bacteria | 2295 |
| 93 | Ga0068854_100100254 | 3300005578 | Bacteria | 2170 |
| 94 | Ga0068854_100149935 | 3300005578 | Bacteria | 1797 |
| 95 | Ga0068854_100235972 | 3300005578 | Bacteria | 1454 |
| 96 | Ga0068854_100343225 | 3300005578 | Bacteria | 1220 |
| 97 | Ga0068856_100001197 | 3300005614 | Bacteria | 27340 |
| 98 | Ga0068856_100460507 | 3300005614 | Bacteria | 1292 |
| 99 | Ga0068852_100000071 | 3300005616 | Bacteria | 70039 |
| 100 | Ga0068852_100004277 | 3300005616 | Bacteria | 10076 |
| 101 | Ga0068852_100631314 | 3300005616 | Bacteria | 1077 |
| 102 | Ga0068859_100010215 | 3300005617 | Bacteria | 9448 |
| 103 | Ga0068859_100024733 | 3300005617 | Bacteria | 6027 |
| 104 | Ga0068859_100179337 | 3300005617 | Unclassified | 2201 |
| 105 | Ga0068859_100739033 | 3300005617 | Bacteria | 1073 |
| 106 | Ga0068864_100731068 | 3300005618 | Unclassified | 969 |
| 107 | Ga0068866_10007171 | 3300005718 | Bacteria | 4662 |
| 108 | Ga0068866_10023234 | 3300005718 | Bacteria | 2881 |
| 109 | Ga0068861_100000143 | 3300005719 | Bacteria | 36538 |
| 110 | Ga0068861_100028082 | 3300005719 | Bacteria | 4104 |
| 111 | Ga0068851_10001398 | 3300005834 | Bacteria | 10545 |
| 112 | Ga0068851_10006671 | 3300005834 | Bacteria | 5280 |
| 113 | Ga0068851_10153224 | 3300005834 | Bacteria | 1261 |
| 114 | Ga0068870_10004591 | 3300005840 | Bacteria | 5953 |
| 115 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 116 | Ga0068863_100000680 | 3300005841 | Bacteria | 34407 |
| 117 | Ga0068863_100084685 | 3300005841 | Bacteria | 3004 |
| 118 | Ga0068863_100222921 | 3300005841 | Bacteria | 1817 |
| 119 | Ga0068858_100000246 | 3300005842 | Bacteria | 58225 |
| 120 | Ga0068858_100001693 | 3300005842 | Bacteria | 22548 |
| 121 | Ga0068858_100015863 | 3300005842 | Bacteria | 7082 |
| 122 | Ga0068858_100037638 | 3300005842 | Bacteria | 4487 |
| 123 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 124 | Ga0068860_100000479 | 3300005843 | Bacteria | 49770 |
| 125 | Ga0068860_100033493 | 3300005843 | Bacteria | 4929 |
| 126 | Ga0068860_100122570 | 3300005843 | Bacteria | 2490 |
| 127 | Ga0068862_100000118 | 3300005844 | Bacteria | 92548 |
| 128 | Ga0068862_100000315 | 3300005844 | Bacteria | 52909 |
| 129 | Ga0068862_100013453 | 3300005844 | Bacteria | 6774 |
| 130 | Ga0068862_100077838 | 3300005844 | Bacteria | 2872 |
| 131 | Ga0070715_10005084 | 3300006163 | Bacteria | 4363 |
| 132 | Ga0070712_100004762 | 3300006175 | Bacteria | 8389 |
| 133 | Ga0070712_100138822 | 3300006175 | Unclassified | 1852 |
| 134 | Ga0075366_10038779 | 3300006195 | Bacteria | 2814 |
| 135 | Ga0075366_10093667 | 3300006195 | Bacteria | 1800 |
| 136 | Ga0097621_100003423 | 3300006237 | Bacteria | 10928 |
| 137 | Ga0097621_100657296 | 3300006237 | Bacteria | 962 |
| 138 | Ga0075370_10132604 | 3300006353 | Bacteria | 1454 |
| 139 | Ga0068871_100222333 | 3300006358 | Bacteria | 1636 |
| 140 | Ga0068871_100283751 | 3300006358 | Bacteria | 1449 |
| 141 | Ga0068871_100449569 | 3300006358 | Bacteria | 1155 |
| 142 | Ga0075428_100024159 | 3300006844 | Bacteria | 6724 |
| 143 | Ga0075430_100019681 | 3300006846 | Bacteria | 5742 |
| 144 | Ga0075431_100092136 | 3300006847 | Bacteria | 3128 |
| 145 | Ga0075431_100160688 | 3300006847 | Bacteria | 2310 |
| 146 | Ga0075431_100261672 | 3300006847 | Unclassified | 1755 |
| 147 | Ga0075429_100329312 | 3300006880 | Unclassified | 1336 |
| 148 | Ga0068865_100029140 | 3300006881 | Bacteria | 3660 |
| 149 | Ga0097620_100010215 | 3300006931 | Bacteria | 9448 |
| 150 | Ga0097620_100024733 | 3300006931 | Bacteria | 6027 |
| 151 | Ga0097620_100179321 | 3300006931 | Unclassified | 2201 |
| 152 | Ga0097620_100739120 | 3300006931 | Bacteria | 1073 |
| 153 | Ga0105240_10001039 | 3300009093 | Bacteria | 49357 |
| 154 | Ga0105240_10001073 | 3300009093 | Bacteria | 48286 |
| 155 | Ga0105240_10003918 | 3300009093 | Bacteria | 22988 |
| 156 | Ga0105240_10018370 | 3300009093 | Bacteria | 9390 |
| 157 | Ga0105240_10021136 | 3300009093 | Bacteria | 8664 |
| 158 | Ga0105240_10047493 | 3300009093 | Bacteria | 5432 |
| 159 | Ga0105240_10091059 | 3300009093 | Bacteria | 3727 |
| 160 | Ga0111539_10114185 | 3300009094 | Bacteria | 3168 |
| 161 | Ga0105245_10025979 | 3300009098 | Bacteria | 5152 |
| 162 | Ga0105245_10107701 | 3300009098 | Bacteria | 2587 |
| 163 | Ga0105245_10143493 | 3300009098 | Bacteria | 2251 |
| 164 | Ga0105247_10005971 | 3300009101 | Bacteria | 7586 |
| 165 | Ga0114129_10628365 | 3300009147 | Bacteria | 1388 |
| 166 | Ga0105243_10142293 | 3300009148 | Bacteria | 2048 |
| 167 | Ga0105241_10001892 | 3300009174 | Bacteria | 15865 |
| 168 | Ga0105241_10228079 | 3300009174 | Bacteria | 1569 |
| 169 | Ga0105242_10005332 | 3300009176 | Bacteria | 9937 |
| 170 | Ga0105248_10000165 | 3300009177 | Bacteria | 77602 |
| 171 | Ga0105248_10030381 | 3300009177 | Bacteria | 6032 |
| 172 | Ga0105248_10101568 | 3300009177 | Bacteria | 3242 |
| 173 | Ga0105237_10003132 | 3300009545 | Bacteria | 19904 |
| 174 | Ga0105237_10007137 | 3300009545 | Bacteria | 12276 |
| 175 | Ga0105237_10114025 | 3300009545 | Bacteria | 2695 |
| 176 | Ga0105238_10000659 | 3300009551 | Bacteria | 36189 |
| 177 | Ga0105238_10007472 | 3300009551 | Bacteria | 10949 |
| 178 | Ga0105238_10016052 | 3300009551 | Bacteria | 7574 |
| 179 | Ga0105238_10036602 | 3300009551 | Bacteria | 4990 |
| 180 | Ga0105238_10041604 | 3300009551 | Bacteria | 4654 |
| 181 | Ga0105238_10356892 | 3300009551 | Bacteria | 1451 |
| 182 | Ga0105238_10400474 | 3300009551 | Bacteria | 1366 |
| 183 | Ga0105238_10440416 | 3300009551 | Bacteria | 1299 |
| 184 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 185 | Ga0105249_10000119 | 3300009553 | Bacteria | 107840 |
| 186 | Ga0105239_10000024 | 3300010375 | Bacteria | 256334 |
| 187 | Ga0105239_10000031 | 3300010375 | Bacteria | 226947 |
| 188 | Ga0105239_10106433 | 3300010375 | Bacteria | 3107 |
| 189 | Ga0105239_10215029 | 3300010375 | Bacteria | 2155 |
| 190 | Ga0105239_10488590 | 3300010375 | Bacteria | 1399 |
| 191 | Ga0105239_10815416 | 3300010375 | Bacteria | 1069 |
| 192 | Ga0157326_1000087 | 3300012513 | Bacteria | 9183 |
| 193 | Ga0157373_10130261 | 3300013100 | Unclassified | 1769 |
| 194 | Ga0157371_10000043 | 3300013102 | Bacteria | 197887 |
| 195 | Ga0157371_10149709 | 3300013102 | Bacteria | 1664 |
| 196 | Ga0157370_10101798 | 3300013104 | Bacteria | 2690 |
| 197 | Ga0157370_10706845 | 3300013104 | Bacteria | 920 |
| 198 | Ga0157369_10017858 | 3300013105 | Bacteria | 7962 |
| 199 | Ga0157369_10019079 | 3300013105 | Bacteria | 7678 |
| 200 | Ga0157369_10028283 | 3300013105 | Bacteria | 6206 |
| 201 | Ga0157374_10093323 | 3300013296 | Bacteria | 2874 |
| 202 | Ga0157378_10116528 | 3300013297 | Bacteria | 2456 |
| 203 | Ga0163162_10011059 | 3300013306 | Bacteria | 8792 |
| 204 | Ga0163162_10222776 | 3300013306 | Bacteria | 2016 |
| 205 | Ga0157375_10118920 | 3300013308 | Bacteria | 2749 |
| 206 | Ga0157375_10480743 | 3300013308 | Bacteria | 1407 |
| 207 | Ga0157375_10907734 | 3300013308 | Unclassified | 1025 |
| 208 | Ga0163163_10083660 | 3300014325 | Bacteria | 3196 |
| 209 | Ga0157380_10262796 | 3300014326 | Unclassified | 1569 |
| 210 | Ga0157380_10373151 | 3300014326 | Unclassified | 1343 |
| 211 | Ga0157377_10282949 | 3300014745 | Bacteria | 1088 |
| 212 | Ga0157379_10021551 | 3300014968 | Bacteria | 5706 |
| 213 | Ga0157379_10068076 | 3300014968 | Bacteria | 3183 |
| 214 | Ga0157379_10087227 | 3300014968 | Bacteria | 2798 |
| 215 | Ga0157379_10160048 | 3300014968 | Bacteria | 2032 |
| 216 | Ga0157379_10243405 | 3300014968 | Bacteria | 1632 |
| 217 | Ga0157376_10027411 | 3300014969 | Bacteria | 4515 |
| 218 | Ga0163161_10000029 | 3300017792 | Bacteria | 193416 |
| 219 | Ga0163161_10389665 | 3300017792 | Bacteria | 1115 |
| 220 | Ga0213874_10010879 | 3300021377 | Bacteria | 2290 |
| 221 | Ga0213876_10000232 | 3300021384 | Bacteria | 54674 |
| 222 | Ga0213876_10099717 | 3300021384 | Bacteria | 1540 |
| 223 | Ga0207672_1001237 | 3300025223 | Bacteria | 2165 |
| 224 | Ga0209455_1008365 | 3300025272 | Bacteria | 2818 |
| 225 | Ga0209050_1000388 | 3300025298 | Bacteria | 82715 |
| 226 | Ga0207656_10007552 | 3300025321 | Bacteria | 3965 |
| 227 | Ga0207656_10015100 | 3300025321 | Bacteria | 2985 |
| 228 | Ga0207682_10041994 | 3300025893 | Bacteria | 1868 |
| 229 | Ga0207692_10046370 | 3300025898 | Bacteria | 2179 |
| 230 | Ga0207642_10068100 | 3300025899 | Bacteria | 1683 |
| 231 | Ga0207710_10005614 | 3300025900 | Bacteria | 5395 |
| 232 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 233 | Ga0207680_10413237 | 3300025903 | Bacteria | 955 |
| 234 | Ga0207647_10000245 | 3300025904 | Bacteria | 44530 |
| 235 | Ga0207647_10164129 | 3300025904 | Bacteria | 1295 |
| 236 | Ga0207685_10013606 | 3300025905 | Bacteria | 2522 |
| 237 | Ga0207699_10320310 | 3300025906 | Bacteria | 1087 |
| 238 | Ga0207645_10004396 | 3300025907 | Bacteria | 10443 |
| 239 | Ga0207645_10007195 | 3300025907 | Bacteria | 7888 |
| 240 | Ga0207643_10010620 | 3300025908 | Bacteria | 4962 |
| 241 | Ga0207705_10000296 | 3300025909 | Bacteria | 46440 |
| 242 | Ga0207705_10319306 | 3300025909 | Bacteria | 1193 |
| 243 | Ga0207654_10001450 | 3300025911 | Bacteria | 12581 |
| 244 | Ga0207654_10002387 | 3300025911 | Bacteria | 9609 |
| 245 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 246 | Ga0207695_10003917 | 3300025913 | Bacteria | 20595 |
| 247 | Ga0207695_10004012 | 3300025913 | Bacteria | 20269 |
| 248 | Ga0207695_10018859 | 3300025913 | Bacteria | 7961 |
| 249 | Ga0207695_10034162 | 3300025913 | Bacteria | 5536 |
| 250 | Ga0207695_10040246 | 3300025913 | Bacteria | 5015 |
| 251 | Ga0207695_10041108 | 3300025913 | Bacteria | 4950 |
| 252 | Ga0207695_10068949 | 3300025913 | Bacteria | 3621 |
| 253 | Ga0207695_10171592 | 3300025913 | Bacteria | 2094 |
| 254 | Ga0207695_10220211 | 3300025913 | Bacteria | 1805 |
| 255 | Ga0207671_10000821 | 3300025914 | Bacteria | 39371 |
| 256 | Ga0207671_10004347 | 3300025914 | Bacteria | 13597 |
| 257 | Ga0207671_10005078 | 3300025914 | Bacteria | 12293 |
| 258 | Ga0207671_10034845 | 3300025914 | Bacteria | 3739 |
| 259 | Ga0207693_10006431 | 3300025915 | Bacteria | 9736 |
| 260 | Ga0207693_10197064 | 3300025915 | Unclassified | 1584 |
| 261 | Ga0207663_10002130 | 3300025916 | Bacteria | 9442 |
| 262 | Ga0207663_10083871 | 3300025916 | Bacteria | 2095 |
| 263 | Ga0207660_10137470 | 3300025917 | Bacteria | 1866 |
| 264 | Ga0207657_10000583 | 3300025919 | Bacteria | 38816 |
| 265 | Ga0207649_10000072 | 3300025920 | Bacteria | 87103 |
| 266 | Ga0207649_10000508 | 3300025920 | Bacteria | 27425 |
| 267 | Ga0207646_10106053 | 3300025922 | Bacteria | 2520 |
| 268 | Ga0207681_10000102 | 3300025923 | Bacteria | 72602 |
| 269 | Ga0207681_10006265 | 3300025923 | Bacteria | 7301 |
| 270 | Ga0207681_10085653 | 3300025923 | Bacteria | 2237 |
| 271 | Ga0207681_10130614 | 3300025923 | Archaea | 1857 |
| 272 | Ga0207694_10000016 | 3300025924 | Bacteria | 349087 |
| 273 | Ga0207694_10002356 | 3300025924 | Bacteria | 15452 |
| 274 | Ga0207694_10024486 | 3300025924 | Bacteria | 4585 |
| 275 | Ga0207694_10027129 | 3300025924 | Bacteria | 4361 |
| 276 | Ga0207694_10095672 | 3300025924 | Bacteria | 2348 |
| 277 | Ga0207694_10516064 | 3300025924 | Bacteria | 1001 |
| 278 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 279 | Ga0207650_10060361 | 3300025925 | Bacteria | 2830 |
| 280 | Ga0207659_10027595 | 3300025926 | Bacteria | 3847 |
| 281 | Ga0207659_10127366 | 3300025926 | Bacteria | 1960 |
| 282 | Ga0207687_10018431 | 3300025927 | Bacteria | 4608 |
| 283 | Ga0207687_10065453 | 3300025927 | Bacteria | 2581 |
| 284 | Ga0207644_10000092 | 3300025931 | Bacteria | 64892 |
| 285 | Ga0207644_10202017 | 3300025931 | Bacteria | 1568 |
| 286 | Ga0207690_10000296 | 3300025932 | Bacteria | 35141 |
| 287 | Ga0207706_10002119 | 3300025933 | Bacteria | 19433 |
| 288 | Ga0207706_10002132 | 3300025933 | Bacteria | 19363 |
| 289 | Ga0207706_10021514 | 3300025933 | Bacteria | 5791 |
| 290 | Ga0207706_10217992 | 3300025933 | Bacteria | 1671 |
| 291 | Ga0207709_10014623 | 3300025935 | Bacteria | 4337 |
| 292 | Ga0207709_10052823 | 3300025935 | Bacteria | 2498 |
| 293 | Ga0207669_10003651 | 3300025937 | Bacteria | 6679 |
| 294 | Ga0207669_10237509 | 3300025937 | Bacteria | 1349 |
| 295 | Ga0207669_10313145 | 3300025937 | Bacteria | 1198 |
| 296 | Ga0207704_10015543 | 3300025938 | Bacteria | 3882 |
| 297 | Ga0207665_10013054 | 3300025939 | Bacteria | 5459 |
| 298 | Ga0207691_10003410 | 3300025940 | Bacteria | 15449 |
| 299 | Ga0207691_10005982 | 3300025940 | Bacteria | 11748 |
| 300 | Ga0207691_10210260 | 3300025940 | Bacteria | 1690 |
| 301 | Ga0207691_10383335 | 3300025940 | Bacteria | 1200 |
| 302 | Ga0207711_10000897 | 3300025941 | Bacteria | 28664 |
| 303 | Ga0207711_10041645 | 3300025941 | Bacteria | 3911 |
| 304 | Ga0207689_10012842 | 3300025942 | Bacteria | 7151 |
| 305 | Ga0207661_10736330 | 3300025944 | Bacteria | 907 |
| 306 | Ga0207667_10000021 | 3300025949 | Bacteria | 370524 |
| 307 | Ga0207667_10000069 | 3300025949 | Bacteria | 180683 |
| 308 | Ga0207667_10008418 | 3300025949 | Bacteria | 12260 |
| 309 | Ga0207667_10044383 | 3300025949 | Bacteria | 4710 |
| 310 | Ga0207667_10203241 | 3300025949 | Bacteria | 2032 |
| 311 | Ga0207651_10014384 | 3300025960 | Bacteria | 4566 |
| 312 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 313 | Ga0207712_10000048 | 3300025961 | Bacteria | 160050 |
| 314 | Ga0207668_10000055 | 3300025972 | Bacteria | 94786 |
| 315 | Ga0207668_10011650 | 3300025972 | Bacteria | 5351 |
| 316 | Ga0207668_10292374 | 3300025972 | Unclassified | 1341 |
| 317 | Ga0207640_10001445 | 3300025981 | Bacteria | 12844 |
| 318 | Ga0207640_10001651 | 3300025981 | Bacteria | 11967 |
| 319 | Ga0207640_10046261 | 3300025981 | Bacteria | 2799 |
| 320 | Ga0207640_10078161 | 3300025981 | Bacteria | 2251 |
| 321 | Ga0207640_10161728 | 3300025981 | Bacteria | 1657 |
| 322 | Ga0207640_10212486 | 3300025981 | Bacteria | 1475 |
| 323 | Ga0207640_10231719 | 3300025981 | Bacteria | 1421 |
| 324 | Ga0207658_10013719 | 3300025986 | Bacteria | 5541 |
| 325 | Ga0207658_10018287 | 3300025986 | Bacteria | 4837 |
| 326 | Ga0207658_10530395 | 3300025986 | Bacteria | 1051 |
| 327 | Ga0207703_10002508 | 3300026035 | Bacteria | 15867 |
| 328 | Ga0207703_10005798 | 3300026035 | Bacteria | 9895 |
| 329 | Ga0207703_10017243 | 3300026035 | Bacteria | 5635 |
| 330 | Ga0207639_10001060 | 3300026041 | Bacteria | 18669 |
| 331 | Ga0207639_10042939 | 3300026041 | Bacteria | 3391 |
| 332 | Ga0207639_10085039 | 3300026041 | Bacteria | 2515 |
| 333 | Ga0207678_10000240 | 3300026067 | Bacteria | 49355 |
| 334 | Ga0207702_10000269 | 3300026078 | Bacteria | 59707 |
| 335 | Ga0207702_10000868 | 3300026078 | Bacteria | 31467 |
| 336 | Ga0207702_10004349 | 3300026078 | Bacteria | 12632 |
| 337 | Ga0207702_10439795 | 3300026078 | Bacteria | 1264 |
| 338 | Ga0207641_10000116 | 3300026088 | Bacteria | 117850 |
| 339 | Ga0207641_10005391 | 3300026088 | Bacteria | 10926 |
| 340 | Ga0207648_10001606 | 3300026089 | Bacteria | 24755 |
| 341 | Ga0207648_10007593 | 3300026089 | Bacteria | 10635 |
| 342 | Ga0207648_10073581 | 3300026089 | Bacteria | 2978 |
| 343 | Ga0207648_10502505 | 3300026089 | Bacteria | 1109 |
| 344 | Ga0207676_10008262 | 3300026095 | Bacteria | 7403 |
| 345 | Ga0207676_10070859 | 3300026095 | Bacteria | 2796 |
| 346 | Ga0207676_10352383 | 3300026095 | Bacteria | 1361 |
| 347 | Ga0207674_10001563 | 3300026116 | Bacteria | 29480 |
| 348 | Ga0207674_10015001 | 3300026116 | Bacteria | 8536 |
| 349 | Ga0207674_10034779 | 3300026116 | Bacteria | 5264 |
| 350 | Ga0207674_10046373 | 3300026116 | Bacteria | 4462 |
| 351 | Ga0207674_10115356 | 3300026116 | Bacteria | 2658 |
| 352 | Ga0207674_10244804 | 3300026116 | Bacteria | 1740 |
| 353 | Ga0207674_10271856 | 3300026116 | Bacteria | 1642 |
| 354 | Ga0207675_100000097 | 3300026118 | Bacteria | 69812 |
| 355 | Ga0207675_100000382 | 3300026118 | Bacteria | 42525 |
| 356 | Ga0207675_100001154 | 3300026118 | Bacteria | 26234 |
| 357 | Ga0207683_10562140 | 3300026121 | Bacteria | 1055 |
| 358 | Ga0207698_10000062 | 3300026142 | Bacteria | 72806 |
| 359 | Ga0207698_10000461 | 3300026142 | Bacteria | 23591 |
| 360 | Ga0207698_10000594 | 3300026142 | Bacteria | 21138 |
| 361 | Ga0207698_10011510 | 3300026142 | Bacteria | 5739 |
| 362 | Ga0209281_1012173 | 3300027111 | Bacteria | 1899 |
| 363 | Ga0209968_1005693 | 3300027526 | Bacteria | 1871 |
| 364 | Ga0209970_1003899 | 3300027614 | Bacteria | 2494 |
| 365 | Ga0210002_1000575 | 3300027617 | Bacteria | 4976 |
| 366 | Ga0209983_1004982 | 3300027665 | Bacteria | 2772 |
| 367 | Ga0209971_1001620 | 3300027682 | Bacteria | 5560 |
| 368 | Ga0209966_1013897 | 3300027695 | Bacteria | 1497 |
| 369 | Ga0209998_10000317 | 3300027717 | Bacteria | 14455 |
| 370 | Ga0209974_10001822 | 3300027876 | Bacteria | 7770 |
| 371 | Ga0207428_10201036 | 3300027907 | Bacteria | 1499 |
| 372 | Ga0268266_10027437 | 3300028379 | Bacteria | 4841 |
| 373 | Ga0268266_10110414 | 3300028379 | Bacteria | 2436 |
| 374 | Ga0268265_10000139 | 3300028380 | Bacteria | 92561 |
| 375 | Ga0268265_10000990 | 3300028380 | Bacteria | 25789 |
| 376 | Ga0268265_10006620 | 3300028380 | Bacteria | 7844 |
| 377 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 378 | Ga0268264_10000585 | 3300028381 | Bacteria | 44270 |
| 379 | Ga0268264_10002651 | 3300028381 | Bacteria | 15641 |
| 380 | Ga0265338_10007089 | 3300028800 | Bacteria | 14046 |
| 381 | Ga0265325_10003271 | 3300031241 | Bacteria | 10656 |
| 382 | Ga0265339_10009768 | 3300031249 | Bacteria | 5998 |
| 383 | Ga0265331_10000011 | 3300031250 | Bacteria | 308171 |
| 384 | Ga0265316_10088791 | 3300031344 | Bacteria | 2360 |
| 385 | Ga0307513_10004619 | 3300031456 | Bacteria | 18343 |
| 386 | Ga0307513_10103263 | 3300031456 | Bacteria | 2867 |
| 387 | Ga0307509_10000038 | 3300031507 | Bacteria | 188458 |
| 388 | Ga0307408_100109357 | 3300031548 | Bacteria | 2120 |
| 389 | Ga0307408_100226072 | 3300031548 | Bacteria | 1530 |
| 390 | Ga0307508_10000398 | 3300031616 | Bacteria | 52452 |
| 391 | Ga0265314_10007030 | 3300031711 | Bacteria | 9830 |
| 392 | Ga0316576_10277347 | 3300031727 | Unclassified | 1256 |
| 393 | Ga0307516_10000056 | 3300031730 | Bacteria | 122840 |
| 394 | Ga0307405_10154795 | 3300031731 | Bacteria | 1616 |
| 395 | Ga0316577_10310553 | 3300031733 | Bacteria | 894 |
| 396 | Ga0307406_10392673 | 3300031901 | Bacteria | 1097 |
| 397 | Ga0307412_10052157 | 3300031911 | Bacteria | 2707 |
| 398 | Ga0307409_100107920 | 3300031995 | Unclassified | 2327 |
| 399 | Ga0307416_100493638 | 3300032002 | Bacteria | 1287 |
| 400 | Ga0307416_100542345 | 3300032002 | Viruses | 1235 |
| 401 | Ga0307416_100958243 | 3300032002 | Bacteria | 958 |
| 402 | Ga0307411_10162460 | 3300032005 | Bacteria | 1675 |
| 403 | Ga0307415_100105417 | 3300032126 | Unclassified | 2079 |
| 404 | Ga0307510_10045997 | 3300033180 | Bacteria | 4700 |
| 405 | Ga0373932_0070118 | 3300035112 | Bacteria | 1085 |
| 406 | Ga0373953_0065106 | 3300035117 | Bacteria | 1496 |
| 407 | Ga0373935_0078319 | 3300035692 | Bacteria | 2144 |
| 408 | Ga0373927_0031859 | 3300035695 | Bacteria | 3434 |
| 409 | Ga0373927_0157067 | 3300035695 | Bacteria | 1490 |
| 410 | Ga0373947_0081786 | 3300035725 | Bacteria | 2001 |
| 411 | Ga0373937_0103495 | 3300036401 | Bacteria | 2644 |
| 412 | Ga0316584_0220219 | 3300036712 | Bacteria | 1395 |
| 413 | Ga0395900_0510827 | 3300037418 | Bacteria | 1151 |
| 414 | Ga0395901_0048779 | 3300038443 | Bacteria | 4398 |
| 415 | Ga0436365_0167364 | 3300039437 | Bacteria | 29700 |
| 416 | Ga0436365_0251199 | 3300039437 | Bacteria | 3643 |
| 417 | Ga0436360_0755413 | 3300039438 | Bacteria | 902 |
| 418 | Ga0436363_0930417 | 3300039450 | Bacteria | 993 |
| 419 | Ga0436363_1394234 | 3300039450 | Bacteria | 2504 |
| 420 | Ga0451853_3917748 | 3300041512 | Bacteria | 2620 |
| 421 | Ga0439431_0028103 | 3300041997 | Bacteria | 1384 |
| 422 | Ga0439443_008773 | 3300042003 | Bacteria | 1435 |
| 423 | Ga0439462_0073355 | 3300042015 | Bacteria | 930 |
| 424 | Ga0439446_0017072 | 3300042156 | Bacteria | 2026 |
| 425 | Ga0439435_0015068 | 3300042436 | Bacteria | 1919 |
| 426 | Ga0451577_0002093 | 3300042876 | Bacteria | 24560 |
| 427 | Ga0451577_0004914 | 3300042876 | Bacteria | 13921 |
| 428 | Ga0451577_0010487 | 3300042876 | Bacteria | 8849 |
| 429 | Ga0451577_0020834 | 3300042876 | Bacteria | 6010 |
| 430 | Ga0451577_0079101 | 3300042876 | Bacteria | 2931 |
| 431 | Ga0451577_0182713 | 3300042876 | Bacteria | 1891 |
| 432 | Ga0466969_0204183 | 3300044656 | Bacteria | 901 |
| 433 | Ga0453683_0007037 | 3300044673 | Bacteria | 7663 |
| 434 | Ga0466965_0012178 | 3300044683 | Bacteria | 4042 |
| 435 | Ga0466966_0022908 | 3300044684 | Bacteria | 4092 |
| 436 | Ga0453684_0017528 | 3300044712 | Bacteria | 11084 |
| 437 | Ga0453684_0018551 | 3300044712 | Bacteria | 10667 |
| 438 | Ga0466971_0039989 | 3300044719 | Bacteria | 2106 |
| 439 | Ga0466970_0194140 | 3300044765 | Bacteria | 1129 |
| 440 | Ga0466959_0343350 | 3300045049 | Bacteria | 1018 |
| 441 | Ga0451576_0016357 | 3300045051 | Bacteria | 8190 |
| 442 | Ga0451576_0073907 | 3300045051 | Bacteria | 3548 |
| 443 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 444 | Ga0495638_0021582 | 3300046460 | Bacteria | 4241 |
| 445 | Ga0495650_0001079 | 3300046471 | Bacteria | 30023 |
| 446 | Ga0495650_0002275 | 3300046471 | Bacteria | 15983 |
| 447 | Ga0495582_0132806 | 3300046473 | Bacteria | 1407 |
| 448 | Ga0495585_0001077 | 3300046492 | Bacteria | 22514 |
| 449 | Ga0495585_0025691 | 3300046492 | Bacteria | 3370 |
| 450 | Ga0495596_0000739 | 3300046500 | Bacteria | 20158 |
| 451 | Ga0495596_0001271 | 3300046500 | Bacteria | 14614 |
| 452 | Ga0495607_0034109 | 3300046501 | Bacteria | 3090 |
| 453 | Ga0495583_0000094 | 3300046506 | Bacteria | 153549 |
| 454 | Ga0495606_0033860 | 3300046507 | Bacteria | 3517 |
| 455 | Ga0495606_0050119 | 3300046507 | Bacteria | 2733 |
| 456 | Ga0495610_0000170 | 3300046512 | Bacteria | 72711 |
| 457 | Ga0495610_0006606 | 3300046512 | Bacteria | 7925 |
| 458 | Ga0495610_0174021 | 3300046512 | Bacteria | 900 |
| 459 | Ga0495616_0000040 | 3300046513 | Bacteria | 122596 |
| 460 | Ga0495616_0071585 | 3300046513 | Bacteria | 1676 |
| 461 | Ga0495620_0122269 | 3300046515 | Bacteria | 1025 |
| 462 | Ga0495630_0094405 | 3300046517 | Bacteria | 2261 |
| 463 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 464 | Ga0495632_0000440 | 3300046519 | Bacteria | 39608 |
| 465 | Ga0495632_0048293 | 3300046519 | Bacteria | 2108 |
| 466 | Ga0495632_0123441 | 3300046519 | Bacteria | 1209 |
| 467 | Ga0495643_0000039 | 3300046522 | Bacteria | 235175 |
| 468 | Ga0495648_0000013 | 3300046524 | Bacteria | 289090 |
| 469 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 470 | Ga0495609_0011981 | 3300046538 | Bacteria | 4117 |
| 471 | Ga0495645_0045057 | 3300046543 | Bacteria | 3218 |
| 472 | Ga0495633_0000122 | 3300046558 | Bacteria | 104795 |
| 473 | Ga0495633_0172024 | 3300046558 | Bacteria | 998 |
| 474 | Ga0495656_0015123 | 3300046615 | Bacteria | 2907 |
| 475 | Ga0495668_0007648 | 3300046616 | Bacteria | 6876 |
| 476 | Ga0495668_0153074 | 3300046616 | Bacteria | 1263 |
| 477 | Ga0495625_0000093 | 3300046660 | Bacteria | 145874 |
| 478 | Ga0495625_0018414 | 3300046660 | Bacteria | 5455 |
| 479 | Ga0495625_0164070 | 3300046660 | Bacteria | 1487 |
| 480 | Ga0495625_0343845 | 3300046660 | Bacteria | 944 |
| 481 | Ga0495670_0017088 | 3300046691 | Bacteria | 3568 |
| 482 | Ga0495671_0000018 | 3300046692 | Bacteria | 291470 |
| 483 | Ga0495671_0007195 | 3300046692 | Bacteria | 6364 |
| 484 | Ga0495671_0010519 | 3300046692 | Bacteria | 5122 |
| 485 | Ga0495671_0071022 | 3300046692 | Bacteria | 1710 |
| 486 | Ga0495671_0182787 | 3300046692 | Bacteria | 1018 |
| 487 | Ga0495683_0189479 | 3300047323 | Bacteria | 934 |
| 488 | Ga0495673_0000435 | 3300047469 | Bacteria | 46845 |
| 489 | Ga0495673_0030476 | 3300047469 | Bacteria | 2532 |
| 490 | Ga0495686_0000060 | 3300047472 | Bacteria | 237402 |
| 491 | Ga0495686_0000105 | 3300047472 | Bacteria | 176098 |
| 492 | Ga0495686_0007537 | 3300047472 | Bacteria | 8147 |
| 493 | Ga0495615_0000003 | 3300048090 | Bacteria | 127902 |
| 494 | Ga0495615_0113629 | 3300048090 | Bacteria | 777 |
| 495 | Ga0495626_0000848 | 3300048091 | Bacteria | 27322 |
| 496 | Ga0495626_0071284 | 3300048091 | Bacteria | 1562 |
| 497 | Ga0496100_0019932 | 3300048903 | Bacteria | 4012 |
| 498 | Ga0496100_0067577 | 3300048903 | Bacteria | 2374 |
| 499 | Ga0496101_0009991 | 3300048904 | Bacteria | 6253 |
| 500 | Ga0496101_0023087 | 3300048904 | Bacteria | 4292 |
| 501 | Ga0496101_0027039 | 3300048904 | Bacteria | 3991 |
| 502 | Ga0496102_0014133 | 3300048905 | Bacteria | 6935 |
| 503 | Ga0496102_0024845 | 3300048905 | Bacteria | 5329 |
| 504 | Ga0496102_0148715 | 3300048905 | Bacteria | 2199 |
| 505 | Ga0496102_0200637 | 3300048905 | Bacteria | 1880 |
| 506 | Ga0496102_0219424 | 3300048905 | Bacteria | 1792 |
| 507 | Ga0496103_0001726 | 3300048906 | Bacteria | 14274 |
| 508 | Ga0496103_0068962 | 3300048906 | Bacteria | 2210 |
| 509 | Ga0496103_0178993 | 3300048906 | Bacteria | 1363 |
| 510 | Ga0496103_0211282 | 3300048906 | Bacteria | 1248 |
| 511 | Ga0496103_0427110 | 3300048906 | Bacteria | 850 |
| 512 | Ga0496104_0008239 | 3300048907 | Bacteria | 9256 |
| 513 | Ga0496104_0033850 | 3300048907 | Bacteria | 4762 |
| 514 | Ga0496105_0007367 | 3300048908 | Bacteria | 8514 |
| 515 | Ga0496105_0056008 | 3300048908 | Bacteria | 3255 |
| 516 | Ga0496105_0434005 | 3300048908 | Bacteria | 1039 |
| 517 | Ga0496106_0057148 | 3300048909 | Bacteria | 2950 |
| 518 | Ga0496106_0369486 | 3300048909 | Bacteria | 1152 |
| 519 | Ga0496107_0058785 | 3300048910 | Bacteria | 2781 |
| 520 | Ga0496107_0092497 | 3300048910 | Bacteria | 2211 |
| 521 | Ga0496107_0099286 | 3300048910 | Bacteria | 2133 |
| 522 | Ga0496109_0066019 | 3300048912 | Bacteria | 3312 |
| 523 | Ga0496109_0170080 | 3300048912 | Bacteria | 2044 |
| 524 | Ga0496110_0038384 | 3300048913 | Bacteria | 4167 |
| 525 | Ga0496111_0008635 | 3300048914 | Bacteria | 6756 |
| 526 | Ga0496111_0176057 | 3300048914 | Bacteria | 1590 |
| 527 | Ga0496112_0176395 | 3300048915 | Bacteria | 2102 |
| 528 | Ga0496113_0121363 | 3300048916 | Bacteria | 2044 |
| 529 | Ga0496114_0007012 | 3300048917 | Bacteria | 8887 |
| 530 | Ga0496114_0020727 | 3300048917 | Bacteria | 5336 |
| 531 | Ga0496114_0332059 | 3300048917 | Bacteria | 1344 |
| 532 | Ga0496115_0004400 | 3300048918 | Bacteria | 10200 |
| 533 | Ga0496115_0457285 | 3300048918 | Bacteria | 1030 |
| 534 | Ga0496116_0000361 | 3300048919 | Bacteria | 70406 |
| 535 | Ga0496117_0004450 | 3300048920 | Bacteria | 15454 |
| 536 | Ga0496118_0011348 | 3300048921 | Bacteria | 8709 |
| 537 | Ga0496118_0032345 | 3300048921 | Bacteria | 4312 |
| 538 | Ga0496118_0054826 | 3300048921 | Bacteria | 3015 |
| 539 | Ga0496119_0008483 | 3300048922 | Bacteria | 9018 |
| 540 | Ga0496119_0168493 | 3300048922 | Bacteria | 1159 |
| 541 | Ga0496120_0030592 | 3300048923 | Bacteria | 3269 |
| 542 | Ga0496120_0149870 | 3300048923 | Bacteria | 1174 |
| 543 | Ga0496121_0000069 | 3300048924 | Bacteria | 253087 |
| 544 | Ga0496121_0000107 | 3300048924 | Bacteria | 188964 |
| 545 | Ga0496121_0004442 | 3300048924 | Bacteria | 18859 |
| 546 | Ga0496121_0006381 | 3300048924 | Bacteria | 14683 |
| 547 | Ga0496121_0010983 | 3300048924 | Bacteria | 10110 |
| 548 | Ga0496122_0002822 | 3300048925 | Bacteria | 23815 |
| 549 | Ga0496122_0006933 | 3300048925 | Bacteria | 12786 |
| 550 | Ga0496123_0001093 | 3300048926 | Bacteria | 40748 |
| 551 | Ga0496123_0003427 | 3300048926 | Bacteria | 17814 |
| 552 | Ga0496124_0006793 | 3300048927 | Bacteria | 12355 |
| 553 | Ga0496124_0046394 | 3300048927 | Bacteria | 3720 |
| 554 | Ga0496124_0353133 | 3300048927 | Bacteria | 1039 |
| 555 | Ga0496125_0028843 | 3300048928 | Bacteria | 5000 |
| 556 | Ga0496126_0000136 | 3300048929 | Bacteria | 167497 |
| 557 | Ga0496126_0002035 | 3300048929 | Bacteria | 28481 |
| 558 | Ga0496126_0002293 | 3300048929 | Bacteria | 26371 |
| 559 | Ga0496126_0008156 | 3300048929 | Bacteria | 11337 |
| 560 | Ga0496126_0347269 | 3300048929 | Bacteria | 1214 |
| 561 | Ga0496126_0477753 | 3300048929 | Bacteria | 999 |
| 562 | Ga0501292_000004 | 3300049515 | Bacteria | 159565 |
| 563 | Ga0501294_000150 | 3300049517 | Bacteria | 8274 |
| 564 | Ga0501301_003525 | 3300049524 | Bacteria | 1079 |
| 565 | Ga0501034_0711822 | 3300049571 | Bacteria | 902 |
| 566 | Ga0501037_0109672 | 3300049573 | Bacteria | 1989 |
| 567 | Ga0501202_007786 | 3300049652 | Bacteria | 1942 |
| 568 | Ga0501206_002373 | 3300049653 | Bacteria | 2372 |
| 569 | Ga0501222_009140 | 3300049662 | Bacteria | 1311 |
| 570 | Ga0501223_001885 | 3300049663 | Bacteria | 4727 |
| 571 | Ga0501224_005774 | 3300049664 | Bacteria | 1783 |
| 572 | Ga0501227_005723 | 3300049665 | Bacteria | 2664 |
| 573 | Ga0501233_005913 | 3300049668 | Bacteria | 2281 |
| 574 | Ga0501257_000013 | 3300049686 | Bacteria | 50789 |
| 575 | Ga0501261_000010 | 3300049690 | Bacteria | 49364 |
| 576 | Ga0501221_024335 | 3300049704 | Bacteria | 1215 |
| 577 | Ga0501245_000129 | 3300049708 | Bacteria | 7785 |
| 578 | Ga0501279_000005 | 3300049775 | Bacteria | 153858 |
| 579 | Ga0501280_000277 | 3300049776 | Bacteria | 13061 |
| 580 | Ga0501281_00015 | 3300049777 | Bacteria | 23738 |
| 581 | Ga0501282_000134 | 3300049778 | Bacteria | 8758 |
| 582 | Ga0501283_001837 | 3300049779 | Bacteria | 2751 |
| 583 | Ga0501044_0000705 | 3300049823 | Bacteria | 40355 |
| 584 | Ga0501044_0001340 | 3300049823 | Bacteria | 28928 |
| 585 | nmdc:mga0k408_31771_c2 | 3300050493 | Bacteria | 1861 |
| 586 | nmdc:mga0k408_83733_c1 | 3300050493 | Bacteria | 1870 |
| 587 | nmdc:mga07m45_136485_c1 | 3300050496 | Bacteria | 1420 |
| 588 | nmdc:mga05p37_538442_c1 | 3300050507 | Bacteria | 1332 |
| 589 | nmdc:mga09592_172593_c1 | 3300050508 | Bacteria | 1870 |
| 590 | nmdc:mga0qj67_89527_c1 | 3300050509 | Bacteria | 2472 |
| 591 | nmdc:mga06r32_187956_c1 | 3300050510 | Bacteria | 2053 |
| 592 | nmdc:mga06r32_19791_c1 | 3300050510 | Bacteria | 6186 |
| 593 | Ga0500643_004375 | 3300053087 | Bacteria | 6414 |
| 594 | Ga0500643_091449 | 3300053087 | Bacteria | 829 |
| 595 | Ga0500583_0008746 | 3300053092 | Bacteria | 3657 |
| 596 | Ga0500583_0011157 | 3300053092 | Bacteria | 3374 |
| 597 | Ga0500641_0195073 | 3300053096 | Unclassified | 866 |
| 598 | Ga0500594_0002262 | 3300053118 | Bacteria | 4171 |
| 599 | Ga0500618_001102 | 3300053125 | Bacteria | 13251 |
| 600 | Ga0500604_0005509 | 3300053151 | Bacteria | 3343 |
| 601 | Ga0500627_0000305 | 3300053158 | Bacteria | 13629 |
| 602 | Ga0500625_068820 | 3300053729 | Bacteria | 1581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046512 | Ga0495610_0174021 | Ga0495610_0174021_56_724 | 220 |
| 2 | 3300046660 | Ga0495625_0164070 | Ga0495625_0164070_19_711 | 226 |
| 3 | 3300046692 | Ga0495671_0182787 | Ga0495671_0182787_39_731 | 226 |
| 4 | 3300025949 | Ga0207667_10044383 | Ga0207667_100443836 | 229 |
| 5 | 3300048090 | Ga0495615_0113629 | Ga0495615_0113629_44_757 | 229 |
| 6 | 3300048913 | Ga0496110_0038384 | Ga0496110_0038384_582_1292 | 229 |
| 7 | 3300005329 | Ga0070683_100186020 | Ga0070683_1001860202 | 232 |
| 8 | 3300005434 | Ga0070709_10376230 | Ga0070709_103762302 | 238 |
| 9 | 3300006163 | Ga0070715_10005084 | Ga0070715_100050842 | 238 |
| 10 | 3300009098 | Ga0105245_10143493 | Ga0105245_101434932 | 238 |
| 11 | 3300010375 | Ga0105239_10106433 | Ga0105239_101064332 | 238 |
| 12 | 3300025905 | Ga0207685_10013606 | Ga0207685_100136061 | 238 |
| 13 | 3300025906 | Ga0207699_10320310 | Ga0207699_103203102 | 238 |
| 14 | 3300048903 | Ga0496100_0067577 | Ga0496100_0067577_1512_2249 | 238 |
| 15 | 3300048904 | Ga0496101_0027039 | Ga0496101_0027039_1010_1747 | 238 |
| 16 | 3300048905 | Ga0496102_0024845 | Ga0496102_0024845_4166_4903 | 238 |
| 17 | 3300048905 | Ga0496102_0219424 | Ga0496102_0219424_116_853 | 238 |
| 18 | 3300048906 | Ga0496103_0068962 | Ga0496103_0068962_22_759 | 238 |
| 19 | 3300048906 | Ga0496103_0211282 | Ga0496103_0211282_433_1170 | 238 |
| 20 | 3300048907 | Ga0496104_0033850 | Ga0496104_0033850_3629_4366 | 238 |
| 21 | 3300048908 | Ga0496105_0056008 | Ga0496105_0056008_328_1065 | 238 |
| 22 | 3300048909 | Ga0496106_0057148 | Ga0496106_0057148_2042_2779 | 238 |
| 23 | 3300048910 | Ga0496107_0092497 | Ga0496107_0092497_1169_1906 | 238 |
| 24 | 3300048912 | Ga0496109_0066019 | Ga0496109_0066019_181_918 | 238 |
| 25 | 3300048912 | Ga0496109_0170080 | Ga0496109_0170080_200_937 | 238 |
| 26 | 3300048914 | Ga0496111_0176057 | Ga0496111_0176057_543_1280 | 238 |
| 27 | 3300048917 | Ga0496114_0332059 | Ga0496114_0332059_325_1062 | 238 |
| 28 | 3300048918 | Ga0496115_0457285 | Ga0496115_0457285_145_882 | 238 |
| 29 | 3300013105 | Ga0157369_10028283 | Ga0157369_100282835 | 239 |
| 30 | 3300014968 | Ga0157379_10160048 | Ga0157379_101600482 | 242 |
| 31 | 3300037418 | Ga0395900_0510827 | Ga0395900_0510827_230_1051 | 242 |
| 32 | 3300048906 | Ga0496103_0427110 | Ga0496103_0427110_52_783 | 242 |
| 33 | 3300009551 | Ga0105238_10016052 | Ga0105238_100160522 | 244 |
| 34 | iso_pu_bacteria | 2919709256 | 2919713232 | 244 |
| 35 | 3300048924 | Ga0496121_0010983 | Ga0496121_0010983_4092_4877 | 246 |
| 36 | 3300005578 | Ga0068854_100235972 | Ga0068854_1002359722 | 249 |
| 37 | 3300025981 | Ga0207640_10212486 | Ga0207640_102124862 | 249 |
| 38 | 3300009174 | Ga0105241_10001892 | Ga0105241_100018929 | 250 |
| 39 | 3300009551 | Ga0105238_10041604 | Ga0105238_100416042 | 250 |
| 40 | 3300013102 | Ga0157371_10000043 | Ga0157371_1000004353 | 250 |
| 41 | 3300013105 | Ga0157369_10017858 | Ga0157369_100178585 | 250 |
| 42 | 3300005434 | Ga0070709_10373977 | Ga0070709_103739772 | 251 |
| 43 | 3300001979 | JGI24740J21852_10000098 | JGI24740J21852_1000009819 | 253 |
| 44 | 3300005330 | Ga0070690_100040550 | Ga0070690_1000405502 | 253 |
| 45 | 3300005335 | Ga0070666_10004720 | Ga0070666_100047206 | 253 |
| 46 | 3300005338 | Ga0068868_100052835 | Ga0068868_1000528352 | 253 |
| 47 | 3300005344 | Ga0070661_100000720 | Ga0070661_1000007205 | 253 |
| 48 | 3300005355 | Ga0070671_100006317 | Ga0070671_1000063176 | 253 |
| 49 | 3300005435 | Ga0070714_100094079 | Ga0070714_1000940792 | 253 |
| 50 | 3300005436 | Ga0070713_100001372 | Ga0070713_10000137211 | 253 |
| 51 | 3300005459 | Ga0068867_100170745 | Ga0068867_1001707452 | 253 |
| 52 | 3300005468 | Ga0070707_100146208 | Ga0070707_1001462083 | 253 |
| 53 | 3300005548 | Ga0070665_100083473 | Ga0070665_1000834733 | 253 |
| 54 | 3300005564 | Ga0070664_100007227 | Ga0070664_1000072273 | 253 |
| 55 | 3300005718 | Ga0068866_10007171 | Ga0068866_100071716 | 253 |
| 56 | 3300005834 | Ga0068851_10001398 | Ga0068851_100013986 | 253 |
| 57 | 3300005841 | Ga0068863_100084685 | Ga0068863_1000846853 | 253 |
| 58 | 3300005842 | Ga0068858_100015863 | Ga0068858_1000158638 | 253 |
| 59 | 3300005843 | Ga0068860_100122570 | Ga0068860_1001225702 | 253 |
| 60 | 3300006175 | Ga0070712_100004762 | Ga0070712_1000047628 | 253 |
| 61 | 3300006237 | Ga0097621_100003423 | Ga0097621_1000034239 | 253 |
| 62 | 3300006358 | Ga0068871_100222333 | Ga0068871_1002223332 | 253 |
| 63 | 3300006881 | Ga0068865_100029140 | Ga0068865_1000291404 | 253 |
| 64 | 3300009098 | Ga0105245_10107701 | Ga0105245_101077013 | 253 |
| 65 | 3300009176 | Ga0105242_10005332 | Ga0105242_100053329 | 253 |
| 66 | 3300009177 | Ga0105248_10030381 | Ga0105248_100303811 | 253 |
| 67 | 3300013296 | Ga0157374_10093323 | Ga0157374_100933233 | 253 |
| 68 | 3300013297 | Ga0157378_10116528 | Ga0157378_101165281 | 253 |
| 69 | 3300013306 | Ga0163162_10011059 | Ga0163162_100110597 | 253 |
| 70 | 3300013308 | Ga0157375_10118920 | Ga0157375_101189202 | 253 |
| 71 | 3300014968 | Ga0157379_10243405 | Ga0157379_102434052 | 253 |
| 72 | 3300014969 | Ga0157376_10027411 | Ga0157376_100274113 | 253 |
| 73 | 3300025898 | Ga0207692_10046370 | Ga0207692_100463704 | 253 |
| 74 | 3300025904 | Ga0207647_10164129 | Ga0207647_101641291 | 253 |
| 75 | 3300025915 | Ga0207693_10006431 | Ga0207693_100064315 | 253 |
| 76 | 3300025916 | Ga0207663_10083871 | Ga0207663_100838711 | 253 |
| 77 | 3300025920 | Ga0207649_10000508 | Ga0207649_1000050821 | 253 |
| 78 | 3300025927 | Ga0207687_10065453 | Ga0207687_100654531 | 253 |
| 79 | 3300025938 | Ga0207704_10015543 | Ga0207704_100155435 | 253 |
| 80 | 3300025939 | Ga0207665_10013054 | Ga0207665_100130544 | 253 |
| 81 | 3300025949 | Ga0207667_10000069 | Ga0207667_10000069113 | 253 |
| 82 | 3300025986 | Ga0207658_10530395 | Ga0207658_105303951 | 253 |
| 83 | 3300026041 | Ga0207639_10001060 | Ga0207639_1000106013 | 253 |
| 84 | 3300026067 | Ga0207678_10000240 | Ga0207678_100002408 | 253 |
| 85 | 3300026078 | Ga0207702_10439795 | Ga0207702_104397951 | 253 |
| 86 | 3300026142 | Ga0207698_10000461 | Ga0207698_1000046113 | 253 |
| 87 | 3300028379 | Ga0268266_10110414 | Ga0268266_101104142 | 253 |
| 88 | 3300035117 | Ga0373953_0065106 | Ga0373953_0065106_54_881 | 253 |
| 89 | 3300035692 | Ga0373935_0078319 | Ga0373935_0078319_1186_2013 | 253 |
| 90 | 3300035695 | Ga0373927_0031859 | Ga0373927_0031859_201_1028 | 253 |
| 91 | 3300035725 | Ga0373947_0081786 | Ga0373947_0081786_661_1488 | 253 |
| 92 | 3300036401 | Ga0373937_0103495 | Ga0373937_0103495_824_1651 | 253 |
| 93 | 3300046473 | Ga0495582_0132806 | Ga0495582_0132806_75_902 | 253 |
| 94 | 3300046517 | Ga0495630_0094405 | Ga0495630_0094405_420_1247 | 253 |
| 95 | 3300048903 | Ga0496100_0019932 | Ga0496100_0019932_2452_3279 | 253 |
| 96 | 3300048904 | Ga0496101_0009991 | Ga0496101_0009991_4964_5791 | 253 |
| 97 | 3300048905 | Ga0496102_0200637 | Ga0496102_0200637_667_1494 | 253 |
| 98 | 3300048906 | Ga0496103_0178993 | Ga0496103_0178993_233_1060 | 253 |
| 99 | 3300048909 | Ga0496106_0369486 | Ga0496106_0369486_35_862 | 253 |
| 100 | 3300048910 | Ga0496107_0099286 | Ga0496107_0099286_387_1214 | 253 |
| 101 | 3300048914 | Ga0496111_0008635 | Ga0496111_0008635_3835_4662 | 253 |
| 102 | 3300048915 | Ga0496112_0176395 | Ga0496112_0176395_1232_2059 | 253 |
| 103 | 3300048916 | Ga0496113_0121363 | Ga0496113_0121363_243_1070 | 253 |
| 104 | 3300048917 | Ga0496114_0007012 | Ga0496114_0007012_2659_3486 | 253 |
| 105 | 3300001915 | JGI24741J21665_1000031 | JGI24741J21665_100003111 | 254 |
| 106 | 3300001990 | JGI24737J22298_10000085 | JGI24737J22298_100000852 | 254 |
| 107 | 3300005339 | Ga0070660_100000403 | Ga0070660_1000004039 | 254 |
| 108 | 3300005366 | Ga0070659_100001027 | Ga0070659_1000010279 | 254 |
| 109 | 3300025321 | Ga0207656_10015100 | Ga0207656_100151003 | 254 |
| 110 | 3300025911 | Ga0207654_10002387 | Ga0207654_100023871 | 254 |
| 111 | 3300025919 | Ga0207657_10000583 | Ga0207657_1000058317 | 254 |
| 112 | 3300025924 | Ga0207694_10027129 | Ga0207694_100271292 | 254 |
| 113 | 3300025932 | Ga0207690_10000296 | Ga0207690_1000029613 | 254 |
| 114 | 3300025981 | Ga0207640_10001651 | Ga0207640_100016516 | 254 |
| 115 | 3300026078 | Ga0207702_10000868 | Ga0207702_100008685 | 254 |
| 116 | 3300026116 | Ga0207674_10001563 | Ga0207674_1000156314 | 254 |
| 117 | 3300012513 | Ga0157326_1000087 | Ga0157326_10000879 | 257 |
| 118 | iso_pu_bacteria | 2515154122 | 2515681223 | 257 |
| 119 | iso_pu_bacteria | 2738541275 | 2738708810 | 257 |
| 120 | iso_pu_bacteria | 2738541301 | 2738847235 | 257 |
| 121 | iso_pu_bacteria | 2738541304 | 2738862964 | 257 |
| 122 | iso_pu_bacteria | 2738543022 | 2739295482 | 257 |
| 123 | iso_pu_bacteria | 2738543033 | 2739357160 | 257 |
| 124 | iso_pu_bacteria | 2928100450 | 2928102436 | 257 |
| 125 | iso_pu_bacteria | 2928959182 | 2928961061 | 257 |
| 126 | 3300036712 | Ga0316584_0220219 | Ga0316584_0220219_15_803 | 258 |
| 127 | 3300005293 | Ga0065715_10026849 | Ga0065715_100268492 | 259 |
| 128 | 3300005578 | Ga0068854_100343225 | Ga0068854_1003432252 | 259 |
| 129 | 3300005617 | Ga0068859_100179337 | Ga0068859_1001793373 | 259 |
| 130 | 3300005719 | Ga0068861_100000143 | Ga0068861_1000001432 | 259 |
| 131 | 3300006931 | Ga0097620_100179321 | Ga0097620_1001793213 | 259 |
| 132 | 3300009093 | Ga0105240_10018370 | Ga0105240_100183703 | 259 |
| 133 | 3300009148 | Ga0105243_10142293 | Ga0105243_101422932 | 259 |
| 134 | 3300009177 | Ga0105248_10000165 | Ga0105248_1000016543 | 259 |
| 135 | 3300013308 | Ga0157375_10907734 | Ga0157375_109077341 | 259 |
| 136 | 3300014326 | Ga0157380_10262796 | Ga0157380_102627962 | 259 |
| 137 | 3300014968 | Ga0157379_10087227 | Ga0157379_100872273 | 259 |
| 138 | 3300025923 | Ga0207681_10130614 | Ga0207681_101306142 | 259 |
| 139 | 3300025926 | Ga0207659_10127366 | Ga0207659_101273662 | 259 |
| 140 | 3300025935 | Ga0207709_10052823 | Ga0207709_100528232 | 259 |
| 141 | 3300025940 | Ga0207691_10383335 | Ga0207691_103833352 | 259 |
| 142 | 3300025941 | Ga0207711_10000897 | Ga0207711_1000089715 | 259 |
| 143 | 3300026089 | Ga0207648_10502505 | Ga0207648_105025052 | 259 |
| 144 | 3300026118 | Ga0207675_100000097 | Ga0207675_10000009734 | 259 |
| 145 | 3300047472 | Ga0495686_0000105 | Ga0495686_0000105_74621_75442 | 259 |
| 146 | 3300048922 | Ga0496119_0008483 | Ga0496119_0008483_4947_5768 | 259 |
| 147 | 3300048923 | Ga0496120_0149870 | Ga0496120_0149870_54_875 | 259 |
| 148 | iso_pu_bacteria | 2510917021 | 2511130349 | 259 |
| 149 | iso_pu_bacteria | 2513237082 | 2513557198 | 259 |
| 150 | iso_pu_bacteria | 2643221541 | 2643728246 | 259 |
| 151 | iso_pu_bacteria | 2643221605 | 2644036540 | 259 |
| 152 | iso_pu_bacteria | 2643221606 | 2644042805 | 259 |
| 153 | iso_pu_bacteria | 2643221671 | 2644395764 | 259 |
| 154 | iso_pu_bacteria | 2818991438 | 2819553260 | 259 |
| 155 | iso_pu_bacteria | 2919138771 | 2919140307 | 259 |
| 156 | iso_pu_bacteria | 2919709256 | 2919711664 | 259 |
| 157 | iso_pu_bacteria | 8054302542 | 8054304572 | 259 |
| 158 | 3300005327 | Ga0070658_10291477 | Ga0070658_102914771 | 260 |
| 159 | 3300009093 | Ga0105240_10003918 | Ga0105240_1000391816 | 260 |
| 160 | 3300009093 | Ga0105240_10047493 | Ga0105240_100474934 | 260 |
| 161 | 3300010375 | Ga0105239_10000024 | Ga0105239_1000002478 | 260 |
| 162 | 3300010375 | Ga0105239_10000031 | Ga0105239_10000031160 | 260 |
| 163 | 3300013104 | Ga0157370_10706845 | Ga0157370_107068451 | 260 |
| 164 | 3300021377 | Ga0213874_10010879 | Ga0213874_100108791 | 260 |
| 165 | 3300021384 | Ga0213876_10000232 | Ga0213876_1000023246 | 260 |
| 166 | 3300025913 | Ga0207695_10004012 | Ga0207695_1000401216 | 260 |
| 167 | 3300025913 | Ga0207695_10034162 | Ga0207695_100341626 | 260 |
| 168 | 3300031733 | Ga0316577_10310553 | Ga0316577_103105531 | 260 |
| 169 | 3300039437 | Ga0436365_0167364 | Ga0436365_0167364_18621_19421 | 260 |
| 170 | 3300039438 | Ga0436360_0755413 | Ga0436360_0755413_17_814 | 260 |
| 171 | 3300039450 | Ga0436363_1394234 | Ga0436363_1394234_106_906 | 260 |
| 172 | 3300042015 | Ga0439462_0073355 | Ga0439462_0073355_42_827 | 260 |
| 173 | 3300042156 | Ga0439446_0017072 | Ga0439446_0017072_237_1040 | 260 |
| 174 | 3300046471 | Ga0495650_0002275 | Ga0495650_0002275_8908_9690 | 260 |
| 175 | 3300046692 | Ga0495671_0010519 | Ga0495671_0010519_889_1713 | 260 |
| 176 | 3300048921 | Ga0496118_0032345 | Ga0496118_0032345_1752_2537 | 260 |
| 177 | 3300048924 | Ga0496121_0000107 | Ga0496121_0000107_185244_186029 | 260 |
| 178 | 3300048929 | Ga0496126_0002293 | Ga0496126_0002293_22720_23505 | 260 |
| 179 | 3300001904 | JGI24736J21556_1000085 | JGI24736J21556_10000851 | 261 |
| 180 | 3300001904 | JGI24736J21556_1019188 | JGI24736J21556_10191882 | 261 |
| 181 | 3300001915 | JGI24741J21665_1010126 | JGI24741J21665_10101261 | 261 |
| 182 | 3300001976 | JGI24752J21851_1000158 | JGI24752J21851_10001582 | 261 |
| 183 | 3300001989 | JGI24739J22299_10029189 | JGI24739J22299_100291892 | 261 |
| 184 | 3300002070 | JGI24750J21931_1003840 | JGI24750J21931_10038402 | 261 |
| 185 | 3300002074 | JGI24748J21848_1000086 | JGI24748J21848_10000865 | 261 |
| 186 | 3300002239 | JGI24034J26672_10000008 | JGI24034J26672_10000008125 | 261 |
| 187 | 3300002244 | JGI24742J22300_10001489 | JGI24742J22300_100014892 | 261 |
| 188 | 3300005327 | Ga0070658_10016771 | Ga0070658_100167714 | 261 |
| 189 | 3300005327 | Ga0070658_10059168 | Ga0070658_100591685 | 261 |
| 190 | 3300005328 | Ga0070676_10000512 | Ga0070676_1000051216 | 261 |
| 191 | 3300005330 | Ga0070690_100000006 | Ga0070690_10000000618 | 261 |
| 192 | 3300005331 | Ga0070670_100088333 | Ga0070670_1000883333 | 261 |
| 193 | 3300005334 | Ga0068869_100003432 | Ga0068869_1000034327 | 261 |
| 194 | 3300005335 | Ga0070666_10000004 | Ga0070666_10000004163 | 261 |
| 195 | 3300005339 | Ga0070660_100103557 | Ga0070660_1001035571 | 261 |
| 196 | 3300005340 | Ga0070689_100360482 | Ga0070689_1003604822 | 261 |
| 197 | 3300005344 | Ga0070661_100000046 | Ga0070661_10000004661 | 261 |
| 198 | 3300005353 | Ga0070669_100000116 | Ga0070669_10000011620 | 261 |
| 199 | 3300005354 | Ga0070675_100007411 | Ga0070675_1000074116 | 261 |
| 200 | 3300005355 | Ga0070671_100006590 | Ga0070671_1000065903 | 261 |
| 201 | 3300005355 | Ga0070671_100117104 | Ga0070671_1001171042 | 261 |
| 202 | 3300005355 | Ga0070671_100333157 | Ga0070671_1003331572 | 261 |
| 203 | 3300005356 | Ga0070674_100371928 | Ga0070674_1003719282 | 261 |
| 204 | 3300005364 | Ga0070673_100006452 | Ga0070673_1000064529 | 261 |
| 205 | 3300005366 | Ga0070659_100071295 | Ga0070659_1000712952 | 261 |
| 206 | 3300005367 | Ga0070667_100010853 | Ga0070667_1000108532 | 261 |
| 207 | 3300005367 | Ga0070667_100092462 | Ga0070667_1000924623 | 261 |
| 208 | 3300005456 | Ga0070678_100530970 | Ga0070678_1005309701 | 261 |
| 209 | 3300005457 | Ga0070662_100425994 | Ga0070662_1004259941 | 261 |
| 210 | 3300005459 | Ga0068867_100004028 | Ga0068867_1000040288 | 261 |
| 211 | 3300005539 | Ga0068853_100680318 | Ga0068853_1006803181 | 261 |
| 212 | 3300005543 | Ga0070672_100024584 | Ga0070672_1000245844 | 261 |
| 213 | 3300005544 | Ga0070686_100000012 | Ga0070686_10000001261 | 261 |
| 214 | 3300005563 | Ga0068855_100000336 | Ga0068855_10000033640 | 261 |
| 215 | 3300005564 | Ga0070664_100142237 | Ga0070664_1001422372 | 261 |
| 216 | 3300005564 | Ga0070664_100171531 | Ga0070664_1001715312 | 261 |
| 217 | 3300005577 | Ga0068857_100079703 | Ga0068857_1000797032 | 261 |
| 218 | 3300005578 | Ga0068854_100075851 | Ga0068854_1000758513 | 261 |
| 219 | 3300005578 | Ga0068854_100088908 | Ga0068854_1000889082 | 261 |
| 220 | 3300005578 | Ga0068854_100100254 | Ga0068854_1001002542 | 261 |
| 221 | 3300005578 | Ga0068854_100149935 | Ga0068854_1001499352 | 261 |
| 222 | 3300005614 | Ga0068856_100460507 | Ga0068856_1004605071 | 261 |
| 223 | 3300005616 | Ga0068852_100004277 | Ga0068852_1000042772 | 261 |
| 224 | 3300005616 | Ga0068852_100631314 | Ga0068852_1006313142 | 261 |
| 225 | 3300005617 | Ga0068859_100024733 | Ga0068859_1000247332 | 261 |
| 226 | 3300005834 | Ga0068851_10006671 | Ga0068851_100066714 | 261 |
| 227 | 3300005841 | Ga0068863_100000013 | Ga0068863_10000001386 | 261 |
| 228 | 3300005842 | Ga0068858_100000246 | Ga0068858_1000002462 | 261 |
| 229 | 3300005842 | Ga0068858_100001693 | Ga0068858_10000169315 | 261 |
| 230 | 3300005843 | Ga0068860_100000009 | Ga0068860_100000009163 | 261 |
| 231 | 3300005844 | Ga0068862_100000315 | Ga0068862_1000003151 | 261 |
| 232 | 3300006237 | Ga0097621_100657296 | Ga0097621_1006572962 | 261 |
| 233 | 3300006358 | Ga0068871_100283751 | Ga0068871_1002837512 | 261 |
| 234 | 3300006358 | Ga0068871_100449569 | Ga0068871_1004495691 | 261 |
| 235 | 3300006931 | Ga0097620_100024733 | Ga0097620_1000247334 | 261 |
| 236 | 3300009093 | Ga0105240_10001073 | Ga0105240_1000107336 | 261 |
| 237 | 3300009093 | Ga0105240_10021136 | Ga0105240_100211367 | 261 |
| 238 | 3300009093 | Ga0105240_10091059 | Ga0105240_100910592 | 261 |
| 239 | 3300009098 | Ga0105245_10025979 | Ga0105245_100259797 | 261 |
| 240 | 3300009174 | Ga0105241_10228079 | Ga0105241_102280792 | 261 |
| 241 | 3300009545 | Ga0105237_10003132 | Ga0105237_100031323 | 261 |
| 242 | 3300009545 | Ga0105237_10007137 | Ga0105237_100071378 | 261 |
| 243 | 3300009551 | Ga0105238_10000659 | Ga0105238_1000065928 | 261 |
| 244 | 3300009551 | Ga0105238_10356892 | Ga0105238_103568922 | 261 |
| 245 | 3300009551 | Ga0105238_10400474 | Ga0105238_104004742 | 261 |
| 246 | 3300009551 | Ga0105238_10440416 | Ga0105238_104404161 | 261 |
| 247 | 3300009553 | Ga0105249_10000006 | Ga0105249_10000006202 | 261 |
| 248 | 3300010375 | Ga0105239_10000031 | Ga0105239_1000003155 | 261 |
| 249 | 3300010375 | Ga0105239_10215029 | Ga0105239_102150292 | 261 |
| 250 | 3300010375 | Ga0105239_10488590 | Ga0105239_104885902 | 261 |
| 251 | 3300010375 | Ga0105239_10815416 | Ga0105239_108154161 | 261 |
| 252 | 3300013100 | Ga0157373_10130261 | Ga0157373_101302612 | 261 |
| 253 | 3300013102 | Ga0157371_10149709 | Ga0157371_101497092 | 261 |
| 254 | 3300013104 | Ga0157370_10101798 | Ga0157370_101017981 | 261 |
| 255 | 3300013105 | Ga0157369_10019079 | Ga0157369_100190792 | 261 |
| 256 | 3300014325 | Ga0163163_10083660 | Ga0163163_100836604 | 261 |
| 257 | 3300014745 | Ga0157377_10282949 | Ga0157377_102829492 | 261 |
| 258 | 3300014968 | Ga0157379_10021551 | Ga0157379_100215511 | 261 |
| 259 | 3300017792 | Ga0163161_10000029 | Ga0163161_1000002924 | 261 |
| 260 | 3300025223 | Ga0207672_1001237 | Ga0207672_10012372 | 261 |
| 261 | 3300025321 | Ga0207656_10007552 | Ga0207656_100075523 | 261 |
| 262 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010244 | 261 |
| 263 | 3300025904 | Ga0207647_10000245 | Ga0207647_1000024534 | 261 |
| 264 | 3300025907 | Ga0207645_10004396 | Ga0207645_100043969 | 261 |
| 265 | 3300025909 | Ga0207705_10319306 | Ga0207705_103193061 | 261 |
| 266 | 3300025911 | Ga0207654_10001450 | Ga0207654_100014502 | 261 |
| 267 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003334 | 261 |
| 268 | 3300025913 | Ga0207695_10018859 | Ga0207695_100188593 | 261 |
| 269 | 3300025913 | Ga0207695_10041108 | Ga0207695_100411084 | 261 |
| 270 | 3300025913 | Ga0207695_10068949 | Ga0207695_100689493 | 261 |
| 271 | 3300025913 | Ga0207695_10171592 | Ga0207695_101715922 | 261 |
| 272 | 3300025913 | Ga0207695_10220211 | Ga0207695_102202112 | 261 |
| 273 | 3300025914 | Ga0207671_10000821 | Ga0207671_1000082118 | 261 |
| 274 | 3300025914 | Ga0207671_10004347 | Ga0207671_1000434710 | 261 |
| 275 | 3300025914 | Ga0207671_10005078 | Ga0207671_100050786 | 261 |
| 276 | 3300025920 | Ga0207649_10000072 | Ga0207649_1000007227 | 261 |
| 277 | 3300025923 | Ga0207681_10000102 | Ga0207681_1000010220 | 261 |
| 278 | 3300025924 | Ga0207694_10000016 | Ga0207694_10000016304 | 261 |
| 279 | 3300025924 | Ga0207694_10002356 | Ga0207694_100023565 | 261 |
| 280 | 3300025924 | Ga0207694_10516064 | Ga0207694_105160641 | 261 |
| 281 | 3300025925 | Ga0207650_10060361 | Ga0207650_100603613 | 261 |
| 282 | 3300025926 | Ga0207659_10027595 | Ga0207659_100275954 | 261 |
| 283 | 3300025927 | Ga0207687_10018431 | Ga0207687_100184313 | 261 |
| 284 | 3300025931 | Ga0207644_10000092 | Ga0207644_1000009251 | 261 |
| 285 | 3300025931 | Ga0207644_10202017 | Ga0207644_102020172 | 261 |
| 286 | 3300025933 | Ga0207706_10021514 | Ga0207706_100215142 | 261 |
| 287 | 3300025933 | Ga0207706_10217992 | Ga0207706_102179922 | 261 |
| 288 | 3300025935 | Ga0207709_10014623 | Ga0207709_100146232 | 261 |
| 289 | 3300025937 | Ga0207669_10313145 | Ga0207669_103131451 | 261 |
| 290 | 3300025940 | Ga0207691_10003410 | Ga0207691_100034105 | 261 |
| 291 | 3300025941 | Ga0207711_10041645 | Ga0207711_100416452 | 261 |
| 292 | 3300025942 | Ga0207689_10012842 | Ga0207689_100128424 | 261 |
| 293 | 3300025944 | Ga0207661_10736330 | Ga0207661_107363301 | 261 |
| 294 | 3300025949 | Ga0207667_10000021 | Ga0207667_1000002143 | 261 |
| 295 | 3300025949 | Ga0207667_10008418 | Ga0207667_100084185 | 261 |
| 296 | 3300025960 | Ga0207651_10014384 | Ga0207651_100143842 | 261 |
| 297 | 3300025961 | Ga0207712_10000014 | Ga0207712_10000014163 | 261 |
| 298 | 3300025981 | Ga0207640_10046261 | Ga0207640_100462612 | 261 |
| 299 | 3300025981 | Ga0207640_10078161 | Ga0207640_100781611 | 261 |
| 300 | 3300025981 | Ga0207640_10231719 | Ga0207640_102317192 | 261 |
| 301 | 3300025986 | Ga0207658_10018287 | Ga0207658_100182873 | 261 |
| 302 | 3300026035 | Ga0207703_10002508 | Ga0207703_100025082 | 261 |
| 303 | 3300026035 | Ga0207703_10005798 | Ga0207703_100057982 | 261 |
| 304 | 3300026041 | Ga0207639_10042939 | Ga0207639_100429393 | 261 |
| 305 | 3300026078 | Ga0207702_10000269 | Ga0207702_1000026931 | 261 |
| 306 | 3300026088 | Ga0207641_10000116 | Ga0207641_1000011687 | 261 |
| 307 | 3300026089 | Ga0207648_10007593 | Ga0207648_100075935 | 261 |
| 308 | 3300026095 | Ga0207676_10008262 | Ga0207676_100082622 | 261 |
| 309 | 3300026116 | Ga0207674_10034779 | Ga0207674_100347794 | 261 |
| 310 | 3300026116 | Ga0207674_10046373 | Ga0207674_100463733 | 261 |
| 311 | 3300026116 | Ga0207674_10244804 | Ga0207674_102448042 | 261 |
| 312 | 3300026118 | Ga0207675_100000382 | Ga0207675_10000038238 | 261 |
| 313 | 3300026121 | Ga0207683_10562140 | Ga0207683_105621401 | 261 |
| 314 | 3300026142 | Ga0207698_10000594 | Ga0207698_1000059414 | 261 |
| 315 | 3300026142 | Ga0207698_10011510 | Ga0207698_100115102 | 261 |
| 316 | 3300028380 | Ga0268265_10000990 | Ga0268265_1000099014 | 261 |
| 317 | 3300028381 | Ga0268264_10000023 | Ga0268264_10000023202 | 261 |
| 318 | 3300028800 | Ga0265338_10007089 | Ga0265338_100070896 | 261 |
| 319 | 3300031241 | Ga0265325_10003271 | Ga0265325_100032712 | 261 |
| 320 | 3300031249 | Ga0265339_10009768 | Ga0265339_100097685 | 261 |
| 321 | 3300031250 | Ga0265331_10000011 | Ga0265331_1000001130 | 261 |
| 322 | 3300031344 | Ga0265316_10088791 | Ga0265316_100887912 | 261 |
| 323 | 3300031456 | Ga0307513_10004619 | Ga0307513_1000461911 | 261 |
| 324 | 3300031616 | Ga0307508_10000398 | Ga0307508_1000039818 | 261 |
| 325 | 3300031711 | Ga0265314_10007030 | Ga0265314_100070306 | 261 |
| 326 | 3300031730 | Ga0307516_10000056 | Ga0307516_10000056111 | 261 |
| 327 | 3300032002 | Ga0307416_100493638 | Ga0307416_1004936382 | 261 |
| 328 | 3300035695 | Ga0373927_0157067 | Ga0373927_0157067_79_885 | 261 |
| 329 | 3300038443 | Ga0395901_0048779 | Ga0395901_0048779_2174_2962 | 261 |
| 330 | 3300041512 | Ga0451853_3917748 | Ga0451853_3917748_1532_2326 | 261 |
| 331 | 3300041997 | Ga0439431_0028103 | Ga0439431_0028103_45_851 | 261 |
| 332 | 3300044656 | Ga0466969_0204183 | Ga0466969_0204183_58_855 | 261 |
| 333 | 3300044683 | Ga0466965_0012178 | Ga0466965_0012178_1596_2396 | 261 |
| 334 | 3300044684 | Ga0466966_0022908 | Ga0466966_0022908_1158_1955 | 261 |
| 335 | 3300044719 | Ga0466971_0039989 | Ga0466971_0039989_415_1212 | 261 |
| 336 | 3300044765 | Ga0466970_0194140 | Ga0466970_0194140_110_907 | 261 |
| 337 | 3300045049 | Ga0466959_0343350 | Ga0466959_0343350_100_897 | 261 |
| 338 | 3300046460 | Ga0495638_0000016 | Ga0495638_0000016_276795_277592 | 261 |
| 339 | 3300046471 | Ga0495650_0001079 | Ga0495650_0001079_15734_16603 | 261 |
| 340 | 3300046506 | Ga0495583_0000094 | Ga0495583_0000094_31456_32253 | 261 |
| 341 | 3300046515 | Ga0495620_0122269 | Ga0495620_0122269_37_825 | 261 |
| 342 | 3300046519 | Ga0495632_0000440 | Ga0495632_0000440_10866_11663 | 261 |
| 343 | 3300046524 | Ga0495648_0000013 | Ga0495648_0000013_118914_119711 | 261 |
| 344 | 3300046692 | Ga0495671_0000018 | Ga0495671_0000018_121293_122090 | 261 |
| 345 | 3300046692 | Ga0495671_0007195 | Ga0495671_0007195_3271_4065 | 261 |
| 346 | 3300047469 | Ga0495673_0000435 | Ga0495673_0000435_14596_15393 | 261 |
| 347 | 3300048905 | Ga0496102_0148715 | Ga0496102_0148715_431_1234 | 261 |
| 348 | 3300048906 | Ga0496103_0001726 | Ga0496103_0001726_6089_6892 | 261 |
| 349 | 3300048908 | Ga0496105_0434005 | Ga0496105_0434005_92_895 | 261 |
| 350 | 3300048910 | Ga0496107_0058785 | Ga0496107_0058785_332_1135 | 261 |
| 351 | 3300048920 | Ga0496117_0004450 | Ga0496117_0004450_7511_8314 | 261 |
| 352 | 3300048921 | Ga0496118_0054826 | Ga0496118_0054826_431_1234 | 261 |
| 353 | 3300048922 | Ga0496119_0168493 | Ga0496119_0168493_206_1009 | 261 |
| 354 | 3300048924 | Ga0496121_0000069 | Ga0496121_0000069_17523_18317 | 261 |
| 355 | 3300048924 | Ga0496121_0006381 | Ga0496121_0006381_3228_4028 | 261 |
| 356 | 3300048929 | Ga0496126_0002035 | Ga0496126_0002035_6850_7641 | 261 |
| 357 | 3300048929 | Ga0496126_0008156 | Ga0496126_0008156_3631_4425 | 261 |
| 358 | 3300049571 | Ga0501034_0711822 | Ga0501034_0711822_47_838 | 261 |
| 359 | 3300049823 | Ga0501044_0000705 | Ga0501044_0000705_14947_15738 | 261 |
| 360 | 3300053087 | Ga0500643_091449 | Ga0500643_091449_18_815 | 261 |
| 361 | 3300053092 | Ga0500583_0008746 | Ga0500583_0008746_1275_2075 | 261 |
| 362 | 3300053092 | Ga0500583_0011157 | Ga0500583_0011157_334_1134 | 261 |
| 363 | 3300053096 | Ga0500641_0195073 | Ga0500641_0195073_56_856 | 261 |
| 364 | 3300053118 | Ga0500594_0002262 | Ga0500594_0002262_3099_3896 | 261 |
| 365 | 3300053729 | Ga0500625_068820 | Ga0500625_068820_89_886 | 261 |
| 366 | 3300032005 | Ga0307411_10162460 | Ga0307411_101624602 | 262 |
| 367 | 3300046543 | Ga0495645_0045057 | Ga0495645_0045057_219_1031 | 262 |
| 368 | 3300047323 | Ga0495683_0189479 | Ga0495683_0189479_22_834 | 262 |
| 369 | 3300048091 | Ga0495626_0071284 | Ga0495626_0071284_288_1100 | 262 |
| 370 | 3300048929 | Ga0496126_0477753 | Ga0496126_0477753_14_811 | 262 |
| 371 | 3300001989 | JGI24739J22299_10002627 | JGI24739J22299_100026271 | 263 |
| 372 | 3300002459 | JGI24751J29686_10001596 | JGI24751J29686_100015966 | 263 |
| 373 | 3300003323 | rootH1_10115529 | rootH1_101155292 | 263 |
| 374 | 3300005290 | Ga0065712_10211592 | Ga0065712_102115922 | 263 |
| 375 | 3300005327 | Ga0070658_10002088 | Ga0070658_1000208815 | 263 |
| 376 | 3300005331 | Ga0070670_100000046 | Ga0070670_1000000465 | 263 |
| 377 | 3300005333 | Ga0070677_10059409 | Ga0070677_100594091 | 263 |
| 378 | 3300005336 | Ga0070680_100041415 | Ga0070680_1000414154 | 263 |
| 379 | 3300005347 | Ga0070668_100000066 | Ga0070668_10000006632 | 263 |
| 380 | 3300005347 | Ga0070668_100017348 | Ga0070668_1000173484 | 263 |
| 381 | 3300005353 | Ga0070669_100005421 | Ga0070669_1000054217 | 263 |
| 382 | 3300005353 | Ga0070669_100034012 | Ga0070669_1000340122 | 263 |
| 383 | 3300005356 | Ga0070674_100035748 | Ga0070674_1000357484 | 263 |
| 384 | 3300005367 | Ga0070667_100022623 | Ga0070667_1000226236 | 263 |
| 385 | 3300005457 | Ga0070662_100003634 | Ga0070662_1000036342 | 263 |
| 386 | 3300005459 | Ga0068867_100024296 | Ga0068867_1000242963 | 263 |
| 387 | 3300005468 | Ga0070707_100113693 | Ga0070707_1001136932 | 263 |
| 388 | 3300005539 | Ga0068853_100008767 | Ga0068853_1000087676 | 263 |
| 389 | 3300005543 | Ga0070672_100061098 | Ga0070672_1000610983 | 263 |
| 390 | 3300005546 | Ga0070696_100200912 | Ga0070696_1002009122 | 263 |
| 391 | 3300005548 | Ga0070665_100012084 | Ga0070665_1000120847 | 263 |
| 392 | 3300005563 | Ga0068855_100241539 | Ga0068855_1002415392 | 263 |
| 393 | 3300005577 | Ga0068857_100005710 | Ga0068857_1000057104 | 263 |
| 394 | 3300005577 | Ga0068857_100115427 | Ga0068857_1001154272 | 263 |
| 395 | 3300005577 | Ga0068857_100140954 | Ga0068857_1001409542 | 263 |
| 396 | 3300005578 | Ga0068854_100000276 | Ga0068854_1000002767 | 263 |
| 397 | 3300005614 | Ga0068856_100001197 | Ga0068856_10000119718 | 263 |
| 398 | 3300005616 | Ga0068852_100000071 | Ga0068852_10000007140 | 263 |
| 399 | 3300005617 | Ga0068859_100010215 | Ga0068859_1000102152 | 263 |
| 400 | 3300005617 | Ga0068859_100739033 | Ga0068859_1007390332 | 263 |
| 401 | 3300005618 | Ga0068864_100731068 | Ga0068864_1007310681 | 263 |
| 402 | 3300005718 | Ga0068866_10023234 | Ga0068866_100232343 | 263 |
| 403 | 3300005719 | Ga0068861_100028082 | Ga0068861_1000280825 | 263 |
| 404 | 3300005834 | Ga0068851_10153224 | Ga0068851_101532242 | 263 |
| 405 | 3300005840 | Ga0068870_10004591 | Ga0068870_100045913 | 263 |
| 406 | 3300005841 | Ga0068863_100000680 | Ga0068863_10000068015 | 263 |
| 407 | 3300005842 | Ga0068858_100037638 | Ga0068858_1000376382 | 263 |
| 408 | 3300005843 | Ga0068860_100000479 | Ga0068860_10000047940 | 263 |
| 409 | 3300005843 | Ga0068860_100033493 | Ga0068860_1000334933 | 263 |
| 410 | 3300005844 | Ga0068862_100000118 | Ga0068862_10000011839 | 263 |
| 411 | 3300005844 | Ga0068862_100013453 | Ga0068862_1000134535 | 263 |
| 412 | 3300005844 | Ga0068862_100077838 | Ga0068862_1000778383 | 263 |
| 413 | 3300006195 | Ga0075366_10038779 | Ga0075366_100387793 | 263 |
| 414 | 3300006846 | Ga0075430_100019681 | Ga0075430_1000196813 | 263 |
| 415 | 3300006847 | Ga0075431_100160688 | Ga0075431_1001606883 | 263 |
| 416 | 3300006847 | Ga0075431_100261672 | Ga0075431_1002616723 | 263 |
| 417 | 3300006880 | Ga0075429_100329312 | Ga0075429_1003293122 | 263 |
| 418 | 3300006931 | Ga0097620_100010215 | Ga0097620_1000102152 | 263 |
| 419 | 3300006931 | Ga0097620_100739120 | Ga0097620_1007391202 | 263 |
| 420 | 3300009093 | Ga0105240_10001039 | Ga0105240_1000103919 | 263 |
| 421 | 3300009094 | Ga0111539_10114185 | Ga0111539_101141853 | 263 |
| 422 | 3300009101 | Ga0105247_10005971 | Ga0105247_100059714 | 263 |
| 423 | 3300009147 | Ga0114129_10628365 | Ga0114129_106283651 | 263 |
| 424 | 3300009177 | Ga0105248_10101568 | Ga0105248_101015684 | 263 |
| 425 | 3300009551 | Ga0105238_10007472 | Ga0105238_100074728 | 263 |
| 426 | 3300009553 | Ga0105249_10000119 | Ga0105249_1000011935 | 263 |
| 427 | 3300013306 | Ga0163162_10222776 | Ga0163162_102227762 | 263 |
| 428 | 3300013308 | Ga0157375_10480743 | Ga0157375_104807432 | 263 |
| 429 | 3300014326 | Ga0157380_10373151 | Ga0157380_103731512 | 263 |
| 430 | 3300014968 | Ga0157379_10068076 | Ga0157379_100680762 | 263 |
| 431 | 3300017792 | Ga0163161_10389665 | Ga0163161_103896651 | 263 |
| 432 | 3300025272 | Ga0209455_1008365 | Ga0209455_10083652 | 263 |
| 433 | 3300025298 | Ga0209050_1000388 | Ga0209050_100038813 | 263 |
| 434 | 3300025893 | Ga0207682_10041994 | Ga0207682_100419943 | 263 |
| 435 | 3300025899 | Ga0207642_10068100 | Ga0207642_100681002 | 263 |
| 436 | 3300025900 | Ga0207710_10005614 | Ga0207710_100056142 | 263 |
| 437 | 3300025903 | Ga0207680_10413237 | Ga0207680_104132371 | 263 |
| 438 | 3300025907 | Ga0207645_10007195 | Ga0207645_100071953 | 263 |
| 439 | 3300025908 | Ga0207643_10010620 | Ga0207643_100106203 | 263 |
| 440 | 3300025909 | Ga0207705_10000296 | Ga0207705_100002968 | 263 |
| 441 | 3300025913 | Ga0207695_10003917 | Ga0207695_100039175 | 263 |
| 442 | 3300025917 | Ga0207660_10137470 | Ga0207660_101374702 | 263 |
| 443 | 3300025922 | Ga0207646_10106053 | Ga0207646_101060532 | 263 |
| 444 | 3300025923 | Ga0207681_10006265 | Ga0207681_100062658 | 263 |
| 445 | 3300025923 | Ga0207681_10085653 | Ga0207681_100856532 | 263 |
| 446 | 3300025924 | Ga0207694_10024486 | Ga0207694_100244867 | 263 |
| 447 | 3300025924 | Ga0207694_10095672 | Ga0207694_100956722 | 263 |
| 448 | 3300025925 | Ga0207650_10000008 | Ga0207650_1000000839 | 263 |
| 449 | 3300025933 | Ga0207706_10002119 | Ga0207706_100021193 | 263 |
| 450 | 3300025933 | Ga0207706_10002132 | Ga0207706_1000213213 | 263 |
| 451 | 3300025937 | Ga0207669_10003651 | Ga0207669_100036514 | 263 |
| 452 | 3300025937 | Ga0207669_10237509 | Ga0207669_102375092 | 263 |
| 453 | 3300025940 | Ga0207691_10005982 | Ga0207691_100059824 | 263 |
| 454 | 3300025949 | Ga0207667_10203241 | Ga0207667_102032413 | 263 |
| 455 | 3300025961 | Ga0207712_10000048 | Ga0207712_1000004834 | 263 |
| 456 | 3300025972 | Ga0207668_10000055 | Ga0207668_1000005552 | 263 |
| 457 | 3300025972 | Ga0207668_10011650 | Ga0207668_100116503 | 263 |
| 458 | 3300025972 | Ga0207668_10292374 | Ga0207668_102923742 | 263 |
| 459 | 3300025981 | Ga0207640_10001445 | Ga0207640_100014453 | 263 |
| 460 | 3300025981 | Ga0207640_10161728 | Ga0207640_101617282 | 263 |
| 461 | 3300025986 | Ga0207658_10013719 | Ga0207658_100137192 | 263 |
| 462 | 3300026035 | Ga0207703_10017243 | Ga0207703_100172432 | 263 |
| 463 | 3300026041 | Ga0207639_10085039 | Ga0207639_100850391 | 263 |
| 464 | 3300026078 | Ga0207702_10004349 | Ga0207702_100043499 | 263 |
| 465 | 3300026088 | Ga0207641_10005391 | Ga0207641_100053912 | 263 |
| 466 | 3300026089 | Ga0207648_10001606 | Ga0207648_1000160620 | 263 |
| 467 | 3300026089 | Ga0207648_10073581 | Ga0207648_100735812 | 263 |
| 468 | 3300026095 | Ga0207676_10070859 | Ga0207676_100708594 | 263 |
| 469 | 3300026095 | Ga0207676_10352383 | Ga0207676_103523832 | 263 |
| 470 | 3300026116 | Ga0207674_10015001 | Ga0207674_100150015 | 263 |
| 471 | 3300026116 | Ga0207674_10115356 | Ga0207674_101153561 | 263 |
| 472 | 3300026116 | Ga0207674_10271856 | Ga0207674_102718562 | 263 |
| 473 | 3300026118 | Ga0207675_100001154 | Ga0207675_10000115411 | 263 |
| 474 | 3300026142 | Ga0207698_10000062 | Ga0207698_1000006232 | 263 |
| 475 | 3300027111 | Ga0209281_1012173 | Ga0209281_10121732 | 263 |
| 476 | 3300027526 | Ga0209968_1005693 | Ga0209968_10056932 | 263 |
| 477 | 3300027614 | Ga0209970_1003899 | Ga0209970_10038993 | 263 |
| 478 | 3300027617 | Ga0210002_1000575 | Ga0210002_10005753 | 263 |
| 479 | 3300027665 | Ga0209983_1004982 | Ga0209983_10049823 | 263 |
| 480 | 3300027682 | Ga0209971_1001620 | Ga0209971_10016206 | 263 |
| 481 | 3300027695 | Ga0209966_1013897 | Ga0209966_10138972 | 263 |
| 482 | 3300027717 | Ga0209998_10000317 | Ga0209998_100003174 | 263 |
| 483 | 3300027876 | Ga0209974_10001822 | Ga0209974_100018224 | 263 |
| 484 | 3300027907 | Ga0207428_10201036 | Ga0207428_102010363 | 263 |
| 485 | 3300028379 | Ga0268266_10027437 | Ga0268266_100274372 | 263 |
| 486 | 3300028380 | Ga0268265_10000139 | Ga0268265_1000013945 | 263 |
| 487 | 3300028380 | Ga0268265_10006620 | Ga0268265_100066201 | 263 |
| 488 | 3300028381 | Ga0268264_10000585 | Ga0268264_100005859 | 263 |
| 489 | 3300028381 | Ga0268264_10002651 | Ga0268264_100026515 | 263 |
| 490 | 3300031456 | Ga0307513_10103263 | Ga0307513_101032632 | 263 |
| 491 | 3300031507 | Ga0307509_10000038 | Ga0307509_10000038157 | 263 |
| 492 | 3300031548 | Ga0307408_100109357 | Ga0307408_1001093572 | 263 |
| 493 | 3300031548 | Ga0307408_100226072 | Ga0307408_1002260721 | 263 |
| 494 | 3300031731 | Ga0307405_10154795 | Ga0307405_101547952 | 263 |
| 495 | 3300031901 | Ga0307406_10392673 | Ga0307406_103926731 | 263 |
| 496 | 3300031911 | Ga0307412_10052157 | Ga0307412_100521574 | 263 |
| 497 | 3300033180 | Ga0307510_10045997 | Ga0307510_100459975 | 263 |
| 498 | 3300035112 | Ga0373932_0070118 | Ga0373932_0070118_269_1075 | 263 |
| 499 | 3300046460 | Ga0495638_0021582 | Ga0495638_0021582_2301_3113 | 263 |
| 500 | 3300046492 | Ga0495585_0001077 | Ga0495585_0001077_18510_19316 | 263 |
| 501 | 3300046492 | Ga0495585_0025691 | Ga0495585_0025691_805_1623 | 263 |
| 502 | 3300046500 | Ga0495596_0000739 | Ga0495596_0000739_13387_14193 | 263 |
| 503 | 3300046500 | Ga0495596_0001271 | Ga0495596_0001271_3059_3862 | 263 |
| 504 | 3300046501 | Ga0495607_0034109 | Ga0495607_0034109_1893_2699 | 263 |
| 505 | 3300046507 | Ga0495606_0033860 | Ga0495606_0033860_733_1539 | 263 |
| 506 | 3300046507 | Ga0495606_0050119 | Ga0495606_0050119_1617_2420 | 263 |
| 507 | 3300046512 | Ga0495610_0000170 | Ga0495610_0000170_70755_71561 | 263 |
| 508 | 3300046512 | Ga0495610_0006606 | Ga0495610_0006606_2003_2806 | 263 |
| 509 | 3300046513 | Ga0495616_0000040 | Ga0495616_0000040_18803_19612 | 263 |
| 510 | 3300046513 | Ga0495616_0071585 | Ga0495616_0071585_765_1571 | 263 |
| 511 | 3300046519 | Ga0495632_0048293 | Ga0495632_0048293_1203_2009 | 263 |
| 512 | 3300046522 | Ga0495643_0000039 | Ga0495643_0000039_75859_76665 | 263 |
| 513 | 3300046538 | Ga0495609_0011981 | Ga0495609_0011981_972_1778 | 263 |
| 514 | 3300046558 | Ga0495633_0172024 | Ga0495633_0172024_80_886 | 263 |
| 515 | 3300046616 | Ga0495668_0007648 | Ga0495668_0007648_1711_2520 | 263 |
| 516 | 3300046616 | Ga0495668_0153074 | Ga0495668_0153074_422_1228 | 263 |
| 517 | 3300046660 | Ga0495625_0000093 | Ga0495625_0000093_61676_62479 | 263 |
| 518 | 3300046660 | Ga0495625_0018414 | Ga0495625_0018414_1490_2302 | 263 |
| 519 | 3300046660 | Ga0495625_0343845 | Ga0495625_0343845_91_897 | 263 |
| 520 | 3300046691 | Ga0495670_0017088 | Ga0495670_0017088_2494_3306 | 263 |
| 521 | 3300046692 | Ga0495671_0071022 | Ga0495671_0071022_725_1531 | 263 |
| 522 | 3300047469 | Ga0495673_0030476 | Ga0495673_0030476_485_1351 | 263 |
| 523 | 3300047472 | Ga0495686_0000060 | Ga0495686_0000060_153888_154691 | 263 |
| 524 | 3300048090 | Ga0495615_0000003 | Ga0495615_0000003_70474_71280 | 263 |
| 525 | 3300048091 | Ga0495626_0000848 | Ga0495626_0000848_14676_15479 | 263 |
| 526 | 3300048904 | Ga0496101_0023087 | Ga0496101_0023087_1214_2017 | 263 |
| 527 | 3300048919 | Ga0496116_0000361 | Ga0496116_0000361_49787_50590 | 263 |
| 528 | 3300048921 | Ga0496118_0011348 | Ga0496118_0011348_3860_4663 | 263 |
| 529 | 3300048923 | Ga0496120_0030592 | Ga0496120_0030592_2129_2932 | 263 |
| 530 | 3300048924 | Ga0496121_0004442 | Ga0496121_0004442_17063_17869 | 263 |
| 531 | 3300048925 | Ga0496122_0002822 | Ga0496122_0002822_4503_5306 | 263 |
| 532 | 3300048925 | Ga0496122_0006933 | Ga0496122_0006933_106_912 | 263 |
| 533 | 3300048926 | Ga0496123_0001093 | Ga0496123_0001093_19783_20586 | 263 |
| 534 | 3300048926 | Ga0496123_0003427 | Ga0496123_0003427_16997_17803 | 263 |
| 535 | 3300048927 | Ga0496124_0006793 | Ga0496124_0006793_10564_11370 | 263 |
| 536 | 3300048927 | Ga0496124_0046394 | Ga0496124_0046394_994_1797 | 263 |
| 537 | 3300048927 | Ga0496124_0353133 | Ga0496124_0353133_135_941 | 263 |
| 538 | 3300048928 | Ga0496125_0028843 | Ga0496125_0028843_1924_2727 | 263 |
| 539 | 3300048929 | Ga0496126_0000136 | Ga0496126_0000136_116924_117727 | 263 |
| 540 | 3300049515 | Ga0501292_000004 | Ga0501292_000004_116122_116928 | 263 |
| 541 | 3300049517 | Ga0501294_000150 | Ga0501294_000150_3223_4029 | 263 |
| 542 | 3300049524 | Ga0501301_003525 | Ga0501301_003525_24_830 | 263 |
| 543 | 3300049573 | Ga0501037_0109672 | Ga0501037_0109672_974_1777 | 263 |
| 544 | 3300049652 | Ga0501202_007786 | Ga0501202_007786_151_957 | 263 |
| 545 | 3300049653 | Ga0501206_002373 | Ga0501206_002373_58_864 | 263 |
| 546 | 3300049662 | Ga0501222_009140 | Ga0501222_009140_171_977 | 263 |
| 547 | 3300049663 | Ga0501223_001885 | Ga0501223_001885_3206_4012 | 263 |
| 548 | 3300049664 | Ga0501224_005774 | Ga0501224_005774_395_1201 | 263 |
| 549 | 3300049665 | Ga0501227_005723 | Ga0501227_005723_1513_2319 | 263 |
| 550 | 3300049668 | Ga0501233_005913 | Ga0501233_005913_1105_1911 | 263 |
| 551 | 3300049686 | Ga0501257_000013 | Ga0501257_000013_41742_42560 | 263 |
| 552 | 3300049690 | Ga0501261_000010 | Ga0501261_000010_31641_32447 | 263 |
| 553 | 3300049704 | Ga0501221_024335 | Ga0501221_024335_360_1166 | 263 |
| 554 | 3300049708 | Ga0501245_000129 | Ga0501245_000129_5322_6128 | 263 |
| 555 | 3300049775 | Ga0501279_000005 | Ga0501279_000005_61688_62494 | 263 |
| 556 | 3300049776 | Ga0501280_000277 | Ga0501280_000277_8927_9733 | 263 |
| 557 | 3300049777 | Ga0501281_00015 | Ga0501281_00015_3200_4006 | 263 |
| 558 | 3300049778 | Ga0501282_000134 | Ga0501282_000134_7237_8043 | 263 |
| 559 | 3300049779 | Ga0501283_001837 | Ga0501283_001837_139_945 | 263 |
| 560 | 3300049823 | Ga0501044_0001340 | Ga0501044_0001340_12006_12809 | 263 |
| 561 | 3300050493 | nmdc:mga0k408_83733_c1 | nmdc:mga0k408_83733_c1_150_956 | 263 |
| 562 | 3300050507 | nmdc:mga05p37_538442_c1 | nmdc:mga05p37_538442_c1_47_853 | 263 |
| 563 | 3300050508 | nmdc:mga09592_172593_c1 | nmdc:mga09592_172593_c1_654_1445 | 263 |
| 564 | 3300050509 | nmdc:mga0qj67_89527_c1 | nmdc:mga0qj67_89527_c1_1191_1982 | 263 |
| 565 | 3300050510 | nmdc:mga06r32_187956_c1 | nmdc:mga06r32_187956_c1_474_1265 | 263 |
| 566 | 3300050510 | nmdc:mga06r32_19791_c1 | nmdc:mga06r32_19791_c1_3211_4002 | 263 |
| 567 | 3300053087 | Ga0500643_004375 | Ga0500643_004375_5583_6395 | 263 |
| 568 | 3300053125 | Ga0500618_001102 | Ga0500618_001102_12291_13100 | 263 |
| 569 | 3300053151 | Ga0500604_0005509 | Ga0500604_0005509_1655_2464 | 263 |
| 570 | 3300053158 | Ga0500627_0000305 | Ga0500627_0000305_941_1750 | 263 |
| 571 | 3300005459 | Ga0068867_100220811 | Ga0068867_1002208112 | 264 |
| 572 | 3300025940 | Ga0207691_10210260 | Ga0207691_102102602 | 264 |
| 573 | 3300046615 | Ga0495656_0015123 | Ga0495656_0015123_690_1508 | 264 |
| 574 | 3300006195 | Ga0075366_10093667 | Ga0075366_100936672 | 265 |
| 575 | 3300006353 | Ga0075370_10132604 | Ga0075370_101326042 | 265 |
| 576 | 3300031727 | Ga0316576_10277347 | Ga0316576_102773471 | 265 |
| 577 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_833412_834236 | 265 |
| 578 | 3300046519 | Ga0495632_0123441 | Ga0495632_0123441_244_1056 | 265 |
| 579 | 3300046525 | Ga0495663_0000001 | Ga0495663_0000001_39060_39884 | 265 |
| 580 | 3300046558 | Ga0495633_0000122 | Ga0495633_0000122_64912_65736 | 265 |
| 581 | 3300047472 | Ga0495686_0007537 | Ga0495686_0007537_4462_5286 | 265 |
| 582 | 3300048905 | Ga0496102_0014133 | Ga0496102_0014133_748_1548 | 265 |
| 583 | 3300048929 | Ga0496126_0347269 | Ga0496126_0347269_278_1102 | 265 |
| 584 | 3300050493 | nmdc:mga0k408_31771_c2 | nmdc:mga0k408_31771_c2_378_1202 | 265 |
| 585 | 3300050496 | nmdc:mga07m45_136485_c1 | nmdc:mga07m45_136485_c1_384_1235 | 265 |
| 586 | 3300031995 | Ga0307409_100107920 | Ga0307409_1001079203 | 266 |
| 587 | 3300032002 | Ga0307416_100542345 | Ga0307416_1005423452 | 266 |
| 588 | 3300032126 | Ga0307415_100105417 | Ga0307415_1001054172 | 266 |
| 589 | 3300042876 | Ga0451577_0182713 | Ga0451577_0182713_1046_1846 | 266 |
| 590 | 3300005841 | Ga0068863_100222921 | Ga0068863_1002229213 | 267 |
| 591 | 3300021384 | Ga0213876_10099717 | Ga0213876_100997173 | 267 |
| 592 | 3300039437 | Ga0436365_0251199 | Ga0436365_0251199_2185_2991 | 267 |
| 593 | 3300039450 | Ga0436363_0930417 | Ga0436363_0930417_72_878 | 267 |
| 594 | 3300042876 | Ga0451577_0002093 | Ga0451577_0002093_6803_7606 | 267 |
| 595 | 3300042876 | Ga0451577_0004914 | Ga0451577_0004914_12283_13086 | 267 |
| 596 | 3300044673 | Ga0453683_0007037 | Ga0453683_0007037_4571_5374 | 267 |
| 597 | 3300044712 | Ga0453684_0017528 | Ga0453684_0017528_4572_5375 | 267 |
| 598 | 3300045051 | Ga0451576_0073907 | Ga0451576_0073907_1052_1855 | 267 |
| 599 | 2162886007 | SwRhRL2b_contig_949771 | SwRhRL2b_0117.00004670 | 268 |
| 600 | 3300005289 | Ga0065704_10001355 | Ga0065704_100013557 | 268 |
| 601 | 3300005439 | Ga0070711_100014843 | Ga0070711_1000148433 | 268 |
| 602 | 3300006175 | Ga0070712_100138822 | Ga0070712_1001388222 | 268 |
| 603 | 3300006844 | Ga0075428_100024159 | Ga0075428_1000241593 | 268 |
| 604 | 3300006847 | Ga0075431_100092136 | Ga0075431_1000921363 | 268 |
| 605 | 3300009545 | Ga0105237_10114025 | Ga0105237_101140253 | 268 |
| 606 | 3300009551 | Ga0105238_10036602 | Ga0105238_100366024 | 268 |
| 607 | 3300025913 | Ga0207695_10040246 | Ga0207695_100402463 | 268 |
| 608 | 3300025914 | Ga0207671_10034845 | Ga0207671_100348454 | 268 |
| 609 | 3300025915 | Ga0207693_10197064 | Ga0207693_101970642 | 268 |
| 610 | 3300025916 | Ga0207663_10002130 | Ga0207663_100021304 | 268 |
| 611 | 3300032002 | Ga0307416_100958243 | Ga0307416_1009582431 | 268 |
| 612 | 3300042003 | Ga0439443_008773 | Ga0439443_008773_598_1404 | 268 |
| 613 | 3300042436 | Ga0439435_0015068 | Ga0439435_0015068_684_1490 | 268 |
| 614 | 3300042876 | Ga0451577_0010487 | Ga0451577_0010487_3132_3938 | 268 |
| 615 | 3300042876 | Ga0451577_0020834 | Ga0451577_0020834_4899_5705 | 268 |
| 616 | 3300042876 | Ga0451577_0079101 | Ga0451577_0079101_77_883 | 268 |
| 617 | 3300044712 | Ga0453684_0018551 | Ga0453684_0018551_6233_7039 | 268 |
| 618 | 3300045051 | Ga0451576_0016357 | Ga0451576_0016357_353_1159 | 268 |
| 619 | 3300048907 | Ga0496104_0008239 | Ga0496104_0008239_4203_5036 | 268 |
| 620 | 3300048908 | Ga0496105_0007367 | Ga0496105_0007367_2390_3223 | 268 |
| 621 | 3300048917 | Ga0496114_0020727 | Ga0496114_0020727_2745_3578 | 268 |
| 622 | 3300048918 | Ga0496115_0004400 | Ga0496115_0004400_4539_5372 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4npc-assembly1.cif.gz_A | crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis | 0.9607 | 4 | 246 |
| 6zzs-assembly2.cif.gz_F-2 | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate | 0.9513 | 4 | 246 |
| 1uls-assembly1.cif.gz_C | crystal structure of tt0140 from thermus thermophilus hb8 | 0.9511 | 3 | 249 |
| 5g4l-assembly1.cif.gz_A | phloroglucinol reductase from clostridium sp. with bound nadph | 0.9499 | 4 | 246 |
| 3awd-assembly1.cif.gz_D | crystal structure of gox2181 | 0.9472 | 3 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9607 | 4 | 246 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9503 | 4 | 184 | 3.40.50.720 |
| 1ulsC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9498 | 4 | 249 | 3.40.50.720 |
| 1nfrD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9451 | 1 | 246 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9447 | 88 | 188 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8NSE2-F1-model_v4 | Short-chain dehydrogenase | 0.9719 | 3 | 189 |
GO:0016616
|
| AF-A0A6L6R527-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9706 | 1 | 192 |
GO:0016491
|
| AF-A0A3C2B842-F1-model_v4 | Short-chain dehydrogenase | 0.9698 | 2 | 260 |
|
| AF-A0A437PFB9-F1-model_v4 | SDR family oxidoreductase | 0.9642 | 22 | 246 |
GO:0016491
|
| AF-A0A3S1RX16-F1-model_v4 | SDR family oxidoreductase | 0.9635 | 22 | 246 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar