F470094

General Info

Members Datasets Scaffolds Average Seq Length
622 336 602 264

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10007472|Ga0105238_100074728
Length 296
Sequence MPLLFFVRVGAAARMLDFPFIQQKREGRMGRLAGKKAVILGASSPGNMGQHIARRFLAEGASVLVSGRKADVIEAFADETGSAWLACDLTDEASIAALGEGAMAQLGGVEIAVNATGWGFLKPFLDNDRAELEAITALQFIGPFQFFQAMIRKMGTAHGGRGGSLIQISSATATIMLNDHAAYMGTKAGTDHVIRCIAHEFGKEGIRANSISPGLTETPMTVDATAVPGLVEAFLPGYPLGRIGTSDDIAAAAVWLASDECFMTGENLQVNGGLTLRRNPTPEEMAASMARAAGQT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
4 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
10 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
11 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
12 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
18 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
301 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
302 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
307 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
308 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
309 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
310 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
311 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
314 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
315 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
316 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
317 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
318 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
319 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
320 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
330 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
334 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
335 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
336 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0
Isolates 3.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0.48
Rhizoplane 5.95
Rhizosphere 81.67
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_949771 2162886007 Bacteria 4752
2 JGI24736J21556_1000085 3300001904 Bacteria 15412
3 JGI24736J21556_1019188 3300001904 Bacteria 1080
4 JGI24741J21665_1000031 3300001915 Bacteria 33403
5 JGI24741J21665_1010126 3300001915 Bacteria 1702
6 JGI24752J21851_1000158 3300001976 Bacteria 9244
7 JGI24740J21852_10000098 3300001979 Bacteria 30614
8 JGI24739J22299_10002627 3300001989 Bacteria 6923
9 JGI24739J22299_10029189 3300001989 Bacteria 1919
10 JGI24737J22298_10000085 3300001990 Bacteria 27466
11 JGI24750J21931_1003840 3300002070 Bacteria 1808
12 JGI24748J21848_1000086 3300002074 Bacteria 27519
13 JGI24034J26672_10000008 3300002239 Bacteria 200986
14 JGI24742J22300_10001489 3300002244 Bacteria 3703
15 JGI24751J29686_10001596 3300002459 Bacteria 4685
16 rootH1_10115529 3300003323 Bacteria 3027
17 Ga0065704_10001355 3300005289 Bacteria 15867
18 Ga0065712_10211592 3300005290 Unclassified 1071
19 Ga0065715_10026849 3300005293 Bacteria 1188
20 Ga0070658_10002088 3300005327 Bacteria 16743
21 Ga0070658_10016771 3300005327 Bacteria 5863
22 Ga0070658_10059168 3300005327 Bacteria 3120
23 Ga0070658_10291477 3300005327 Bacteria 1391
24 Ga0070676_10000512 3300005328 Bacteria 18570
25 Ga0070683_100186020 3300005329 Bacteria 1972
26 Ga0070690_100000006 3300005330 Bacteria 132992
27 Ga0070690_100040550 3300005330 Bacteria 2945
28 Ga0070670_100000046 3300005331 Bacteria 138621
29 Ga0070670_100088333 3300005331 Bacteria 2665
30 Ga0070677_10059409 3300005333 Bacteria 1572
31 Ga0068869_100003432 3300005334 Bacteria 9689
32 Ga0070666_10000004 3300005335 Bacteria 372098
33 Ga0070666_10004720 3300005335 Bacteria 8333
34 Ga0070680_100041415 3300005336 Bacteria 3735
35 Ga0068868_100052835 3300005338 Bacteria 3199
36 Ga0070660_100000403 3300005339 Bacteria 28790
37 Ga0070660_100103557 3300005339 Bacteria 2257
38 Ga0070689_100360482 3300005340 Bacteria 1221
39 Ga0070661_100000046 3300005344 Bacteria 92262
40 Ga0070661_100000720 3300005344 Bacteria 24214
41 Ga0070668_100000066 3300005347 Bacteria 65221
42 Ga0070668_100017348 3300005347 Bacteria 5392
43 Ga0070669_100000116 3300005353 Bacteria 75907
44 Ga0070669_100005421 3300005353 Bacteria 9201
45 Ga0070669_100034012 3300005353 Bacteria 3689
46 Ga0070675_100007411 3300005354 Bacteria 8474
47 Ga0070671_100006317 3300005355 Bacteria 9451
48 Ga0070671_100006590 3300005355 Bacteria 9280
49 Ga0070671_100117104 3300005355 Bacteria 2240
50 Ga0070671_100333157 3300005355 Bacteria 1294
51 Ga0070674_100035748 3300005356 Bacteria 3329
52 Ga0070674_100371928 3300005356 Bacteria 1160
53 Ga0070673_100006452 3300005364 Bacteria 7625
54 Ga0070659_100001027 3300005366 Bacteria 20434
55 Ga0070659_100071295 3300005366 Bacteria 2762
56 Ga0070667_100010853 3300005367 Bacteria 7533
57 Ga0070667_100022623 3300005367 Bacteria 5212
58 Ga0070667_100092462 3300005367 Bacteria 2603
59 Ga0070709_10373977 3300005434 Bacteria 1058
60 Ga0070709_10376230 3300005434 Bacteria 1055
61 Ga0070714_100094079 3300005435 Bacteria 2630
62 Ga0070713_100001372 3300005436 Bacteria 15583
63 Ga0070711_100014843 3300005439 Bacteria 4919
64 Ga0070678_100530970 3300005456 Bacteria 1042
65 Ga0070662_100003634 3300005457 Bacteria 9627
66 Ga0070662_100425994 3300005457 Bacteria 1098
67 Ga0068867_100004028 3300005459 Bacteria 10336
68 Ga0068867_100024296 3300005459 Bacteria 4342
69 Ga0068867_100170745 3300005459 Bacteria 1722
70 Ga0068867_100220811 3300005459 Unclassified 1527
71 Ga0070707_100113693 3300005468 Bacteria 2627
72 Ga0070707_100146208 3300005468 Bacteria 2301
73 Ga0068853_100008767 3300005539 Bacteria 8135
74 Ga0068853_100680318 3300005539 Bacteria 980
75 Ga0070672_100024584 3300005543 Bacteria 4455
76 Ga0070672_100061098 3300005543 Bacteria 2969
77 Ga0070686_100000012 3300005544 Bacteria 176038
78 Ga0070696_100200912 3300005546 Unclassified 1488
79 Ga0070665_100012084 3300005548 Bacteria 8711
80 Ga0070665_100083473 3300005548 Bacteria 3199
81 Ga0068855_100000336 3300005563 Bacteria 58477
82 Ga0068855_100241539 3300005563 Bacteria 2018
83 Ga0070664_100007227 3300005564 Bacteria 8958
84 Ga0070664_100142237 3300005564 Bacteria 2113
85 Ga0070664_100171531 3300005564 Bacteria 1924
86 Ga0068857_100005710 3300005577 Bacteria 10641
87 Ga0068857_100079703 3300005577 Bacteria 2923
88 Ga0068857_100115427 3300005577 Bacteria 2415
89 Ga0068857_100140954 3300005577 Bacteria 2179
90 Ga0068854_100000276 3300005578 Bacteria 34585
91 Ga0068854_100075851 3300005578 Bacteria 2470
92 Ga0068854_100088908 3300005578 Bacteria 2295
93 Ga0068854_100100254 3300005578 Bacteria 2170
94 Ga0068854_100149935 3300005578 Bacteria 1797
95 Ga0068854_100235972 3300005578 Bacteria 1454
96 Ga0068854_100343225 3300005578 Bacteria 1220
97 Ga0068856_100001197 3300005614 Bacteria 27340
98 Ga0068856_100460507 3300005614 Bacteria 1292
99 Ga0068852_100000071 3300005616 Bacteria 70039
100 Ga0068852_100004277 3300005616 Bacteria 10076
101 Ga0068852_100631314 3300005616 Bacteria 1077
102 Ga0068859_100010215 3300005617 Bacteria 9448
103 Ga0068859_100024733 3300005617 Bacteria 6027
104 Ga0068859_100179337 3300005617 Unclassified 2201
105 Ga0068859_100739033 3300005617 Bacteria 1073
106 Ga0068864_100731068 3300005618 Unclassified 969
107 Ga0068866_10007171 3300005718 Bacteria 4662
108 Ga0068866_10023234 3300005718 Bacteria 2881
109 Ga0068861_100000143 3300005719 Bacteria 36538
110 Ga0068861_100028082 3300005719 Bacteria 4104
111 Ga0068851_10001398 3300005834 Bacteria 10545
112 Ga0068851_10006671 3300005834 Bacteria 5280
113 Ga0068851_10153224 3300005834 Bacteria 1261
114 Ga0068870_10004591 3300005840 Bacteria 5953
115 Ga0068863_100000013 3300005841 Bacteria 220357
116 Ga0068863_100000680 3300005841 Bacteria 34407
117 Ga0068863_100084685 3300005841 Bacteria 3004
118 Ga0068863_100222921 3300005841 Bacteria 1817
119 Ga0068858_100000246 3300005842 Bacteria 58225
120 Ga0068858_100001693 3300005842 Bacteria 22548
121 Ga0068858_100015863 3300005842 Bacteria 7082
122 Ga0068858_100037638 3300005842 Bacteria 4487
123 Ga0068860_100000009 3300005843 Bacteria 372089
124 Ga0068860_100000479 3300005843 Bacteria 49770
125 Ga0068860_100033493 3300005843 Bacteria 4929
126 Ga0068860_100122570 3300005843 Bacteria 2490
127 Ga0068862_100000118 3300005844 Bacteria 92548
128 Ga0068862_100000315 3300005844 Bacteria 52909
129 Ga0068862_100013453 3300005844 Bacteria 6774
130 Ga0068862_100077838 3300005844 Bacteria 2872
131 Ga0070715_10005084 3300006163 Bacteria 4363
132 Ga0070712_100004762 3300006175 Bacteria 8389
133 Ga0070712_100138822 3300006175 Unclassified 1852
134 Ga0075366_10038779 3300006195 Bacteria 2814
135 Ga0075366_10093667 3300006195 Bacteria 1800
136 Ga0097621_100003423 3300006237 Bacteria 10928
137 Ga0097621_100657296 3300006237 Bacteria 962
138 Ga0075370_10132604 3300006353 Bacteria 1454
139 Ga0068871_100222333 3300006358 Bacteria 1636
140 Ga0068871_100283751 3300006358 Bacteria 1449
141 Ga0068871_100449569 3300006358 Bacteria 1155
142 Ga0075428_100024159 3300006844 Bacteria 6724
143 Ga0075430_100019681 3300006846 Bacteria 5742
144 Ga0075431_100092136 3300006847 Bacteria 3128
145 Ga0075431_100160688 3300006847 Bacteria 2310
146 Ga0075431_100261672 3300006847 Unclassified 1755
147 Ga0075429_100329312 3300006880 Unclassified 1336
148 Ga0068865_100029140 3300006881 Bacteria 3660
149 Ga0097620_100010215 3300006931 Bacteria 9448
150 Ga0097620_100024733 3300006931 Bacteria 6027
151 Ga0097620_100179321 3300006931 Unclassified 2201
152 Ga0097620_100739120 3300006931 Bacteria 1073
153 Ga0105240_10001039 3300009093 Bacteria 49357
154 Ga0105240_10001073 3300009093 Bacteria 48286
155 Ga0105240_10003918 3300009093 Bacteria 22988
156 Ga0105240_10018370 3300009093 Bacteria 9390
157 Ga0105240_10021136 3300009093 Bacteria 8664
158 Ga0105240_10047493 3300009093 Bacteria 5432
159 Ga0105240_10091059 3300009093 Bacteria 3727
160 Ga0111539_10114185 3300009094 Bacteria 3168
161 Ga0105245_10025979 3300009098 Bacteria 5152
162 Ga0105245_10107701 3300009098 Bacteria 2587
163 Ga0105245_10143493 3300009098 Bacteria 2251
164 Ga0105247_10005971 3300009101 Bacteria 7586
165 Ga0114129_10628365 3300009147 Bacteria 1388
166 Ga0105243_10142293 3300009148 Bacteria 2048
167 Ga0105241_10001892 3300009174 Bacteria 15865
168 Ga0105241_10228079 3300009174 Bacteria 1569
169 Ga0105242_10005332 3300009176 Bacteria 9937
170 Ga0105248_10000165 3300009177 Bacteria 77602
171 Ga0105248_10030381 3300009177 Bacteria 6032
172 Ga0105248_10101568 3300009177 Bacteria 3242
173 Ga0105237_10003132 3300009545 Bacteria 19904
174 Ga0105237_10007137 3300009545 Bacteria 12276
175 Ga0105237_10114025 3300009545 Bacteria 2695
176 Ga0105238_10000659 3300009551 Bacteria 36189
177 Ga0105238_10007472 3300009551 Bacteria 10949
178 Ga0105238_10016052 3300009551 Bacteria 7574
179 Ga0105238_10036602 3300009551 Bacteria 4990
180 Ga0105238_10041604 3300009551 Bacteria 4654
181 Ga0105238_10356892 3300009551 Bacteria 1451
182 Ga0105238_10400474 3300009551 Bacteria 1366
183 Ga0105238_10440416 3300009551 Bacteria 1299
184 Ga0105249_10000006 3300009553 Bacteria 354449
185 Ga0105249_10000119 3300009553 Bacteria 107840
186 Ga0105239_10000024 3300010375 Bacteria 256334
187 Ga0105239_10000031 3300010375 Bacteria 226947
188 Ga0105239_10106433 3300010375 Bacteria 3107
189 Ga0105239_10215029 3300010375 Bacteria 2155
190 Ga0105239_10488590 3300010375 Bacteria 1399
191 Ga0105239_10815416 3300010375 Bacteria 1069
192 Ga0157326_1000087 3300012513 Bacteria 9183
193 Ga0157373_10130261 3300013100 Unclassified 1769
194 Ga0157371_10000043 3300013102 Bacteria 197887
195 Ga0157371_10149709 3300013102 Bacteria 1664
196 Ga0157370_10101798 3300013104 Bacteria 2690
197 Ga0157370_10706845 3300013104 Bacteria 920
198 Ga0157369_10017858 3300013105 Bacteria 7962
199 Ga0157369_10019079 3300013105 Bacteria 7678
200 Ga0157369_10028283 3300013105 Bacteria 6206
201 Ga0157374_10093323 3300013296 Bacteria 2874
202 Ga0157378_10116528 3300013297 Bacteria 2456
203 Ga0163162_10011059 3300013306 Bacteria 8792
204 Ga0163162_10222776 3300013306 Bacteria 2016
205 Ga0157375_10118920 3300013308 Bacteria 2749
206 Ga0157375_10480743 3300013308 Bacteria 1407
207 Ga0157375_10907734 3300013308 Unclassified 1025
208 Ga0163163_10083660 3300014325 Bacteria 3196
209 Ga0157380_10262796 3300014326 Unclassified 1569
210 Ga0157380_10373151 3300014326 Unclassified 1343
211 Ga0157377_10282949 3300014745 Bacteria 1088
212 Ga0157379_10021551 3300014968 Bacteria 5706
213 Ga0157379_10068076 3300014968 Bacteria 3183
214 Ga0157379_10087227 3300014968 Bacteria 2798
215 Ga0157379_10160048 3300014968 Bacteria 2032
216 Ga0157379_10243405 3300014968 Bacteria 1632
217 Ga0157376_10027411 3300014969 Bacteria 4515
218 Ga0163161_10000029 3300017792 Bacteria 193416
219 Ga0163161_10389665 3300017792 Bacteria 1115
220 Ga0213874_10010879 3300021377 Bacteria 2290
221 Ga0213876_10000232 3300021384 Bacteria 54674
222 Ga0213876_10099717 3300021384 Bacteria 1540
223 Ga0207672_1001237 3300025223 Bacteria 2165
224 Ga0209455_1008365 3300025272 Bacteria 2818
225 Ga0209050_1000388 3300025298 Bacteria 82715
226 Ga0207656_10007552 3300025321 Bacteria 3965
227 Ga0207656_10015100 3300025321 Bacteria 2985
228 Ga0207682_10041994 3300025893 Bacteria 1868
229 Ga0207692_10046370 3300025898 Bacteria 2179
230 Ga0207642_10068100 3300025899 Bacteria 1683
231 Ga0207710_10005614 3300025900 Bacteria 5395
232 Ga0207680_10000010 3300025903 Bacteria 414170
233 Ga0207680_10413237 3300025903 Bacteria 955
234 Ga0207647_10000245 3300025904 Bacteria 44530
235 Ga0207647_10164129 3300025904 Bacteria 1295
236 Ga0207685_10013606 3300025905 Bacteria 2522
237 Ga0207699_10320310 3300025906 Bacteria 1087
238 Ga0207645_10004396 3300025907 Bacteria 10443
239 Ga0207645_10007195 3300025907 Bacteria 7888
240 Ga0207643_10010620 3300025908 Bacteria 4962
241 Ga0207705_10000296 3300025909 Bacteria 46440
242 Ga0207705_10319306 3300025909 Bacteria 1193
243 Ga0207654_10001450 3300025911 Bacteria 12581
244 Ga0207654_10002387 3300025911 Bacteria 9609
245 Ga0207695_10000003 3300025913 Bacteria 1368691
246 Ga0207695_10003917 3300025913 Bacteria 20595
247 Ga0207695_10004012 3300025913 Bacteria 20269
248 Ga0207695_10018859 3300025913 Bacteria 7961
249 Ga0207695_10034162 3300025913 Bacteria 5536
250 Ga0207695_10040246 3300025913 Bacteria 5015
251 Ga0207695_10041108 3300025913 Bacteria 4950
252 Ga0207695_10068949 3300025913 Bacteria 3621
253 Ga0207695_10171592 3300025913 Bacteria 2094
254 Ga0207695_10220211 3300025913 Bacteria 1805
255 Ga0207671_10000821 3300025914 Bacteria 39371
256 Ga0207671_10004347 3300025914 Bacteria 13597
257 Ga0207671_10005078 3300025914 Bacteria 12293
258 Ga0207671_10034845 3300025914 Bacteria 3739
259 Ga0207693_10006431 3300025915 Bacteria 9736
260 Ga0207693_10197064 3300025915 Unclassified 1584
261 Ga0207663_10002130 3300025916 Bacteria 9442
262 Ga0207663_10083871 3300025916 Bacteria 2095
263 Ga0207660_10137470 3300025917 Bacteria 1866
264 Ga0207657_10000583 3300025919 Bacteria 38816
265 Ga0207649_10000072 3300025920 Bacteria 87103
266 Ga0207649_10000508 3300025920 Bacteria 27425
267 Ga0207646_10106053 3300025922 Bacteria 2520
268 Ga0207681_10000102 3300025923 Bacteria 72602
269 Ga0207681_10006265 3300025923 Bacteria 7301
270 Ga0207681_10085653 3300025923 Bacteria 2237
271 Ga0207681_10130614 3300025923 Archaea 1857
272 Ga0207694_10000016 3300025924 Bacteria 349087
273 Ga0207694_10002356 3300025924 Bacteria 15452
274 Ga0207694_10024486 3300025924 Bacteria 4585
275 Ga0207694_10027129 3300025924 Bacteria 4361
276 Ga0207694_10095672 3300025924 Bacteria 2348
277 Ga0207694_10516064 3300025924 Bacteria 1001
278 Ga0207650_10000008 3300025925 Bacteria 498534
279 Ga0207650_10060361 3300025925 Bacteria 2830
280 Ga0207659_10027595 3300025926 Bacteria 3847
281 Ga0207659_10127366 3300025926 Bacteria 1960
282 Ga0207687_10018431 3300025927 Bacteria 4608
283 Ga0207687_10065453 3300025927 Bacteria 2581
284 Ga0207644_10000092 3300025931 Bacteria 64892
285 Ga0207644_10202017 3300025931 Bacteria 1568
286 Ga0207690_10000296 3300025932 Bacteria 35141
287 Ga0207706_10002119 3300025933 Bacteria 19433
288 Ga0207706_10002132 3300025933 Bacteria 19363
289 Ga0207706_10021514 3300025933 Bacteria 5791
290 Ga0207706_10217992 3300025933 Bacteria 1671
291 Ga0207709_10014623 3300025935 Bacteria 4337
292 Ga0207709_10052823 3300025935 Bacteria 2498
293 Ga0207669_10003651 3300025937 Bacteria 6679
294 Ga0207669_10237509 3300025937 Bacteria 1349
295 Ga0207669_10313145 3300025937 Bacteria 1198
296 Ga0207704_10015543 3300025938 Bacteria 3882
297 Ga0207665_10013054 3300025939 Bacteria 5459
298 Ga0207691_10003410 3300025940 Bacteria 15449
299 Ga0207691_10005982 3300025940 Bacteria 11748
300 Ga0207691_10210260 3300025940 Bacteria 1690
301 Ga0207691_10383335 3300025940 Bacteria 1200
302 Ga0207711_10000897 3300025941 Bacteria 28664
303 Ga0207711_10041645 3300025941 Bacteria 3911
304 Ga0207689_10012842 3300025942 Bacteria 7151
305 Ga0207661_10736330 3300025944 Bacteria 907
306 Ga0207667_10000021 3300025949 Bacteria 370524
307 Ga0207667_10000069 3300025949 Bacteria 180683
308 Ga0207667_10008418 3300025949 Bacteria 12260
309 Ga0207667_10044383 3300025949 Bacteria 4710
310 Ga0207667_10203241 3300025949 Bacteria 2032
311 Ga0207651_10014384 3300025960 Bacteria 4566
312 Ga0207712_10000014 3300025961 Bacteria 375393
313 Ga0207712_10000048 3300025961 Bacteria 160050
314 Ga0207668_10000055 3300025972 Bacteria 94786
315 Ga0207668_10011650 3300025972 Bacteria 5351
316 Ga0207668_10292374 3300025972 Unclassified 1341
317 Ga0207640_10001445 3300025981 Bacteria 12844
318 Ga0207640_10001651 3300025981 Bacteria 11967
319 Ga0207640_10046261 3300025981 Bacteria 2799
320 Ga0207640_10078161 3300025981 Bacteria 2251
321 Ga0207640_10161728 3300025981 Bacteria 1657
322 Ga0207640_10212486 3300025981 Bacteria 1475
323 Ga0207640_10231719 3300025981 Bacteria 1421
324 Ga0207658_10013719 3300025986 Bacteria 5541
325 Ga0207658_10018287 3300025986 Bacteria 4837
326 Ga0207658_10530395 3300025986 Bacteria 1051
327 Ga0207703_10002508 3300026035 Bacteria 15867
328 Ga0207703_10005798 3300026035 Bacteria 9895
329 Ga0207703_10017243 3300026035 Bacteria 5635
330 Ga0207639_10001060 3300026041 Bacteria 18669
331 Ga0207639_10042939 3300026041 Bacteria 3391
332 Ga0207639_10085039 3300026041 Bacteria 2515
333 Ga0207678_10000240 3300026067 Bacteria 49355
334 Ga0207702_10000269 3300026078 Bacteria 59707
335 Ga0207702_10000868 3300026078 Bacteria 31467
336 Ga0207702_10004349 3300026078 Bacteria 12632
337 Ga0207702_10439795 3300026078 Bacteria 1264
338 Ga0207641_10000116 3300026088 Bacteria 117850
339 Ga0207641_10005391 3300026088 Bacteria 10926
340 Ga0207648_10001606 3300026089 Bacteria 24755
341 Ga0207648_10007593 3300026089 Bacteria 10635
342 Ga0207648_10073581 3300026089 Bacteria 2978
343 Ga0207648_10502505 3300026089 Bacteria 1109
344 Ga0207676_10008262 3300026095 Bacteria 7403
345 Ga0207676_10070859 3300026095 Bacteria 2796
346 Ga0207676_10352383 3300026095 Bacteria 1361
347 Ga0207674_10001563 3300026116 Bacteria 29480
348 Ga0207674_10015001 3300026116 Bacteria 8536
349 Ga0207674_10034779 3300026116 Bacteria 5264
350 Ga0207674_10046373 3300026116 Bacteria 4462
351 Ga0207674_10115356 3300026116 Bacteria 2658
352 Ga0207674_10244804 3300026116 Bacteria 1740
353 Ga0207674_10271856 3300026116 Bacteria 1642
354 Ga0207675_100000097 3300026118 Bacteria 69812
355 Ga0207675_100000382 3300026118 Bacteria 42525
356 Ga0207675_100001154 3300026118 Bacteria 26234
357 Ga0207683_10562140 3300026121 Bacteria 1055
358 Ga0207698_10000062 3300026142 Bacteria 72806
359 Ga0207698_10000461 3300026142 Bacteria 23591
360 Ga0207698_10000594 3300026142 Bacteria 21138
361 Ga0207698_10011510 3300026142 Bacteria 5739
362 Ga0209281_1012173 3300027111 Bacteria 1899
363 Ga0209968_1005693 3300027526 Bacteria 1871
364 Ga0209970_1003899 3300027614 Bacteria 2494
365 Ga0210002_1000575 3300027617 Bacteria 4976
366 Ga0209983_1004982 3300027665 Bacteria 2772
367 Ga0209971_1001620 3300027682 Bacteria 5560
368 Ga0209966_1013897 3300027695 Bacteria 1497
369 Ga0209998_10000317 3300027717 Bacteria 14455
370 Ga0209974_10001822 3300027876 Bacteria 7770
371 Ga0207428_10201036 3300027907 Bacteria 1499
372 Ga0268266_10027437 3300028379 Bacteria 4841
373 Ga0268266_10110414 3300028379 Bacteria 2436
374 Ga0268265_10000139 3300028380 Bacteria 92561
375 Ga0268265_10000990 3300028380 Bacteria 25789
376 Ga0268265_10006620 3300028380 Bacteria 7844
377 Ga0268264_10000023 3300028381 Bacteria 471408
378 Ga0268264_10000585 3300028381 Bacteria 44270
379 Ga0268264_10002651 3300028381 Bacteria 15641
380 Ga0265338_10007089 3300028800 Bacteria 14046
381 Ga0265325_10003271 3300031241 Bacteria 10656
382 Ga0265339_10009768 3300031249 Bacteria 5998
383 Ga0265331_10000011 3300031250 Bacteria 308171
384 Ga0265316_10088791 3300031344 Bacteria 2360
385 Ga0307513_10004619 3300031456 Bacteria 18343
386 Ga0307513_10103263 3300031456 Bacteria 2867
387 Ga0307509_10000038 3300031507 Bacteria 188458
388 Ga0307408_100109357 3300031548 Bacteria 2120
389 Ga0307408_100226072 3300031548 Bacteria 1530
390 Ga0307508_10000398 3300031616 Bacteria 52452
391 Ga0265314_10007030 3300031711 Bacteria 9830
392 Ga0316576_10277347 3300031727 Unclassified 1256
393 Ga0307516_10000056 3300031730 Bacteria 122840
394 Ga0307405_10154795 3300031731 Bacteria 1616
395 Ga0316577_10310553 3300031733 Bacteria 894
396 Ga0307406_10392673 3300031901 Bacteria 1097
397 Ga0307412_10052157 3300031911 Bacteria 2707
398 Ga0307409_100107920 3300031995 Unclassified 2327
399 Ga0307416_100493638 3300032002 Bacteria 1287
400 Ga0307416_100542345 3300032002 Viruses 1235
401 Ga0307416_100958243 3300032002 Bacteria 958
402 Ga0307411_10162460 3300032005 Bacteria 1675
403 Ga0307415_100105417 3300032126 Unclassified 2079
404 Ga0307510_10045997 3300033180 Bacteria 4700
405 Ga0373932_0070118 3300035112 Bacteria 1085
406 Ga0373953_0065106 3300035117 Bacteria 1496
407 Ga0373935_0078319 3300035692 Bacteria 2144
408 Ga0373927_0031859 3300035695 Bacteria 3434
409 Ga0373927_0157067 3300035695 Bacteria 1490
410 Ga0373947_0081786 3300035725 Bacteria 2001
411 Ga0373937_0103495 3300036401 Bacteria 2644
412 Ga0316584_0220219 3300036712 Bacteria 1395
413 Ga0395900_0510827 3300037418 Bacteria 1151
414 Ga0395901_0048779 3300038443 Bacteria 4398
415 Ga0436365_0167364 3300039437 Bacteria 29700
416 Ga0436365_0251199 3300039437 Bacteria 3643
417 Ga0436360_0755413 3300039438 Bacteria 902
418 Ga0436363_0930417 3300039450 Bacteria 993
419 Ga0436363_1394234 3300039450 Bacteria 2504
420 Ga0451853_3917748 3300041512 Bacteria 2620
421 Ga0439431_0028103 3300041997 Bacteria 1384
422 Ga0439443_008773 3300042003 Bacteria 1435
423 Ga0439462_0073355 3300042015 Bacteria 930
424 Ga0439446_0017072 3300042156 Bacteria 2026
425 Ga0439435_0015068 3300042436 Bacteria 1919
426 Ga0451577_0002093 3300042876 Bacteria 24560
427 Ga0451577_0004914 3300042876 Bacteria 13921
428 Ga0451577_0010487 3300042876 Bacteria 8849
429 Ga0451577_0020834 3300042876 Bacteria 6010
430 Ga0451577_0079101 3300042876 Bacteria 2931
431 Ga0451577_0182713 3300042876 Bacteria 1891
432 Ga0466969_0204183 3300044656 Bacteria 901
433 Ga0453683_0007037 3300044673 Bacteria 7663
434 Ga0466965_0012178 3300044683 Bacteria 4042
435 Ga0466966_0022908 3300044684 Bacteria 4092
436 Ga0453684_0017528 3300044712 Bacteria 11084
437 Ga0453684_0018551 3300044712 Bacteria 10667
438 Ga0466971_0039989 3300044719 Bacteria 2106
439 Ga0466970_0194140 3300044765 Bacteria 1129
440 Ga0466959_0343350 3300045049 Bacteria 1018
441 Ga0451576_0016357 3300045051 Bacteria 8190
442 Ga0451576_0073907 3300045051 Bacteria 3548
443 Ga0495638_0000016 3300046460 Bacteria 396505
444 Ga0495638_0021582 3300046460 Bacteria 4241
445 Ga0495650_0001079 3300046471 Bacteria 30023
446 Ga0495650_0002275 3300046471 Bacteria 15983
447 Ga0495582_0132806 3300046473 Bacteria 1407
448 Ga0495585_0001077 3300046492 Bacteria 22514
449 Ga0495585_0025691 3300046492 Bacteria 3370
450 Ga0495596_0000739 3300046500 Bacteria 20158
451 Ga0495596_0001271 3300046500 Bacteria 14614
452 Ga0495607_0034109 3300046501 Bacteria 3090
453 Ga0495583_0000094 3300046506 Bacteria 153549
454 Ga0495606_0033860 3300046507 Bacteria 3517
455 Ga0495606_0050119 3300046507 Bacteria 2733
456 Ga0495610_0000170 3300046512 Bacteria 72711
457 Ga0495610_0006606 3300046512 Bacteria 7925
458 Ga0495610_0174021 3300046512 Bacteria 900
459 Ga0495616_0000040 3300046513 Bacteria 122596
460 Ga0495616_0071585 3300046513 Bacteria 1676
461 Ga0495620_0122269 3300046515 Bacteria 1025
462 Ga0495630_0094405 3300046517 Bacteria 2261
463 Ga0495632_0000001 3300046519 Bacteria 873295
464 Ga0495632_0000440 3300046519 Bacteria 39608
465 Ga0495632_0048293 3300046519 Bacteria 2108
466 Ga0495632_0123441 3300046519 Bacteria 1209
467 Ga0495643_0000039 3300046522 Bacteria 235175
468 Ga0495648_0000013 3300046524 Bacteria 289090
469 Ga0495663_0000001 3300046525 Bacteria 595264
470 Ga0495609_0011981 3300046538 Bacteria 4117
471 Ga0495645_0045057 3300046543 Bacteria 3218
472 Ga0495633_0000122 3300046558 Bacteria 104795
473 Ga0495633_0172024 3300046558 Bacteria 998
474 Ga0495656_0015123 3300046615 Bacteria 2907
475 Ga0495668_0007648 3300046616 Bacteria 6876
476 Ga0495668_0153074 3300046616 Bacteria 1263
477 Ga0495625_0000093 3300046660 Bacteria 145874
478 Ga0495625_0018414 3300046660 Bacteria 5455
479 Ga0495625_0164070 3300046660 Bacteria 1487
480 Ga0495625_0343845 3300046660 Bacteria 944
481 Ga0495670_0017088 3300046691 Bacteria 3568
482 Ga0495671_0000018 3300046692 Bacteria 291470
483 Ga0495671_0007195 3300046692 Bacteria 6364
484 Ga0495671_0010519 3300046692 Bacteria 5122
485 Ga0495671_0071022 3300046692 Bacteria 1710
486 Ga0495671_0182787 3300046692 Bacteria 1018
487 Ga0495683_0189479 3300047323 Bacteria 934
488 Ga0495673_0000435 3300047469 Bacteria 46845
489 Ga0495673_0030476 3300047469 Bacteria 2532
490 Ga0495686_0000060 3300047472 Bacteria 237402
491 Ga0495686_0000105 3300047472 Bacteria 176098
492 Ga0495686_0007537 3300047472 Bacteria 8147
493 Ga0495615_0000003 3300048090 Bacteria 127902
494 Ga0495615_0113629 3300048090 Bacteria 777
495 Ga0495626_0000848 3300048091 Bacteria 27322
496 Ga0495626_0071284 3300048091 Bacteria 1562
497 Ga0496100_0019932 3300048903 Bacteria 4012
498 Ga0496100_0067577 3300048903 Bacteria 2374
499 Ga0496101_0009991 3300048904 Bacteria 6253
500 Ga0496101_0023087 3300048904 Bacteria 4292
501 Ga0496101_0027039 3300048904 Bacteria 3991
502 Ga0496102_0014133 3300048905 Bacteria 6935
503 Ga0496102_0024845 3300048905 Bacteria 5329
504 Ga0496102_0148715 3300048905 Bacteria 2199
505 Ga0496102_0200637 3300048905 Bacteria 1880
506 Ga0496102_0219424 3300048905 Bacteria 1792
507 Ga0496103_0001726 3300048906 Bacteria 14274
508 Ga0496103_0068962 3300048906 Bacteria 2210
509 Ga0496103_0178993 3300048906 Bacteria 1363
510 Ga0496103_0211282 3300048906 Bacteria 1248
511 Ga0496103_0427110 3300048906 Bacteria 850
512 Ga0496104_0008239 3300048907 Bacteria 9256
513 Ga0496104_0033850 3300048907 Bacteria 4762
514 Ga0496105_0007367 3300048908 Bacteria 8514
515 Ga0496105_0056008 3300048908 Bacteria 3255
516 Ga0496105_0434005 3300048908 Bacteria 1039
517 Ga0496106_0057148 3300048909 Bacteria 2950
518 Ga0496106_0369486 3300048909 Bacteria 1152
519 Ga0496107_0058785 3300048910 Bacteria 2781
520 Ga0496107_0092497 3300048910 Bacteria 2211
521 Ga0496107_0099286 3300048910 Bacteria 2133
522 Ga0496109_0066019 3300048912 Bacteria 3312
523 Ga0496109_0170080 3300048912 Bacteria 2044
524 Ga0496110_0038384 3300048913 Bacteria 4167
525 Ga0496111_0008635 3300048914 Bacteria 6756
526 Ga0496111_0176057 3300048914 Bacteria 1590
527 Ga0496112_0176395 3300048915 Bacteria 2102
528 Ga0496113_0121363 3300048916 Bacteria 2044
529 Ga0496114_0007012 3300048917 Bacteria 8887
530 Ga0496114_0020727 3300048917 Bacteria 5336
531 Ga0496114_0332059 3300048917 Bacteria 1344
532 Ga0496115_0004400 3300048918 Bacteria 10200
533 Ga0496115_0457285 3300048918 Bacteria 1030
534 Ga0496116_0000361 3300048919 Bacteria 70406
535 Ga0496117_0004450 3300048920 Bacteria 15454
536 Ga0496118_0011348 3300048921 Bacteria 8709
537 Ga0496118_0032345 3300048921 Bacteria 4312
538 Ga0496118_0054826 3300048921 Bacteria 3015
539 Ga0496119_0008483 3300048922 Bacteria 9018
540 Ga0496119_0168493 3300048922 Bacteria 1159
541 Ga0496120_0030592 3300048923 Bacteria 3269
542 Ga0496120_0149870 3300048923 Bacteria 1174
543 Ga0496121_0000069 3300048924 Bacteria 253087
544 Ga0496121_0000107 3300048924 Bacteria 188964
545 Ga0496121_0004442 3300048924 Bacteria 18859
546 Ga0496121_0006381 3300048924 Bacteria 14683
547 Ga0496121_0010983 3300048924 Bacteria 10110
548 Ga0496122_0002822 3300048925 Bacteria 23815
549 Ga0496122_0006933 3300048925 Bacteria 12786
550 Ga0496123_0001093 3300048926 Bacteria 40748
551 Ga0496123_0003427 3300048926 Bacteria 17814
552 Ga0496124_0006793 3300048927 Bacteria 12355
553 Ga0496124_0046394 3300048927 Bacteria 3720
554 Ga0496124_0353133 3300048927 Bacteria 1039
555 Ga0496125_0028843 3300048928 Bacteria 5000
556 Ga0496126_0000136 3300048929 Bacteria 167497
557 Ga0496126_0002035 3300048929 Bacteria 28481
558 Ga0496126_0002293 3300048929 Bacteria 26371
559 Ga0496126_0008156 3300048929 Bacteria 11337
560 Ga0496126_0347269 3300048929 Bacteria 1214
561 Ga0496126_0477753 3300048929 Bacteria 999
562 Ga0501292_000004 3300049515 Bacteria 159565
563 Ga0501294_000150 3300049517 Bacteria 8274
564 Ga0501301_003525 3300049524 Bacteria 1079
565 Ga0501034_0711822 3300049571 Bacteria 902
566 Ga0501037_0109672 3300049573 Bacteria 1989
567 Ga0501202_007786 3300049652 Bacteria 1942
568 Ga0501206_002373 3300049653 Bacteria 2372
569 Ga0501222_009140 3300049662 Bacteria 1311
570 Ga0501223_001885 3300049663 Bacteria 4727
571 Ga0501224_005774 3300049664 Bacteria 1783
572 Ga0501227_005723 3300049665 Bacteria 2664
573 Ga0501233_005913 3300049668 Bacteria 2281
574 Ga0501257_000013 3300049686 Bacteria 50789
575 Ga0501261_000010 3300049690 Bacteria 49364
576 Ga0501221_024335 3300049704 Bacteria 1215
577 Ga0501245_000129 3300049708 Bacteria 7785
578 Ga0501279_000005 3300049775 Bacteria 153858
579 Ga0501280_000277 3300049776 Bacteria 13061
580 Ga0501281_00015 3300049777 Bacteria 23738
581 Ga0501282_000134 3300049778 Bacteria 8758
582 Ga0501283_001837 3300049779 Bacteria 2751
583 Ga0501044_0000705 3300049823 Bacteria 40355
584 Ga0501044_0001340 3300049823 Bacteria 28928
585 nmdc:mga0k408_31771_c2 3300050493 Bacteria 1861
586 nmdc:mga0k408_83733_c1 3300050493 Bacteria 1870
587 nmdc:mga07m45_136485_c1 3300050496 Bacteria 1420
588 nmdc:mga05p37_538442_c1 3300050507 Bacteria 1332
589 nmdc:mga09592_172593_c1 3300050508 Bacteria 1870
590 nmdc:mga0qj67_89527_c1 3300050509 Bacteria 2472
591 nmdc:mga06r32_187956_c1 3300050510 Bacteria 2053
592 nmdc:mga06r32_19791_c1 3300050510 Bacteria 6186
593 Ga0500643_004375 3300053087 Bacteria 6414
594 Ga0500643_091449 3300053087 Bacteria 829
595 Ga0500583_0008746 3300053092 Bacteria 3657
596 Ga0500583_0011157 3300053092 Bacteria 3374
597 Ga0500641_0195073 3300053096 Unclassified 866
598 Ga0500594_0002262 3300053118 Bacteria 4171
599 Ga0500618_001102 3300053125 Bacteria 13251
600 Ga0500604_0005509 3300053151 Bacteria 3343
601 Ga0500627_0000305 3300053158 Bacteria 13629
602 Ga0500625_068820 3300053729 Bacteria 1581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0174021 Ga0495610_0174021_56_724 220
2 3300046660 Ga0495625_0164070 Ga0495625_0164070_19_711 226
3 3300046692 Ga0495671_0182787 Ga0495671_0182787_39_731 226
4 3300025949 Ga0207667_10044383 Ga0207667_100443836 229
5 3300048090 Ga0495615_0113629 Ga0495615_0113629_44_757 229
6 3300048913 Ga0496110_0038384 Ga0496110_0038384_582_1292 229
7 3300005329 Ga0070683_100186020 Ga0070683_1001860202 232
8 3300005434 Ga0070709_10376230 Ga0070709_103762302 238
9 3300006163 Ga0070715_10005084 Ga0070715_100050842 238
10 3300009098 Ga0105245_10143493 Ga0105245_101434932 238
11 3300010375 Ga0105239_10106433 Ga0105239_101064332 238
12 3300025905 Ga0207685_10013606 Ga0207685_100136061 238
13 3300025906 Ga0207699_10320310 Ga0207699_103203102 238
14 3300048903 Ga0496100_0067577 Ga0496100_0067577_1512_2249 238
15 3300048904 Ga0496101_0027039 Ga0496101_0027039_1010_1747 238
16 3300048905 Ga0496102_0024845 Ga0496102_0024845_4166_4903 238
17 3300048905 Ga0496102_0219424 Ga0496102_0219424_116_853 238
18 3300048906 Ga0496103_0068962 Ga0496103_0068962_22_759 238
19 3300048906 Ga0496103_0211282 Ga0496103_0211282_433_1170 238
20 3300048907 Ga0496104_0033850 Ga0496104_0033850_3629_4366 238
21 3300048908 Ga0496105_0056008 Ga0496105_0056008_328_1065 238
22 3300048909 Ga0496106_0057148 Ga0496106_0057148_2042_2779 238
23 3300048910 Ga0496107_0092497 Ga0496107_0092497_1169_1906 238
24 3300048912 Ga0496109_0066019 Ga0496109_0066019_181_918 238
25 3300048912 Ga0496109_0170080 Ga0496109_0170080_200_937 238
26 3300048914 Ga0496111_0176057 Ga0496111_0176057_543_1280 238
27 3300048917 Ga0496114_0332059 Ga0496114_0332059_325_1062 238
28 3300048918 Ga0496115_0457285 Ga0496115_0457285_145_882 238
29 3300013105 Ga0157369_10028283 Ga0157369_100282835 239
30 3300014968 Ga0157379_10160048 Ga0157379_101600482 242
31 3300037418 Ga0395900_0510827 Ga0395900_0510827_230_1051 242
32 3300048906 Ga0496103_0427110 Ga0496103_0427110_52_783 242
33 3300009551 Ga0105238_10016052 Ga0105238_100160522 244
34 iso_pu_bacteria 2919709256 2919713232 244
35 3300048924 Ga0496121_0010983 Ga0496121_0010983_4092_4877 246
36 3300005578 Ga0068854_100235972 Ga0068854_1002359722 249
37 3300025981 Ga0207640_10212486 Ga0207640_102124862 249
38 3300009174 Ga0105241_10001892 Ga0105241_100018929 250
39 3300009551 Ga0105238_10041604 Ga0105238_100416042 250
40 3300013102 Ga0157371_10000043 Ga0157371_1000004353 250
41 3300013105 Ga0157369_10017858 Ga0157369_100178585 250
42 3300005434 Ga0070709_10373977 Ga0070709_103739772 251
43 3300001979 JGI24740J21852_10000098 JGI24740J21852_1000009819 253
44 3300005330 Ga0070690_100040550 Ga0070690_1000405502 253
45 3300005335 Ga0070666_10004720 Ga0070666_100047206 253
46 3300005338 Ga0068868_100052835 Ga0068868_1000528352 253
47 3300005344 Ga0070661_100000720 Ga0070661_1000007205 253
48 3300005355 Ga0070671_100006317 Ga0070671_1000063176 253
49 3300005435 Ga0070714_100094079 Ga0070714_1000940792 253
50 3300005436 Ga0070713_100001372 Ga0070713_10000137211 253
51 3300005459 Ga0068867_100170745 Ga0068867_1001707452 253
52 3300005468 Ga0070707_100146208 Ga0070707_1001462083 253
53 3300005548 Ga0070665_100083473 Ga0070665_1000834733 253
54 3300005564 Ga0070664_100007227 Ga0070664_1000072273 253
55 3300005718 Ga0068866_10007171 Ga0068866_100071716 253
56 3300005834 Ga0068851_10001398 Ga0068851_100013986 253
57 3300005841 Ga0068863_100084685 Ga0068863_1000846853 253
58 3300005842 Ga0068858_100015863 Ga0068858_1000158638 253
59 3300005843 Ga0068860_100122570 Ga0068860_1001225702 253
60 3300006175 Ga0070712_100004762 Ga0070712_1000047628 253
61 3300006237 Ga0097621_100003423 Ga0097621_1000034239 253
62 3300006358 Ga0068871_100222333 Ga0068871_1002223332 253
63 3300006881 Ga0068865_100029140 Ga0068865_1000291404 253
64 3300009098 Ga0105245_10107701 Ga0105245_101077013 253
65 3300009176 Ga0105242_10005332 Ga0105242_100053329 253
66 3300009177 Ga0105248_10030381 Ga0105248_100303811 253
67 3300013296 Ga0157374_10093323 Ga0157374_100933233 253
68 3300013297 Ga0157378_10116528 Ga0157378_101165281 253
69 3300013306 Ga0163162_10011059 Ga0163162_100110597 253
70 3300013308 Ga0157375_10118920 Ga0157375_101189202 253
71 3300014968 Ga0157379_10243405 Ga0157379_102434052 253
72 3300014969 Ga0157376_10027411 Ga0157376_100274113 253
73 3300025898 Ga0207692_10046370 Ga0207692_100463704 253
74 3300025904 Ga0207647_10164129 Ga0207647_101641291 253
75 3300025915 Ga0207693_10006431 Ga0207693_100064315 253
76 3300025916 Ga0207663_10083871 Ga0207663_100838711 253
77 3300025920 Ga0207649_10000508 Ga0207649_1000050821 253
78 3300025927 Ga0207687_10065453 Ga0207687_100654531 253
79 3300025938 Ga0207704_10015543 Ga0207704_100155435 253
80 3300025939 Ga0207665_10013054 Ga0207665_100130544 253
81 3300025949 Ga0207667_10000069 Ga0207667_10000069113 253
82 3300025986 Ga0207658_10530395 Ga0207658_105303951 253
83 3300026041 Ga0207639_10001060 Ga0207639_1000106013 253
84 3300026067 Ga0207678_10000240 Ga0207678_100002408 253
85 3300026078 Ga0207702_10439795 Ga0207702_104397951 253
86 3300026142 Ga0207698_10000461 Ga0207698_1000046113 253
87 3300028379 Ga0268266_10110414 Ga0268266_101104142 253
88 3300035117 Ga0373953_0065106 Ga0373953_0065106_54_881 253
89 3300035692 Ga0373935_0078319 Ga0373935_0078319_1186_2013 253
90 3300035695 Ga0373927_0031859 Ga0373927_0031859_201_1028 253
91 3300035725 Ga0373947_0081786 Ga0373947_0081786_661_1488 253
92 3300036401 Ga0373937_0103495 Ga0373937_0103495_824_1651 253
93 3300046473 Ga0495582_0132806 Ga0495582_0132806_75_902 253
94 3300046517 Ga0495630_0094405 Ga0495630_0094405_420_1247 253
95 3300048903 Ga0496100_0019932 Ga0496100_0019932_2452_3279 253
96 3300048904 Ga0496101_0009991 Ga0496101_0009991_4964_5791 253
97 3300048905 Ga0496102_0200637 Ga0496102_0200637_667_1494 253
98 3300048906 Ga0496103_0178993 Ga0496103_0178993_233_1060 253
99 3300048909 Ga0496106_0369486 Ga0496106_0369486_35_862 253
100 3300048910 Ga0496107_0099286 Ga0496107_0099286_387_1214 253
101 3300048914 Ga0496111_0008635 Ga0496111_0008635_3835_4662 253
102 3300048915 Ga0496112_0176395 Ga0496112_0176395_1232_2059 253
103 3300048916 Ga0496113_0121363 Ga0496113_0121363_243_1070 253
104 3300048917 Ga0496114_0007012 Ga0496114_0007012_2659_3486 253
105 3300001915 JGI24741J21665_1000031 JGI24741J21665_100003111 254
106 3300001990 JGI24737J22298_10000085 JGI24737J22298_100000852 254
107 3300005339 Ga0070660_100000403 Ga0070660_1000004039 254
108 3300005366 Ga0070659_100001027 Ga0070659_1000010279 254
109 3300025321 Ga0207656_10015100 Ga0207656_100151003 254
110 3300025911 Ga0207654_10002387 Ga0207654_100023871 254
111 3300025919 Ga0207657_10000583 Ga0207657_1000058317 254
112 3300025924 Ga0207694_10027129 Ga0207694_100271292 254
113 3300025932 Ga0207690_10000296 Ga0207690_1000029613 254
114 3300025981 Ga0207640_10001651 Ga0207640_100016516 254
115 3300026078 Ga0207702_10000868 Ga0207702_100008685 254
116 3300026116 Ga0207674_10001563 Ga0207674_1000156314 254
117 3300012513 Ga0157326_1000087 Ga0157326_10000879 257
118 iso_pu_bacteria 2515154122 2515681223 257
119 iso_pu_bacteria 2738541275 2738708810 257
120 iso_pu_bacteria 2738541301 2738847235 257
121 iso_pu_bacteria 2738541304 2738862964 257
122 iso_pu_bacteria 2738543022 2739295482 257
123 iso_pu_bacteria 2738543033 2739357160 257
124 iso_pu_bacteria 2928100450 2928102436 257
125 iso_pu_bacteria 2928959182 2928961061 257
126 3300036712 Ga0316584_0220219 Ga0316584_0220219_15_803 258
127 3300005293 Ga0065715_10026849 Ga0065715_100268492 259
128 3300005578 Ga0068854_100343225 Ga0068854_1003432252 259
129 3300005617 Ga0068859_100179337 Ga0068859_1001793373 259
130 3300005719 Ga0068861_100000143 Ga0068861_1000001432 259
131 3300006931 Ga0097620_100179321 Ga0097620_1001793213 259
132 3300009093 Ga0105240_10018370 Ga0105240_100183703 259
133 3300009148 Ga0105243_10142293 Ga0105243_101422932 259
134 3300009177 Ga0105248_10000165 Ga0105248_1000016543 259
135 3300013308 Ga0157375_10907734 Ga0157375_109077341 259
136 3300014326 Ga0157380_10262796 Ga0157380_102627962 259
137 3300014968 Ga0157379_10087227 Ga0157379_100872273 259
138 3300025923 Ga0207681_10130614 Ga0207681_101306142 259
139 3300025926 Ga0207659_10127366 Ga0207659_101273662 259
140 3300025935 Ga0207709_10052823 Ga0207709_100528232 259
141 3300025940 Ga0207691_10383335 Ga0207691_103833352 259
142 3300025941 Ga0207711_10000897 Ga0207711_1000089715 259
143 3300026089 Ga0207648_10502505 Ga0207648_105025052 259
144 3300026118 Ga0207675_100000097 Ga0207675_10000009734 259
145 3300047472 Ga0495686_0000105 Ga0495686_0000105_74621_75442 259
146 3300048922 Ga0496119_0008483 Ga0496119_0008483_4947_5768 259
147 3300048923 Ga0496120_0149870 Ga0496120_0149870_54_875 259
148 iso_pu_bacteria 2510917021 2511130349 259
149 iso_pu_bacteria 2513237082 2513557198 259
150 iso_pu_bacteria 2643221541 2643728246 259
151 iso_pu_bacteria 2643221605 2644036540 259
152 iso_pu_bacteria 2643221606 2644042805 259
153 iso_pu_bacteria 2643221671 2644395764 259
154 iso_pu_bacteria 2818991438 2819553260 259
155 iso_pu_bacteria 2919138771 2919140307 259
156 iso_pu_bacteria 2919709256 2919711664 259
157 iso_pu_bacteria 8054302542 8054304572 259
158 3300005327 Ga0070658_10291477 Ga0070658_102914771 260
159 3300009093 Ga0105240_10003918 Ga0105240_1000391816 260
160 3300009093 Ga0105240_10047493 Ga0105240_100474934 260
161 3300010375 Ga0105239_10000024 Ga0105239_1000002478 260
162 3300010375 Ga0105239_10000031 Ga0105239_10000031160 260
163 3300013104 Ga0157370_10706845 Ga0157370_107068451 260
164 3300021377 Ga0213874_10010879 Ga0213874_100108791 260
165 3300021384 Ga0213876_10000232 Ga0213876_1000023246 260
166 3300025913 Ga0207695_10004012 Ga0207695_1000401216 260
167 3300025913 Ga0207695_10034162 Ga0207695_100341626 260
168 3300031733 Ga0316577_10310553 Ga0316577_103105531 260
169 3300039437 Ga0436365_0167364 Ga0436365_0167364_18621_19421 260
170 3300039438 Ga0436360_0755413 Ga0436360_0755413_17_814 260
171 3300039450 Ga0436363_1394234 Ga0436363_1394234_106_906 260
172 3300042015 Ga0439462_0073355 Ga0439462_0073355_42_827 260
173 3300042156 Ga0439446_0017072 Ga0439446_0017072_237_1040 260
174 3300046471 Ga0495650_0002275 Ga0495650_0002275_8908_9690 260
175 3300046692 Ga0495671_0010519 Ga0495671_0010519_889_1713 260
176 3300048921 Ga0496118_0032345 Ga0496118_0032345_1752_2537 260
177 3300048924 Ga0496121_0000107 Ga0496121_0000107_185244_186029 260
178 3300048929 Ga0496126_0002293 Ga0496126_0002293_22720_23505 260
179 3300001904 JGI24736J21556_1000085 JGI24736J21556_10000851 261
180 3300001904 JGI24736J21556_1019188 JGI24736J21556_10191882 261
181 3300001915 JGI24741J21665_1010126 JGI24741J21665_10101261 261
182 3300001976 JGI24752J21851_1000158 JGI24752J21851_10001582 261
183 3300001989 JGI24739J22299_10029189 JGI24739J22299_100291892 261
184 3300002070 JGI24750J21931_1003840 JGI24750J21931_10038402 261
185 3300002074 JGI24748J21848_1000086 JGI24748J21848_10000865 261
186 3300002239 JGI24034J26672_10000008 JGI24034J26672_10000008125 261
187 3300002244 JGI24742J22300_10001489 JGI24742J22300_100014892 261
188 3300005327 Ga0070658_10016771 Ga0070658_100167714 261
189 3300005327 Ga0070658_10059168 Ga0070658_100591685 261
190 3300005328 Ga0070676_10000512 Ga0070676_1000051216 261
191 3300005330 Ga0070690_100000006 Ga0070690_10000000618 261
192 3300005331 Ga0070670_100088333 Ga0070670_1000883333 261
193 3300005334 Ga0068869_100003432 Ga0068869_1000034327 261
194 3300005335 Ga0070666_10000004 Ga0070666_10000004163 261
195 3300005339 Ga0070660_100103557 Ga0070660_1001035571 261
196 3300005340 Ga0070689_100360482 Ga0070689_1003604822 261
197 3300005344 Ga0070661_100000046 Ga0070661_10000004661 261
198 3300005353 Ga0070669_100000116 Ga0070669_10000011620 261
199 3300005354 Ga0070675_100007411 Ga0070675_1000074116 261
200 3300005355 Ga0070671_100006590 Ga0070671_1000065903 261
201 3300005355 Ga0070671_100117104 Ga0070671_1001171042 261
202 3300005355 Ga0070671_100333157 Ga0070671_1003331572 261
203 3300005356 Ga0070674_100371928 Ga0070674_1003719282 261
204 3300005364 Ga0070673_100006452 Ga0070673_1000064529 261
205 3300005366 Ga0070659_100071295 Ga0070659_1000712952 261
206 3300005367 Ga0070667_100010853 Ga0070667_1000108532 261
207 3300005367 Ga0070667_100092462 Ga0070667_1000924623 261
208 3300005456 Ga0070678_100530970 Ga0070678_1005309701 261
209 3300005457 Ga0070662_100425994 Ga0070662_1004259941 261
210 3300005459 Ga0068867_100004028 Ga0068867_1000040288 261
211 3300005539 Ga0068853_100680318 Ga0068853_1006803181 261
212 3300005543 Ga0070672_100024584 Ga0070672_1000245844 261
213 3300005544 Ga0070686_100000012 Ga0070686_10000001261 261
214 3300005563 Ga0068855_100000336 Ga0068855_10000033640 261
215 3300005564 Ga0070664_100142237 Ga0070664_1001422372 261
216 3300005564 Ga0070664_100171531 Ga0070664_1001715312 261
217 3300005577 Ga0068857_100079703 Ga0068857_1000797032 261
218 3300005578 Ga0068854_100075851 Ga0068854_1000758513 261
219 3300005578 Ga0068854_100088908 Ga0068854_1000889082 261
220 3300005578 Ga0068854_100100254 Ga0068854_1001002542 261
221 3300005578 Ga0068854_100149935 Ga0068854_1001499352 261
222 3300005614 Ga0068856_100460507 Ga0068856_1004605071 261
223 3300005616 Ga0068852_100004277 Ga0068852_1000042772 261
224 3300005616 Ga0068852_100631314 Ga0068852_1006313142 261
225 3300005617 Ga0068859_100024733 Ga0068859_1000247332 261
226 3300005834 Ga0068851_10006671 Ga0068851_100066714 261
227 3300005841 Ga0068863_100000013 Ga0068863_10000001386 261
228 3300005842 Ga0068858_100000246 Ga0068858_1000002462 261
229 3300005842 Ga0068858_100001693 Ga0068858_10000169315 261
230 3300005843 Ga0068860_100000009 Ga0068860_100000009163 261
231 3300005844 Ga0068862_100000315 Ga0068862_1000003151 261
232 3300006237 Ga0097621_100657296 Ga0097621_1006572962 261
233 3300006358 Ga0068871_100283751 Ga0068871_1002837512 261
234 3300006358 Ga0068871_100449569 Ga0068871_1004495691 261
235 3300006931 Ga0097620_100024733 Ga0097620_1000247334 261
236 3300009093 Ga0105240_10001073 Ga0105240_1000107336 261
237 3300009093 Ga0105240_10021136 Ga0105240_100211367 261
238 3300009093 Ga0105240_10091059 Ga0105240_100910592 261
239 3300009098 Ga0105245_10025979 Ga0105245_100259797 261
240 3300009174 Ga0105241_10228079 Ga0105241_102280792 261
241 3300009545 Ga0105237_10003132 Ga0105237_100031323 261
242 3300009545 Ga0105237_10007137 Ga0105237_100071378 261
243 3300009551 Ga0105238_10000659 Ga0105238_1000065928 261
244 3300009551 Ga0105238_10356892 Ga0105238_103568922 261
245 3300009551 Ga0105238_10400474 Ga0105238_104004742 261
246 3300009551 Ga0105238_10440416 Ga0105238_104404161 261
247 3300009553 Ga0105249_10000006 Ga0105249_10000006202 261
248 3300010375 Ga0105239_10000031 Ga0105239_1000003155 261
249 3300010375 Ga0105239_10215029 Ga0105239_102150292 261
250 3300010375 Ga0105239_10488590 Ga0105239_104885902 261
251 3300010375 Ga0105239_10815416 Ga0105239_108154161 261
252 3300013100 Ga0157373_10130261 Ga0157373_101302612 261
253 3300013102 Ga0157371_10149709 Ga0157371_101497092 261
254 3300013104 Ga0157370_10101798 Ga0157370_101017981 261
255 3300013105 Ga0157369_10019079 Ga0157369_100190792 261
256 3300014325 Ga0163163_10083660 Ga0163163_100836604 261
257 3300014745 Ga0157377_10282949 Ga0157377_102829492 261
258 3300014968 Ga0157379_10021551 Ga0157379_100215511 261
259 3300017792 Ga0163161_10000029 Ga0163161_1000002924 261
260 3300025223 Ga0207672_1001237 Ga0207672_10012372 261
261 3300025321 Ga0207656_10007552 Ga0207656_100075523 261
262 3300025903 Ga0207680_10000010 Ga0207680_10000010244 261
263 3300025904 Ga0207647_10000245 Ga0207647_1000024534 261
264 3300025907 Ga0207645_10004396 Ga0207645_100043969 261
265 3300025909 Ga0207705_10319306 Ga0207705_103193061 261
266 3300025911 Ga0207654_10001450 Ga0207654_100014502 261
267 3300025913 Ga0207695_10000003 Ga0207695_10000003334 261
268 3300025913 Ga0207695_10018859 Ga0207695_100188593 261
269 3300025913 Ga0207695_10041108 Ga0207695_100411084 261
270 3300025913 Ga0207695_10068949 Ga0207695_100689493 261
271 3300025913 Ga0207695_10171592 Ga0207695_101715922 261
272 3300025913 Ga0207695_10220211 Ga0207695_102202112 261
273 3300025914 Ga0207671_10000821 Ga0207671_1000082118 261
274 3300025914 Ga0207671_10004347 Ga0207671_1000434710 261
275 3300025914 Ga0207671_10005078 Ga0207671_100050786 261
276 3300025920 Ga0207649_10000072 Ga0207649_1000007227 261
277 3300025923 Ga0207681_10000102 Ga0207681_1000010220 261
278 3300025924 Ga0207694_10000016 Ga0207694_10000016304 261
279 3300025924 Ga0207694_10002356 Ga0207694_100023565 261
280 3300025924 Ga0207694_10516064 Ga0207694_105160641 261
281 3300025925 Ga0207650_10060361 Ga0207650_100603613 261
282 3300025926 Ga0207659_10027595 Ga0207659_100275954 261
283 3300025927 Ga0207687_10018431 Ga0207687_100184313 261
284 3300025931 Ga0207644_10000092 Ga0207644_1000009251 261
285 3300025931 Ga0207644_10202017 Ga0207644_102020172 261
286 3300025933 Ga0207706_10021514 Ga0207706_100215142 261
287 3300025933 Ga0207706_10217992 Ga0207706_102179922 261
288 3300025935 Ga0207709_10014623 Ga0207709_100146232 261
289 3300025937 Ga0207669_10313145 Ga0207669_103131451 261
290 3300025940 Ga0207691_10003410 Ga0207691_100034105 261
291 3300025941 Ga0207711_10041645 Ga0207711_100416452 261
292 3300025942 Ga0207689_10012842 Ga0207689_100128424 261
293 3300025944 Ga0207661_10736330 Ga0207661_107363301 261
294 3300025949 Ga0207667_10000021 Ga0207667_1000002143 261
295 3300025949 Ga0207667_10008418 Ga0207667_100084185 261
296 3300025960 Ga0207651_10014384 Ga0207651_100143842 261
297 3300025961 Ga0207712_10000014 Ga0207712_10000014163 261
298 3300025981 Ga0207640_10046261 Ga0207640_100462612 261
299 3300025981 Ga0207640_10078161 Ga0207640_100781611 261
300 3300025981 Ga0207640_10231719 Ga0207640_102317192 261
301 3300025986 Ga0207658_10018287 Ga0207658_100182873 261
302 3300026035 Ga0207703_10002508 Ga0207703_100025082 261
303 3300026035 Ga0207703_10005798 Ga0207703_100057982 261
304 3300026041 Ga0207639_10042939 Ga0207639_100429393 261
305 3300026078 Ga0207702_10000269 Ga0207702_1000026931 261
306 3300026088 Ga0207641_10000116 Ga0207641_1000011687 261
307 3300026089 Ga0207648_10007593 Ga0207648_100075935 261
308 3300026095 Ga0207676_10008262 Ga0207676_100082622 261
309 3300026116 Ga0207674_10034779 Ga0207674_100347794 261
310 3300026116 Ga0207674_10046373 Ga0207674_100463733 261
311 3300026116 Ga0207674_10244804 Ga0207674_102448042 261
312 3300026118 Ga0207675_100000382 Ga0207675_10000038238 261
313 3300026121 Ga0207683_10562140 Ga0207683_105621401 261
314 3300026142 Ga0207698_10000594 Ga0207698_1000059414 261
315 3300026142 Ga0207698_10011510 Ga0207698_100115102 261
316 3300028380 Ga0268265_10000990 Ga0268265_1000099014 261
317 3300028381 Ga0268264_10000023 Ga0268264_10000023202 261
318 3300028800 Ga0265338_10007089 Ga0265338_100070896 261
319 3300031241 Ga0265325_10003271 Ga0265325_100032712 261
320 3300031249 Ga0265339_10009768 Ga0265339_100097685 261
321 3300031250 Ga0265331_10000011 Ga0265331_1000001130 261
322 3300031344 Ga0265316_10088791 Ga0265316_100887912 261
323 3300031456 Ga0307513_10004619 Ga0307513_1000461911 261
324 3300031616 Ga0307508_10000398 Ga0307508_1000039818 261
325 3300031711 Ga0265314_10007030 Ga0265314_100070306 261
326 3300031730 Ga0307516_10000056 Ga0307516_10000056111 261
327 3300032002 Ga0307416_100493638 Ga0307416_1004936382 261
328 3300035695 Ga0373927_0157067 Ga0373927_0157067_79_885 261
329 3300038443 Ga0395901_0048779 Ga0395901_0048779_2174_2962 261
330 3300041512 Ga0451853_3917748 Ga0451853_3917748_1532_2326 261
331 3300041997 Ga0439431_0028103 Ga0439431_0028103_45_851 261
332 3300044656 Ga0466969_0204183 Ga0466969_0204183_58_855 261
333 3300044683 Ga0466965_0012178 Ga0466965_0012178_1596_2396 261
334 3300044684 Ga0466966_0022908 Ga0466966_0022908_1158_1955 261
335 3300044719 Ga0466971_0039989 Ga0466971_0039989_415_1212 261
336 3300044765 Ga0466970_0194140 Ga0466970_0194140_110_907 261
337 3300045049 Ga0466959_0343350 Ga0466959_0343350_100_897 261
338 3300046460 Ga0495638_0000016 Ga0495638_0000016_276795_277592 261
339 3300046471 Ga0495650_0001079 Ga0495650_0001079_15734_16603 261
340 3300046506 Ga0495583_0000094 Ga0495583_0000094_31456_32253 261
341 3300046515 Ga0495620_0122269 Ga0495620_0122269_37_825 261
342 3300046519 Ga0495632_0000440 Ga0495632_0000440_10866_11663 261
343 3300046524 Ga0495648_0000013 Ga0495648_0000013_118914_119711 261
344 3300046692 Ga0495671_0000018 Ga0495671_0000018_121293_122090 261
345 3300046692 Ga0495671_0007195 Ga0495671_0007195_3271_4065 261
346 3300047469 Ga0495673_0000435 Ga0495673_0000435_14596_15393 261
347 3300048905 Ga0496102_0148715 Ga0496102_0148715_431_1234 261
348 3300048906 Ga0496103_0001726 Ga0496103_0001726_6089_6892 261
349 3300048908 Ga0496105_0434005 Ga0496105_0434005_92_895 261
350 3300048910 Ga0496107_0058785 Ga0496107_0058785_332_1135 261
351 3300048920 Ga0496117_0004450 Ga0496117_0004450_7511_8314 261
352 3300048921 Ga0496118_0054826 Ga0496118_0054826_431_1234 261
353 3300048922 Ga0496119_0168493 Ga0496119_0168493_206_1009 261
354 3300048924 Ga0496121_0000069 Ga0496121_0000069_17523_18317 261
355 3300048924 Ga0496121_0006381 Ga0496121_0006381_3228_4028 261
356 3300048929 Ga0496126_0002035 Ga0496126_0002035_6850_7641 261
357 3300048929 Ga0496126_0008156 Ga0496126_0008156_3631_4425 261
358 3300049571 Ga0501034_0711822 Ga0501034_0711822_47_838 261
359 3300049823 Ga0501044_0000705 Ga0501044_0000705_14947_15738 261
360 3300053087 Ga0500643_091449 Ga0500643_091449_18_815 261
361 3300053092 Ga0500583_0008746 Ga0500583_0008746_1275_2075 261
362 3300053092 Ga0500583_0011157 Ga0500583_0011157_334_1134 261
363 3300053096 Ga0500641_0195073 Ga0500641_0195073_56_856 261
364 3300053118 Ga0500594_0002262 Ga0500594_0002262_3099_3896 261
365 3300053729 Ga0500625_068820 Ga0500625_068820_89_886 261
366 3300032005 Ga0307411_10162460 Ga0307411_101624602 262
367 3300046543 Ga0495645_0045057 Ga0495645_0045057_219_1031 262
368 3300047323 Ga0495683_0189479 Ga0495683_0189479_22_834 262
369 3300048091 Ga0495626_0071284 Ga0495626_0071284_288_1100 262
370 3300048929 Ga0496126_0477753 Ga0496126_0477753_14_811 262
371 3300001989 JGI24739J22299_10002627 JGI24739J22299_100026271 263
372 3300002459 JGI24751J29686_10001596 JGI24751J29686_100015966 263
373 3300003323 rootH1_10115529 rootH1_101155292 263
374 3300005290 Ga0065712_10211592 Ga0065712_102115922 263
375 3300005327 Ga0070658_10002088 Ga0070658_1000208815 263
376 3300005331 Ga0070670_100000046 Ga0070670_1000000465 263
377 3300005333 Ga0070677_10059409 Ga0070677_100594091 263
378 3300005336 Ga0070680_100041415 Ga0070680_1000414154 263
379 3300005347 Ga0070668_100000066 Ga0070668_10000006632 263
380 3300005347 Ga0070668_100017348 Ga0070668_1000173484 263
381 3300005353 Ga0070669_100005421 Ga0070669_1000054217 263
382 3300005353 Ga0070669_100034012 Ga0070669_1000340122 263
383 3300005356 Ga0070674_100035748 Ga0070674_1000357484 263
384 3300005367 Ga0070667_100022623 Ga0070667_1000226236 263
385 3300005457 Ga0070662_100003634 Ga0070662_1000036342 263
386 3300005459 Ga0068867_100024296 Ga0068867_1000242963 263
387 3300005468 Ga0070707_100113693 Ga0070707_1001136932 263
388 3300005539 Ga0068853_100008767 Ga0068853_1000087676 263
389 3300005543 Ga0070672_100061098 Ga0070672_1000610983 263
390 3300005546 Ga0070696_100200912 Ga0070696_1002009122 263
391 3300005548 Ga0070665_100012084 Ga0070665_1000120847 263
392 3300005563 Ga0068855_100241539 Ga0068855_1002415392 263
393 3300005577 Ga0068857_100005710 Ga0068857_1000057104 263
394 3300005577 Ga0068857_100115427 Ga0068857_1001154272 263
395 3300005577 Ga0068857_100140954 Ga0068857_1001409542 263
396 3300005578 Ga0068854_100000276 Ga0068854_1000002767 263
397 3300005614 Ga0068856_100001197 Ga0068856_10000119718 263
398 3300005616 Ga0068852_100000071 Ga0068852_10000007140 263
399 3300005617 Ga0068859_100010215 Ga0068859_1000102152 263
400 3300005617 Ga0068859_100739033 Ga0068859_1007390332 263
401 3300005618 Ga0068864_100731068 Ga0068864_1007310681 263
402 3300005718 Ga0068866_10023234 Ga0068866_100232343 263
403 3300005719 Ga0068861_100028082 Ga0068861_1000280825 263
404 3300005834 Ga0068851_10153224 Ga0068851_101532242 263
405 3300005840 Ga0068870_10004591 Ga0068870_100045913 263
406 3300005841 Ga0068863_100000680 Ga0068863_10000068015 263
407 3300005842 Ga0068858_100037638 Ga0068858_1000376382 263
408 3300005843 Ga0068860_100000479 Ga0068860_10000047940 263
409 3300005843 Ga0068860_100033493 Ga0068860_1000334933 263
410 3300005844 Ga0068862_100000118 Ga0068862_10000011839 263
411 3300005844 Ga0068862_100013453 Ga0068862_1000134535 263
412 3300005844 Ga0068862_100077838 Ga0068862_1000778383 263
413 3300006195 Ga0075366_10038779 Ga0075366_100387793 263
414 3300006846 Ga0075430_100019681 Ga0075430_1000196813 263
415 3300006847 Ga0075431_100160688 Ga0075431_1001606883 263
416 3300006847 Ga0075431_100261672 Ga0075431_1002616723 263
417 3300006880 Ga0075429_100329312 Ga0075429_1003293122 263
418 3300006931 Ga0097620_100010215 Ga0097620_1000102152 263
419 3300006931 Ga0097620_100739120 Ga0097620_1007391202 263
420 3300009093 Ga0105240_10001039 Ga0105240_1000103919 263
421 3300009094 Ga0111539_10114185 Ga0111539_101141853 263
422 3300009101 Ga0105247_10005971 Ga0105247_100059714 263
423 3300009147 Ga0114129_10628365 Ga0114129_106283651 263
424 3300009177 Ga0105248_10101568 Ga0105248_101015684 263
425 3300009551 Ga0105238_10007472 Ga0105238_100074728 263
426 3300009553 Ga0105249_10000119 Ga0105249_1000011935 263
427 3300013306 Ga0163162_10222776 Ga0163162_102227762 263
428 3300013308 Ga0157375_10480743 Ga0157375_104807432 263
429 3300014326 Ga0157380_10373151 Ga0157380_103731512 263
430 3300014968 Ga0157379_10068076 Ga0157379_100680762 263
431 3300017792 Ga0163161_10389665 Ga0163161_103896651 263
432 3300025272 Ga0209455_1008365 Ga0209455_10083652 263
433 3300025298 Ga0209050_1000388 Ga0209050_100038813 263
434 3300025893 Ga0207682_10041994 Ga0207682_100419943 263
435 3300025899 Ga0207642_10068100 Ga0207642_100681002 263
436 3300025900 Ga0207710_10005614 Ga0207710_100056142 263
437 3300025903 Ga0207680_10413237 Ga0207680_104132371 263
438 3300025907 Ga0207645_10007195 Ga0207645_100071953 263
439 3300025908 Ga0207643_10010620 Ga0207643_100106203 263
440 3300025909 Ga0207705_10000296 Ga0207705_100002968 263
441 3300025913 Ga0207695_10003917 Ga0207695_100039175 263
442 3300025917 Ga0207660_10137470 Ga0207660_101374702 263
443 3300025922 Ga0207646_10106053 Ga0207646_101060532 263
444 3300025923 Ga0207681_10006265 Ga0207681_100062658 263
445 3300025923 Ga0207681_10085653 Ga0207681_100856532 263
446 3300025924 Ga0207694_10024486 Ga0207694_100244867 263
447 3300025924 Ga0207694_10095672 Ga0207694_100956722 263
448 3300025925 Ga0207650_10000008 Ga0207650_1000000839 263
449 3300025933 Ga0207706_10002119 Ga0207706_100021193 263
450 3300025933 Ga0207706_10002132 Ga0207706_1000213213 263
451 3300025937 Ga0207669_10003651 Ga0207669_100036514 263
452 3300025937 Ga0207669_10237509 Ga0207669_102375092 263
453 3300025940 Ga0207691_10005982 Ga0207691_100059824 263
454 3300025949 Ga0207667_10203241 Ga0207667_102032413 263
455 3300025961 Ga0207712_10000048 Ga0207712_1000004834 263
456 3300025972 Ga0207668_10000055 Ga0207668_1000005552 263
457 3300025972 Ga0207668_10011650 Ga0207668_100116503 263
458 3300025972 Ga0207668_10292374 Ga0207668_102923742 263
459 3300025981 Ga0207640_10001445 Ga0207640_100014453 263
460 3300025981 Ga0207640_10161728 Ga0207640_101617282 263
461 3300025986 Ga0207658_10013719 Ga0207658_100137192 263
462 3300026035 Ga0207703_10017243 Ga0207703_100172432 263
463 3300026041 Ga0207639_10085039 Ga0207639_100850391 263
464 3300026078 Ga0207702_10004349 Ga0207702_100043499 263
465 3300026088 Ga0207641_10005391 Ga0207641_100053912 263
466 3300026089 Ga0207648_10001606 Ga0207648_1000160620 263
467 3300026089 Ga0207648_10073581 Ga0207648_100735812 263
468 3300026095 Ga0207676_10070859 Ga0207676_100708594 263
469 3300026095 Ga0207676_10352383 Ga0207676_103523832 263
470 3300026116 Ga0207674_10015001 Ga0207674_100150015 263
471 3300026116 Ga0207674_10115356 Ga0207674_101153561 263
472 3300026116 Ga0207674_10271856 Ga0207674_102718562 263
473 3300026118 Ga0207675_100001154 Ga0207675_10000115411 263
474 3300026142 Ga0207698_10000062 Ga0207698_1000006232 263
475 3300027111 Ga0209281_1012173 Ga0209281_10121732 263
476 3300027526 Ga0209968_1005693 Ga0209968_10056932 263
477 3300027614 Ga0209970_1003899 Ga0209970_10038993 263
478 3300027617 Ga0210002_1000575 Ga0210002_10005753 263
479 3300027665 Ga0209983_1004982 Ga0209983_10049823 263
480 3300027682 Ga0209971_1001620 Ga0209971_10016206 263
481 3300027695 Ga0209966_1013897 Ga0209966_10138972 263
482 3300027717 Ga0209998_10000317 Ga0209998_100003174 263
483 3300027876 Ga0209974_10001822 Ga0209974_100018224 263
484 3300027907 Ga0207428_10201036 Ga0207428_102010363 263
485 3300028379 Ga0268266_10027437 Ga0268266_100274372 263
486 3300028380 Ga0268265_10000139 Ga0268265_1000013945 263
487 3300028380 Ga0268265_10006620 Ga0268265_100066201 263
488 3300028381 Ga0268264_10000585 Ga0268264_100005859 263
489 3300028381 Ga0268264_10002651 Ga0268264_100026515 263
490 3300031456 Ga0307513_10103263 Ga0307513_101032632 263
491 3300031507 Ga0307509_10000038 Ga0307509_10000038157 263
492 3300031548 Ga0307408_100109357 Ga0307408_1001093572 263
493 3300031548 Ga0307408_100226072 Ga0307408_1002260721 263
494 3300031731 Ga0307405_10154795 Ga0307405_101547952 263
495 3300031901 Ga0307406_10392673 Ga0307406_103926731 263
496 3300031911 Ga0307412_10052157 Ga0307412_100521574 263
497 3300033180 Ga0307510_10045997 Ga0307510_100459975 263
498 3300035112 Ga0373932_0070118 Ga0373932_0070118_269_1075 263
499 3300046460 Ga0495638_0021582 Ga0495638_0021582_2301_3113 263
500 3300046492 Ga0495585_0001077 Ga0495585_0001077_18510_19316 263
501 3300046492 Ga0495585_0025691 Ga0495585_0025691_805_1623 263
502 3300046500 Ga0495596_0000739 Ga0495596_0000739_13387_14193 263
503 3300046500 Ga0495596_0001271 Ga0495596_0001271_3059_3862 263
504 3300046501 Ga0495607_0034109 Ga0495607_0034109_1893_2699 263
505 3300046507 Ga0495606_0033860 Ga0495606_0033860_733_1539 263
506 3300046507 Ga0495606_0050119 Ga0495606_0050119_1617_2420 263
507 3300046512 Ga0495610_0000170 Ga0495610_0000170_70755_71561 263
508 3300046512 Ga0495610_0006606 Ga0495610_0006606_2003_2806 263
509 3300046513 Ga0495616_0000040 Ga0495616_0000040_18803_19612 263
510 3300046513 Ga0495616_0071585 Ga0495616_0071585_765_1571 263
511 3300046519 Ga0495632_0048293 Ga0495632_0048293_1203_2009 263
512 3300046522 Ga0495643_0000039 Ga0495643_0000039_75859_76665 263
513 3300046538 Ga0495609_0011981 Ga0495609_0011981_972_1778 263
514 3300046558 Ga0495633_0172024 Ga0495633_0172024_80_886 263
515 3300046616 Ga0495668_0007648 Ga0495668_0007648_1711_2520 263
516 3300046616 Ga0495668_0153074 Ga0495668_0153074_422_1228 263
517 3300046660 Ga0495625_0000093 Ga0495625_0000093_61676_62479 263
518 3300046660 Ga0495625_0018414 Ga0495625_0018414_1490_2302 263
519 3300046660 Ga0495625_0343845 Ga0495625_0343845_91_897 263
520 3300046691 Ga0495670_0017088 Ga0495670_0017088_2494_3306 263
521 3300046692 Ga0495671_0071022 Ga0495671_0071022_725_1531 263
522 3300047469 Ga0495673_0030476 Ga0495673_0030476_485_1351 263
523 3300047472 Ga0495686_0000060 Ga0495686_0000060_153888_154691 263
524 3300048090 Ga0495615_0000003 Ga0495615_0000003_70474_71280 263
525 3300048091 Ga0495626_0000848 Ga0495626_0000848_14676_15479 263
526 3300048904 Ga0496101_0023087 Ga0496101_0023087_1214_2017 263
527 3300048919 Ga0496116_0000361 Ga0496116_0000361_49787_50590 263
528 3300048921 Ga0496118_0011348 Ga0496118_0011348_3860_4663 263
529 3300048923 Ga0496120_0030592 Ga0496120_0030592_2129_2932 263
530 3300048924 Ga0496121_0004442 Ga0496121_0004442_17063_17869 263
531 3300048925 Ga0496122_0002822 Ga0496122_0002822_4503_5306 263
532 3300048925 Ga0496122_0006933 Ga0496122_0006933_106_912 263
533 3300048926 Ga0496123_0001093 Ga0496123_0001093_19783_20586 263
534 3300048926 Ga0496123_0003427 Ga0496123_0003427_16997_17803 263
535 3300048927 Ga0496124_0006793 Ga0496124_0006793_10564_11370 263
536 3300048927 Ga0496124_0046394 Ga0496124_0046394_994_1797 263
537 3300048927 Ga0496124_0353133 Ga0496124_0353133_135_941 263
538 3300048928 Ga0496125_0028843 Ga0496125_0028843_1924_2727 263
539 3300048929 Ga0496126_0000136 Ga0496126_0000136_116924_117727 263
540 3300049515 Ga0501292_000004 Ga0501292_000004_116122_116928 263
541 3300049517 Ga0501294_000150 Ga0501294_000150_3223_4029 263
542 3300049524 Ga0501301_003525 Ga0501301_003525_24_830 263
543 3300049573 Ga0501037_0109672 Ga0501037_0109672_974_1777 263
544 3300049652 Ga0501202_007786 Ga0501202_007786_151_957 263
545 3300049653 Ga0501206_002373 Ga0501206_002373_58_864 263
546 3300049662 Ga0501222_009140 Ga0501222_009140_171_977 263
547 3300049663 Ga0501223_001885 Ga0501223_001885_3206_4012 263
548 3300049664 Ga0501224_005774 Ga0501224_005774_395_1201 263
549 3300049665 Ga0501227_005723 Ga0501227_005723_1513_2319 263
550 3300049668 Ga0501233_005913 Ga0501233_005913_1105_1911 263
551 3300049686 Ga0501257_000013 Ga0501257_000013_41742_42560 263
552 3300049690 Ga0501261_000010 Ga0501261_000010_31641_32447 263
553 3300049704 Ga0501221_024335 Ga0501221_024335_360_1166 263
554 3300049708 Ga0501245_000129 Ga0501245_000129_5322_6128 263
555 3300049775 Ga0501279_000005 Ga0501279_000005_61688_62494 263
556 3300049776 Ga0501280_000277 Ga0501280_000277_8927_9733 263
557 3300049777 Ga0501281_00015 Ga0501281_00015_3200_4006 263
558 3300049778 Ga0501282_000134 Ga0501282_000134_7237_8043 263
559 3300049779 Ga0501283_001837 Ga0501283_001837_139_945 263
560 3300049823 Ga0501044_0001340 Ga0501044_0001340_12006_12809 263
561 3300050493 nmdc:mga0k408_83733_c1 nmdc:mga0k408_83733_c1_150_956 263
562 3300050507 nmdc:mga05p37_538442_c1 nmdc:mga05p37_538442_c1_47_853 263
563 3300050508 nmdc:mga09592_172593_c1 nmdc:mga09592_172593_c1_654_1445 263
564 3300050509 nmdc:mga0qj67_89527_c1 nmdc:mga0qj67_89527_c1_1191_1982 263
565 3300050510 nmdc:mga06r32_187956_c1 nmdc:mga06r32_187956_c1_474_1265 263
566 3300050510 nmdc:mga06r32_19791_c1 nmdc:mga06r32_19791_c1_3211_4002 263
567 3300053087 Ga0500643_004375 Ga0500643_004375_5583_6395 263
568 3300053125 Ga0500618_001102 Ga0500618_001102_12291_13100 263
569 3300053151 Ga0500604_0005509 Ga0500604_0005509_1655_2464 263
570 3300053158 Ga0500627_0000305 Ga0500627_0000305_941_1750 263
571 3300005459 Ga0068867_100220811 Ga0068867_1002208112 264
572 3300025940 Ga0207691_10210260 Ga0207691_102102602 264
573 3300046615 Ga0495656_0015123 Ga0495656_0015123_690_1508 264
574 3300006195 Ga0075366_10093667 Ga0075366_100936672 265
575 3300006353 Ga0075370_10132604 Ga0075370_101326042 265
576 3300031727 Ga0316576_10277347 Ga0316576_102773471 265
577 3300046519 Ga0495632_0000001 Ga0495632_0000001_833412_834236 265
578 3300046519 Ga0495632_0123441 Ga0495632_0123441_244_1056 265
579 3300046525 Ga0495663_0000001 Ga0495663_0000001_39060_39884 265
580 3300046558 Ga0495633_0000122 Ga0495633_0000122_64912_65736 265
581 3300047472 Ga0495686_0007537 Ga0495686_0007537_4462_5286 265
582 3300048905 Ga0496102_0014133 Ga0496102_0014133_748_1548 265
583 3300048929 Ga0496126_0347269 Ga0496126_0347269_278_1102 265
584 3300050493 nmdc:mga0k408_31771_c2 nmdc:mga0k408_31771_c2_378_1202 265
585 3300050496 nmdc:mga07m45_136485_c1 nmdc:mga07m45_136485_c1_384_1235 265
586 3300031995 Ga0307409_100107920 Ga0307409_1001079203 266
587 3300032002 Ga0307416_100542345 Ga0307416_1005423452 266
588 3300032126 Ga0307415_100105417 Ga0307415_1001054172 266
589 3300042876 Ga0451577_0182713 Ga0451577_0182713_1046_1846 266
590 3300005841 Ga0068863_100222921 Ga0068863_1002229213 267
591 3300021384 Ga0213876_10099717 Ga0213876_100997173 267
592 3300039437 Ga0436365_0251199 Ga0436365_0251199_2185_2991 267
593 3300039450 Ga0436363_0930417 Ga0436363_0930417_72_878 267
594 3300042876 Ga0451577_0002093 Ga0451577_0002093_6803_7606 267
595 3300042876 Ga0451577_0004914 Ga0451577_0004914_12283_13086 267
596 3300044673 Ga0453683_0007037 Ga0453683_0007037_4571_5374 267
597 3300044712 Ga0453684_0017528 Ga0453684_0017528_4572_5375 267
598 3300045051 Ga0451576_0073907 Ga0451576_0073907_1052_1855 267
599 2162886007 SwRhRL2b_contig_949771 SwRhRL2b_0117.00004670 268
600 3300005289 Ga0065704_10001355 Ga0065704_100013557 268
601 3300005439 Ga0070711_100014843 Ga0070711_1000148433 268
602 3300006175 Ga0070712_100138822 Ga0070712_1001388222 268
603 3300006844 Ga0075428_100024159 Ga0075428_1000241593 268
604 3300006847 Ga0075431_100092136 Ga0075431_1000921363 268
605 3300009545 Ga0105237_10114025 Ga0105237_101140253 268
606 3300009551 Ga0105238_10036602 Ga0105238_100366024 268
607 3300025913 Ga0207695_10040246 Ga0207695_100402463 268
608 3300025914 Ga0207671_10034845 Ga0207671_100348454 268
609 3300025915 Ga0207693_10197064 Ga0207693_101970642 268
610 3300025916 Ga0207663_10002130 Ga0207663_100021304 268
611 3300032002 Ga0307416_100958243 Ga0307416_1009582431 268
612 3300042003 Ga0439443_008773 Ga0439443_008773_598_1404 268
613 3300042436 Ga0439435_0015068 Ga0439435_0015068_684_1490 268
614 3300042876 Ga0451577_0010487 Ga0451577_0010487_3132_3938 268
615 3300042876 Ga0451577_0020834 Ga0451577_0020834_4899_5705 268
616 3300042876 Ga0451577_0079101 Ga0451577_0079101_77_883 268
617 3300044712 Ga0453684_0018551 Ga0453684_0018551_6233_7039 268
618 3300045051 Ga0451576_0016357 Ga0451576_0016357_353_1159 268
619 3300048907 Ga0496104_0008239 Ga0496104_0008239_4203_5036 268
620 3300048908 Ga0496105_0007367 Ga0496105_0007367_2390_3223 268
621 3300048917 Ga0496114_0020727 Ga0496114_0020727_2745_3578 268
622 3300048918 Ga0496115_0004400 Ga0496115_0004400_4539_5372 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

228

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

275

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9607 4 246
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9513 4 246
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9511 3 249
5g4l-assembly1.cif.gz_A phloroglucinol reductase from clostridium sp. with bound nadph 0.9499 4 246
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9472 3 246
ID Description Score Start End Superfamily
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9607 4 246 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9503 4 184 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9498 4 249 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 1 246 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 88 188 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2M8NSE2-F1-model_v4 Short-chain dehydrogenase 0.9719 3 189 GO:0016616
AF-A0A6L6R527-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9706 1 192 GO:0016491
AF-A0A3C2B842-F1-model_v4 Short-chain dehydrogenase 0.9698 2 260
AF-A0A437PFB9-F1-model_v4 SDR family oxidoreductase 0.9642 22 246 GO:0016491
AF-A0A3S1RX16-F1-model_v4 SDR family oxidoreductase 0.9635 22 246 GO:0016616

Feature Viewer

pLDDT pTM Quality
94.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map