F470013

General Info

Members Datasets Scaffolds Average Seq Length
621 266 621 118

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100257623|Ga0307416_1002576232
Length 119
Sequence VSGYLPVAIYLALIIGFAAISLIMARLLRPSRPNSSYAKEQNYECGAEPIGTAWVQFPVGFYLVALVFIVFDTLAIFLFPFALVLRELGVWALGAMGAFVAVLTLGWIYAYREGILDWK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 2.42
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002893 3300003203 Bacteria 8098
2 Ga0065712_10003667 3300005290 Bacteria 6051
3 Ga0065715_10009447 3300005293 Bacteria 2906
4 Ga0065715_10093719 3300005293 Bacteria 4583
5 Ga0065715_10118663 3300005293 Bacteria 2310
6 Ga0065707_10207494 3300005295 Bacteria 1281
7 Ga0070676_10006734 3300005328 Bacteria 6155
8 Ga0070683_100014312 3300005329 Bacteria 6937
9 Ga0070670_100019360 3300005331 Bacteria 5840
10 Ga0070670_100491031 3300005331 Bacteria 1091
11 Ga0068869_100001496 3300005334 Bacteria 13845
12 Ga0068869_100136433 3300005334 Bacteria 1891
13 Ga0068869_100160277 3300005334 Bacteria 1751
14 Ga0068869_101054158 3300005334 Unclassified 710
15 Ga0070680_100000934 3300005336 Bacteria 20654
16 Ga0070680_100111435 3300005336 Bacteria 2278
17 Ga0070680_100282995 3300005336 Bacteria 1405
18 Ga0070682_100001865 3300005337 Bacteria 11757
19 Ga0068868_100044648 3300005338 Bacteria 3465
20 Ga0068868_100938710 3300005338 Bacteria 788
21 Ga0070660_100024523 3300005339 Bacteria 4474
22 Ga0070689_100736688 3300005340 Bacteria 863
23 Ga0070689_101620204 3300005340 Bacteria 588
24 Ga0070691_10002071 3300005341 Bacteria 8856
25 Ga0070691_10330860 3300005341 Bacteria 841
26 Ga0070687_100140453 3300005343 Bacteria 1406
27 Ga0070687_100330650 3300005343 Bacteria 977
28 Ga0070661_100000211 3300005344 Bacteria 48345
29 Ga0070692_10002475 3300005345 Bacteria 7181
30 Ga0070692_10368949 3300005345 Bacteria 897
31 Ga0070692_10535573 3300005345 Bacteria 765
32 Ga0070668_100079796 3300005347 Bacteria 2563
33 Ga0070668_100160833 3300005347 Bacteria 1822
34 Ga0070668_100391262 3300005347 Bacteria 1185
35 Ga0070669_100019045 3300005353 Bacteria 4907
36 Ga0070669_100020540 3300005353 Bacteria 4717
37 Ga0070669_100088728 3300005353 Bacteria 2315
38 Ga0070675_100309347 3300005354 Bacteria 1394
39 Ga0070671_101362795 3300005355 Unclassified 626
40 Ga0070673_100022870 3300005364 Bacteria 4559
41 Ga0070673_101392182 3300005364 Bacteria 660
42 Ga0070688_101703130 3300005365 Unclassified 516
43 Ga0070659_100001505 3300005366 Bacteria 16800
44 Ga0070659_100876943 3300005366 Bacteria 783
45 Ga0070667_100088984 3300005367 Bacteria 2652
46 Ga0070667_100993799 3300005367 Bacteria 783
47 Ga0070703_10028898 3300005406 Bacteria 1660
48 Ga0070703_10114460 3300005406 Bacteria 970
49 Ga0070703_10213748 3300005406 Bacteria 764
50 Ga0070703_10389540 3300005406 Bacteria 604
51 Ga0070701_10490662 3300005438 Bacteria 796
52 Ga0070701_10637470 3300005438 Bacteria 710
53 Ga0070711_100337382 3300005439 Bacteria 1208
54 Ga0070705_100005391 3300005440 Bacteria 6231
55 Ga0070705_100018832 3300005440 Bacteria 3625
56 Ga0070705_100161089 3300005440 Bacteria 1500
57 Ga0070705_100758454 3300005440 Bacteria 768
58 Ga0070705_100767238 3300005440 Bacteria 764
59 Ga0070700_100247920 3300005441 Bacteria 1276
60 Ga0070694_100003319 3300005444 Bacteria 9628
61 Ga0070694_100021019 3300005444 Bacteria 4166
62 Ga0070694_100196049 3300005444 Bacteria 1503
63 Ga0070694_100551631 3300005444 Bacteria 923
64 Ga0070694_100994426 3300005444 Unclassified 696
65 Ga0070708_100201245 3300005445 Bacteria 1864
66 Ga0070708_100400239 3300005445 Bacteria 1295
67 Ga0070708_100875009 3300005445 Bacteria 844
68 Ga0070708_100900046 3300005445 Bacteria 831
69 Ga0070708_101080412 3300005445 Bacteria 752
70 Ga0070663_100026467 3300005455 Bacteria 3930
71 Ga0070662_100286622 3300005457 Bacteria 1334
72 Ga0070662_100638521 3300005457 Bacteria 897
73 Ga0070681_10062390 3300005458 Bacteria 3701
74 Ga0070681_10247040 3300005458 Bacteria 1697
75 Ga0068867_100006675 3300005459 Bacteria 8159
76 Ga0068867_100283723 3300005459 Bacteria 1359
77 Ga0068867_100475128 3300005459 Bacteria 1070
78 Ga0068867_101650454 3300005459 Unclassified 600
79 Ga0070706_100035858 3300005467 Bacteria 4580
80 Ga0070706_100095440 3300005467 Bacteria 2760
81 Ga0070706_100832164 3300005467 Bacteria 854
82 Ga0070706_100949681 3300005467 Bacteria 793
83 Ga0070707_100076882 3300005468 Bacteria 3220
84 Ga0070707_100231760 3300005468 Unclassified 1797
85 Ga0070707_100646572 3300005468 Bacteria 1020
86 Ga0070707_100832395 3300005468 Bacteria 887
87 Ga0070707_101085066 3300005468 Bacteria 766
88 Ga0070698_100035071 3300005471 Bacteria 5188
89 Ga0070698_100195389 3300005471 Bacteria 1960
90 Ga0070698_101036465 3300005471 Bacteria 768
91 Ga0070698_101232879 3300005471 Bacteria 697
92 Ga0070699_100008025 3300005518 Bacteria 9167
93 Ga0070699_100064987 3300005518 Bacteria 3165
94 Ga0070699_100091594 3300005518 Bacteria 2658
95 Ga0070699_100541622 3300005518 Unclassified 1059
96 Ga0070679_100008274 3300005530 Bacteria 9785
97 Ga0070684_100072662 3300005535 Bacteria 3029
98 Ga0070697_100008644 3300005536 Bacteria 7953
99 Ga0070697_100085434 3300005536 Bacteria 2603
100 Ga0070697_100139504 3300005536 Bacteria 2038
101 Ga0070697_100248301 3300005536 Bacteria 1521
102 Ga0070697_100883483 3300005536 Bacteria 793
103 Ga0070697_100980987 3300005536 Bacteria 751
104 Ga0070697_101228978 3300005536 Bacteria 668
105 Ga0068853_100000678 3300005539 Bacteria 23432
106 Ga0068853_101244189 3300005539 Bacteria 719
107 Ga0068853_101876163 3300005539 Bacteria 581
108 Ga0070672_100050763 3300005543 Bacteria 3233
109 Ga0070672_100176944 3300005543 Bacteria 1777
110 Ga0070686_100448179 3300005544 Bacteria 992
111 Ga0070686_100933752 3300005544 Bacteria 708
112 Ga0070695_100002498 3300005545 Bacteria 10593
113 Ga0070695_100005383 3300005545 Bacteria 7533
114 Ga0070695_100199280 3300005545 Bacteria 1430
115 Ga0070695_100224007 3300005545 Bacteria 1356
116 Ga0070696_100091216 3300005546 Bacteria 2169
117 Ga0070696_100335766 3300005546 Bacteria 1167
118 Ga0070696_100769995 3300005546 Bacteria 790
119 Ga0070696_101158797 3300005546 Unclassified 652
120 Ga0070693_100000189 3300005547 Bacteria 28531
121 Ga0070693_100214766 3300005547 Bacteria 1257
122 Ga0070704_100001133 3300005549 Bacteria 13909
123 Ga0070704_100006591 3300005549 Bacteria 6850
124 Ga0070704_100226172 3300005549 Bacteria 1524
125 Ga0070704_100295349 3300005549 Bacteria 1348
126 Ga0070704_100330325 3300005549 Bacteria 1280
127 Ga0068855_100015121 3300005563 Bacteria 9293
128 Ga0068855_100967163 3300005563 Bacteria 896
129 Ga0070664_100012522 3300005564 Bacteria 6898
130 Ga0070664_100445210 3300005564 Bacteria 1189
131 Ga0068857_100046341 3300005577 Bacteria 3858
132 Ga0068854_100002061 3300005578 Bacteria 12321
133 Ga0068856_100008288 3300005614 Bacteria 10131
134 Ga0070702_100191925 3300005615 Bacteria 1345
135 Ga0068852_101628962 3300005616 Bacteria 668
136 Ga0068859_100849413 3300005617 Bacteria 999
137 Ga0068859_100906665 3300005617 Bacteria 966
138 Ga0068864_100021673 3300005618 Bacteria 5381
139 Ga0068864_100206245 3300005618 Bacteria 1808
140 Ga0068864_100332396 3300005618 Bacteria 1430
141 Ga0068864_100586032 3300005618 Unclassified 1081
142 Ga0068866_10161459 3300005718 Bacteria 1307
143 Ga0068861_100006876 3300005719 Bacteria 7768
144 Ga0068861_100291751 3300005719 Bacteria 1409
145 Ga0068861_100772554 3300005719 Bacteria 899
146 Ga0068870_10007619 3300005840 Bacteria 4839
147 Ga0068870_10626455 3300005840 Unclassified 734
148 Ga0068863_100005815 3300005841 Bacteria 12091
149 Ga0068863_100168455 3300005841 Bacteria 2101
150 Ga0068863_100314327 3300005841 Bacteria 1521
151 Ga0068863_101062833 3300005841 Unclassified 813
152 Ga0068858_100076039 3300005842 Bacteria 3119
153 Ga0068860_100004587 3300005843 Bacteria 14099
154 Ga0068860_100042805 3300005843 Bacteria 4322
155 Ga0068860_100231057 3300005843 Bacteria 1797
156 Ga0068862_100015431 3300005844 Bacteria 6345
157 Ga0068862_100117879 3300005844 Bacteria 2337
158 Ga0068862_101286944 3300005844 Bacteria 732
159 Ga0068862_101617789 3300005844 Bacteria 655
160 Ga0081455_10022244 3300005937 Bacteria 5930
161 Ga0081539_10000096 3300005985 Bacteria 204059
162 Ga0075365_10025483 3300006038 Bacteria 3744
163 Ga0075365_10321702 3300006038 Bacteria 1089
164 Ga0075365_10322661 3300006038 Bacteria 1088
165 Ga0075364_10029608 3300006051 Bacteria 3512
166 Ga0075364_10217964 3300006051 Bacteria 1294
167 Ga0075432_10416544 3300006058 Unclassified 583
168 Ga0070712_100018868 3300006175 Bacteria 4488
169 Ga0075362_10000233 3300006177 Bacteria 15482
170 Ga0075367_10533041 3300006178 Unclassified 745
171 Ga0075366_10039306 3300006195 Bacteria 2797
172 Ga0075366_10826849 3300006195 Unclassified 576
173 Ga0097621_100444164 3300006237 Bacteria 1168
174 Ga0075428_100003167 3300006844 Bacteria 17983
175 Ga0075428_100026308 3300006844 Bacteria 6442
176 Ga0075428_100115170 3300006844 Bacteria 2928
177 Ga0075428_100136489 3300006844 Unclassified 2667
178 Ga0075428_100900045 3300006844 Bacteria 939
179 Ga0075428_101425780 3300006844 Unclassified 726
180 Ga0075430_100000404 3300006846 Bacteria 31995
181 Ga0075430_100044512 3300006846 Bacteria 3752
182 Ga0075430_100143064 3300006846 Bacteria 1992
183 Ga0075430_100269876 3300006846 Bacteria 1408
184 Ga0075431_100000082 3300006847 Bacteria 56660
185 Ga0075431_100001936 3300006847 Bacteria 19722
186 Ga0075431_100049839 3300006847 Bacteria 4317
187 Ga0075431_100338939 3300006847 Bacteria 1513
188 Ga0075431_101165949 3300006847 Bacteria 734
189 Ga0075433_10000427 3300006852 Bacteria 27010
190 Ga0075433_10010989 3300006852 Bacteria 7280
191 Ga0075433_10034070 3300006852 Bacteria 4371
192 Ga0075433_10039794 3300006852 Bacteria 4066
193 Ga0075433_10069763 3300006852 Bacteria 3087
194 Ga0075433_10075186 3300006852 Bacteria 2972
195 Ga0075433_10252706 3300006852 Bacteria 1564
196 Ga0075433_10358859 3300006852 Bacteria 1288
197 Ga0075434_100000180 3300006871 Bacteria 41040
198 Ga0075434_100104105 3300006871 Bacteria 2847
199 Ga0075434_100162184 3300006871 Bacteria 2255
200 Ga0075434_100224438 3300006871 Bacteria 1898
201 Ga0075434_100279243 3300006871 Unclassified 1690
202 Ga0075434_100545263 3300006871 Bacteria 1179
203 Ga0075434_100957100 3300006871 Bacteria 871
204 Ga0075434_101172210 3300006871 Unclassified 781
205 Ga0075429_100002106 3300006880 Bacteria 16613
206 Ga0075429_100002856 3300006880 Bacteria 14619
207 Ga0075429_100016759 3300006880 Bacteria 6344
208 Ga0075429_100031684 3300006880 Bacteria 4595
209 Ga0075429_100127202 3300006880 Unclassified 2228
210 Ga0068865_100286646 3300006881 Bacteria 1313
211 Ga0075436_100023165 3300006914 Bacteria 4266
212 Ga0075436_100034917 3300006914 Bacteria 3468
213 Ga0075436_100286513 3300006914 Unclassified 1178
214 Ga0097620_100849497 3300006931 Bacteria 999
215 Ga0097620_100906662 3300006931 Bacteria 966
216 Ga0075435_100045243 3300007076 Bacteria 3528
217 Ga0075435_100059789 3300007076 Bacteria 3089
218 Ga0075435_100067064 3300007076 Bacteria 2921
219 Ga0075435_100069510 3300007076 Bacteria 2872
220 Ga0075435_100161323 3300007076 Bacteria 1889
221 Ga0075435_100241170 3300007076 Bacteria 1537
222 Ga0075435_100488659 3300007076 Bacteria 1064
223 Ga0075435_100637335 3300007076 Bacteria 925
224 Ga0075435_101232754 3300007076 Unclassified 655
225 Ga0099794_10011283 3300007265 Bacteria 3820
226 Ga0099794_10038325 3300007265 Bacteria 2270
227 Ga0099794_10359180 3300007265 Bacteria 758
228 Ga0099794_10430881 3300007265 Bacteria 690
229 Ga0111539_10001292 3300009094 Bacteria 33417
230 Ga0111539_10001353 3300009094 Bacteria 32630
231 Ga0111539_10012644 3300009094 Bacteria 10575
232 Ga0111539_10308850 3300009094 Bacteria 1840
233 Ga0111539_10586624 3300009094 Bacteria 1298
234 Ga0111539_10695151 3300009094 Bacteria 1184
235 Ga0114129_10000110 3300009147 Bacteria 81178
236 Ga0114129_10086949 3300009147 Bacteria 4335
237 Ga0114129_10096779 3300009147 Bacteria 4086
238 Ga0114129_10106434 3300009147 Bacteria 3874
239 Ga0114129_10202186 3300009147 Bacteria 2690
240 Ga0114129_10321107 3300009147 Bacteria 2058
241 Ga0114129_10657937 3300009147 Bacteria 1351
242 Ga0114129_11189838 3300009147 Bacteria 950
243 Ga0114129_11219606 3300009147 Bacteria 936
244 Ga0114129_11671934 3300009147 Bacteria 778
245 Ga0114129_12576384 3300009147 Bacteria 607
246 Ga0114129_13026216 3300009147 Bacteria 552
247 Ga0105243_10060967 3300009148 Bacteria 3015
248 Ga0105243_11799387 3300009148 Bacteria 643
249 Ga0105241_10001410 3300009174 Bacteria 18406
250 Ga0105242_10623388 3300009176 Bacteria 1045
251 Ga0105248_10098036 3300009177 Bacteria 3302
252 Ga0105237_10211607 3300009545 Bacteria 1939
253 Ga0105249_10716842 3300009553 Bacteria 1061
254 Ga0105249_10813350 3300009553 Bacteria 999
255 Ga0105249_12452720 3300009553 Bacteria 594
256 Ga0105239_10952802 3300010375 Bacteria 986
257 Ga0105239_12007369 3300010375 Unclassified 671
258 Ga0105246_10014486 3300011119 Bacteria 4960
259 Ga0157373_10015786 3300013100 Bacteria 5513
260 Ga0157371_10234753 3300013102 Bacteria 1318
261 Ga0157370_10308851 3300013104 Bacteria 1459
262 Ga0157369_10059275 3300013105 Bacteria 4128
263 Ga0157378_10135169 3300013297 Bacteria 2286
264 Ga0157378_10192904 3300013297 Bacteria 1923
265 Ga0163162_10036717 3300013306 Bacteria 4886
266 Ga0163162_10215621 3300013306 Bacteria 2050
267 Ga0157372_10006472 3300013307 Bacteria 12468
268 Ga0157375_10028617 3300013308 Bacteria 5227
269 Ga0157375_10803431 3300013308 Bacteria 1089
270 Ga0163163_10057404 3300014325 Bacteria 3849
271 Ga0163163_11491609 3300014325 Bacteria 738
272 Ga0157380_10643578 3300014326 Bacteria 1056
273 Ga0157380_10894460 3300014326 Bacteria 913
274 Ga0157380_11200699 3300014326 Bacteria 802
275 Ga0157380_11659355 3300014326 Bacteria 696
276 Ga0157380_12434014 3300014326 Bacteria 589
277 Ga0182007_10019299 3300015262 Bacteria 2453
278 Ga0207653_10001516 3300025885 Bacteria 7515
279 Ga0207642_10159378 3300025899 Bacteria 1210
280 Ga0207647_10032509 3300025904 Bacteria 3350
281 Ga0207647_10114886 3300025904 Bacteria 1590
282 Ga0207647_10126024 3300025904 Bacteria 1507
283 Ga0207645_10000400 3300025907 Bacteria 35898
284 Ga0207643_10000424 3300025908 Bacteria 27864
285 Ga0207684_10040466 3300025910 Bacteria 3951
286 Ga0207684_10067040 3300025910 Bacteria 3049
287 Ga0207684_10168420 3300025910 Bacteria 1888
288 Ga0207684_10668124 3300025910 Bacteria 884
289 Ga0207654_10002440 3300025911 Bacteria 9494
290 Ga0207654_11033238 3300025911 Bacteria 598
291 Ga0207707_10000116 3300025912 Bacteria 81364
292 Ga0207707_10068879 3300025912 Unclassified 3084
293 Ga0207707_11078509 3300025912 Bacteria 656
294 Ga0207693_10141026 3300025915 Bacteria 1895
295 Ga0207663_10161883 3300025916 Bacteria 1580
296 Ga0207660_10003214 3300025917 Bacteria 10691
297 Ga0207660_10111790 3300025917 Bacteria 2057
298 Ga0207660_10516419 3300025917 Bacteria 970
299 Ga0207657_10000211 3300025919 Bacteria 60392
300 Ga0207649_10001872 3300025920 Bacteria 12020
301 Ga0207652_10003841 3300025921 Bacteria 12319
302 Ga0207646_10021998 3300025922 Bacteria 5883
303 Ga0207646_10082210 3300025922 Bacteria 2880
304 Ga0207646_10316445 3300025922 Unclassified 1410
305 Ga0207646_11245015 3300025922 Unclassified 651
306 Ga0207681_10040372 3300025923 Bacteria 3105
307 Ga0207650_10005754 3300025925 Bacteria 8456
308 Ga0207687_10537379 3300025927 Bacteria 979
309 Ga0207644_10069716 3300025931 Bacteria 2568
310 Ga0207690_10001495 3300025932 Bacteria 14606
311 Ga0207690_10708204 3300025932 Bacteria 828
312 Ga0207706_10002411 3300025933 Bacteria 18232
313 Ga0207706_10243256 3300025933 Bacteria 1573
314 Ga0207709_10068840 3300025935 Bacteria 2239
315 Ga0207670_10198564 3300025936 Bacteria 1522
316 Ga0207670_10241411 3300025936 Bacteria 1392
317 Ga0207704_10223450 3300025938 Bacteria 1395
318 Ga0207704_10439741 3300025938 Bacteria 1038
319 Ga0207704_10831932 3300025938 Bacteria 773
320 Ga0207691_10009557 3300025940 Bacteria 9307
321 Ga0207691_10044674 3300025940 Bacteria 4077
322 Ga0207711_11213804 3300025941 Unclassified 696
323 Ga0207711_11454070 3300025941 Bacteria 628
324 Ga0207689_10000201 3300025942 Bacteria 52554
325 Ga0207689_10006142 3300025942 Bacteria 10632
326 Ga0207689_10487208 3300025942 Bacteria 1033
327 Ga0207689_11358503 3300025942 Bacteria 596
328 Ga0207661_10116000 3300025944 Bacteria 2273
329 Ga0207667_10000342 3300025949 Bacteria 63745
330 Ga0207651_10256909 3300025960 Bacteria 1432
331 Ga0207712_10193760 3300025961 Bacteria 1606
332 Ga0207712_10540514 3300025961 Bacteria 1001
333 Ga0207712_10624758 3300025961 Bacteria 934
334 Ga0207712_11248727 3300025961 Bacteria 663
335 Ga0207668_10168930 3300025972 Bacteria 1713
336 Ga0207640_10005238 3300025981 Bacteria 7056
337 Ga0207658_11099868 3300025986 Bacteria 726
338 Ga0207677_10046871 3300026023 Bacteria 2897
339 Ga0207677_11520584 3300026023 Bacteria 618
340 Ga0207703_11282773 3300026035 Unclassified 704
341 Ga0207639_10010274 3300026041 Bacteria 6480
342 Ga0207639_12241353 3300026041 Unclassified 508
343 Ga0207678_10038622 3300026067 Bacteria 4147
344 Ga0207708_10342509 3300026075 Bacteria 1225
345 Ga0207708_10511633 3300026075 Bacteria 1008
346 Ga0207702_10001143 3300026078 Bacteria 27129
347 Ga0207641_10032523 3300026088 Bacteria 4331
348 Ga0207641_10193852 3300026088 Bacteria 1869
349 Ga0207641_10555201 3300026088 Bacteria 1120
350 Ga0207641_10662907 3300026088 Unclassified 1025
351 Ga0207648_10027633 3300026089 Bacteria 5036
352 Ga0207648_10106824 3300026089 Bacteria 2456
353 Ga0207648_10230014 3300026089 Bacteria 1649
354 Ga0207648_11453338 3300026089 Bacteria 644
355 Ga0207676_10009069 3300026095 Bacteria 7084
356 Ga0207676_10158776 3300026095 Bacteria 1957
357 Ga0207676_10843490 3300026095 Bacteria 896
358 Ga0207674_10000951 3300026116 Bacteria 37804
359 Ga0207675_100025354 3300026118 Bacteria 5518
360 Ga0207675_100135871 3300026118 Bacteria 2333
361 Ga0207675_100323798 3300026118 Bacteria 1505
362 Ga0207675_100366788 3300026118 Bacteria 1414
363 Ga0207675_100575684 3300026118 Bacteria 1127
364 Ga0207675_100873446 3300026118 Bacteria 915
365 Ga0209995_1000169 3300027471 Bacteria 10476
366 Ga0209983_1060072 3300027665 Bacteria 839
367 Ga0209588_1004754 3300027671 Bacteria 3852
368 Ga0209588_1036728 3300027671 Bacteria 1577
369 Ga0209971_1011663 3300027682 Bacteria 2082
370 Ga0209966_1013125 3300027695 Bacteria 1529
371 Ga0209813_10235709 3300027866 Bacteria 690
372 Ga0209974_10138703 3300027876 Unclassified 871
373 Ga0207428_10000027 3300027907 Bacteria 250186
374 Ga0207428_10007638 3300027907 Bacteria 9844
375 Ga0207428_10074725 3300027907 Bacteria 2657
376 Ga0207428_10220260 3300027907 Bacteria 1423
377 Ga0268265_10059441 3300028380 Bacteria 2924
378 Ga0268265_10265627 3300028380 Bacteria 1528
379 Ga0268265_10503280 3300028380 Bacteria 1142
380 Ga0268264_10096020 3300028381 Bacteria 2566
381 Ga0268264_10202676 3300028381 Bacteria 1816
382 Ga0307408_100499703 3300031548 Bacteria 1064
383 Ga0307408_100728564 3300031548 Unclassified 894
384 Ga0307405_10197582 3300031731 Bacteria 1458
385 Ga0307413_10391682 3300031824 Bacteria 1086
386 Ga0307410_10178705 3300031852 Bacteria 1605
387 Ga0307410_10640101 3300031852 Bacteria 891
388 Ga0307410_11414308 3300031852 Bacteria 611
389 Ga0307406_11955937 3300031901 Unclassified 523
390 Ga0307412_10304083 3300031911 Bacteria 1262
391 Ga0307409_100656752 3300031995 Bacteria 1043
392 Ga0307409_100901315 3300031995 Bacteria 898
393 Ga0307416_100257623 3300032002 Bacteria 1703
394 Ga0307416_100915983 3300032002 Bacteria 977
395 Ga0307416_101861492 3300032002 Bacteria 705
396 Ga0307415_101195895 3300032126 Bacteria 716
397 Ga0373930_0176866 3300034816 Bacteria 546
398 Ga0373958_0048345 3300034819 Bacteria 892
399 Ga0373938_0141948 3300034957 Bacteria 634
400 Ga0373940_0116788 3300035088 Bacteria 824
401 Ga0373949_0003943 3300035090 Bacteria 3446
402 Ga0373949_0007754 3300035090 Bacteria 2352
403 Ga0373951_0018714 3300035091 Bacteria 1574
404 Ga0373951_0043855 3300035091 Bacteria 1085
405 Ga0373951_0056481 3300035091 Bacteria 975
406 Ga0373952_0252156 3300035092 Bacteria 535
407 Ga0373932_0072441 3300035112 Bacteria 1071
408 Ga0373932_0114056 3300035112 Bacteria 894
409 Ga0373939_0168786 3300035114 Bacteria 808
410 Ga0373960_0163024 3300035121 Bacteria 769
411 Ga0373961_0007012 3300035241 Bacteria 2713
412 Ga0373931_0002228 3300035691 Bacteria 8566
413 Ga0373931_0014296 3300035691 Bacteria 3877
414 Ga0373931_0016884 3300035691 Bacteria 3600
415 Ga0373925_0223760 3300037068 Bacteria 1503
416 Ga0395901_0581846 3300038443 Bacteria 1131
417 Ga0242420_039629 3300038996 Bacteria 897
418 Ga0242420_071388 3300038996 Bacteria 706
419 Ga0242420_113550 3300038996 Unclassified 585
420 Ga0451793_0808498 3300041452 Bacteria 698
421 Ga0439448_0085059 3300042005 Bacteria 1065
422 Ga0450892_012774 3300042130 Bacteria 760
423 Ga0439458_0002241 3300042157 Bacteria 4760
424 Ga0439435_0013810 3300042436 Bacteria 1985
425 Ga0439459_0027302 3300042438 Bacteria 1139
426 Ga0450916_024428 3300042530 Archaea 848
427 Ga0451577_0052534 3300042876 Bacteria 3638
428 Ga0451577_0129629 3300042876 Bacteria 2262
429 Ga0451577_0147755 3300042876 Bacteria 2114
430 Ga0451577_0795654 3300042876 Bacteria 854
431 Ga0439440_0058835 3300042993 Bacteria 977
432 Ga0453683_0006627 3300044673 Bacteria 7932
433 Ga0453684_0222177 3300044712 Bacteria 2187
434 Ga0453684_2028502 3300044712 Bacteria 579
435 Ga0451576_0005764 3300045051 Bacteria 15422
436 Ga0451576_0202386 3300045051 Bacteria 2074
437 Ga0451576_1167596 3300045051 Bacteria 804
438 Ga0495603_0194346 3300046455 Bacteria 1173
439 Ga0495580_0000727 3300046472 Bacteria 28206
440 Ga0495580_0194137 3300046472 Bacteria 1400
441 Ga0495584_0520556 3300046491 Unclassified 606
442 Ga0495594_0201000 3300046499 Bacteria 1136
443 Ga0495642_0003953 3300046528 Bacteria 5801
444 Ga0495642_0297417 3300046528 Bacteria 707
445 Ga0495598_0140461 3300046537 Bacteria 835
446 Ga0495659_0056697 3300046664 Bacteria 1438
447 Ga0495659_0071461 3300046664 Bacteria 1301
448 Ga0495669_0015347 3300046684 Bacteria 3280
449 Ga0495669_0103315 3300046684 Unclassified 1325
450 Ga0495670_0451062 3300046691 Bacteria 697
451 Ga0496101_0229143 3300048904 Bacteria 1444
452 Ga0496102_0025757 3300048905 Bacteria 5238
453 Ga0496102_0034348 3300048905 Bacteria 4560
454 Ga0496105_0731430 3300048908 Bacteria 757
455 Ga0496106_0081850 3300048909 Unclassified 2481
456 Ga0496106_0116979 3300048909 Bacteria 2080
457 Ga0496106_0326302 3300048909 Bacteria 1232
458 Ga0496109_0545007 3300048912 Bacteria 1094
459 Ga0496110_0144539 3300048913 Bacteria 2151
460 Ga0496110_1022548 3300048913 Bacteria 734
461 Ga0496112_0457355 3300048915 Bacteria 1214
462 Ga0496113_0141061 3300048916 Bacteria 1896
463 Ga0496113_0404058 3300048916 Bacteria 1097
464 Ga0496113_0783271 3300048916 Bacteria 758
465 Ga0501299_073823 3300049522 Unclassified 745
466 Ga0501033_0443022 3300049570 Bacteria 903
467 Ga0501034_0135000 3300049571 Bacteria 2448
468 Ga0501038_0053411 3300049574 Bacteria 3479
469 Ga0501038_0147136 3300049574 Bacteria 1923
470 Ga0501038_0312917 3300049574 Unclassified 1230
471 Ga0501038_0915208 3300049574 Bacteria 647
472 Ga0501039_0173819 3300049575 Bacteria 1694
473 Ga0501039_0225437 3300049575 Bacteria 1473
474 Ga0501039_0402937 3300049575 Bacteria 1074
475 Ga0501039_0512239 3300049575 Bacteria 942
476 Ga0501040_0026162 3300049576 Bacteria 3924
477 Ga0501040_0091918 3300049576 Bacteria 2110
478 Ga0501040_0141398 3300049576 Bacteria 1696
479 Ga0501040_0157639 3300049576 Bacteria 1603
480 Ga0501040_0543082 3300049576 Bacteria 839
481 Ga0501040_1433847 3300049576 Unclassified 501
482 Ga0501041_0084372 3300049577 Bacteria 1958
483 Ga0501041_0108514 3300049577 Bacteria 1721
484 Ga0501041_0253643 3300049577 Bacteria 1106
485 Ga0501041_0947811 3300049577 Unclassified 553
486 Ga0501042_0103837 3300049578 Bacteria 2045
487 Ga0501043_0565639 3300049579 Unclassified 843
488 Ga0501047_0631743 3300049581 Bacteria 891
489 Ga0501048_0035123 3300049582 Bacteria 3610
490 Ga0501048_0373761 3300049582 Bacteria 1017
491 Ga0501068_0076651 3300049584 Bacteria 2047
492 Ga0501068_1065086 3300049584 Bacteria 534
493 Ga0501070_0480895 3300049586 Bacteria 999
494 Ga0501071_0085807 3300049587 Bacteria 2309
495 Ga0501072_0005285 3300049588 Bacteria 9833
496 Ga0501072_0032175 3300049588 Bacteria 4108
497 Ga0501072_0106740 3300049588 Bacteria 2227
498 Ga0501072_0321762 3300049588 Bacteria 1229
499 Ga0501072_1023120 3300049588 Unclassified 644
500 Ga0501073_0486027 3300049589 Bacteria 854
501 Ga0501074_0019399 3300049590 Bacteria 4939
502 Ga0501074_0087561 3300049590 Bacteria 2230
503 Ga0501074_0178173 3300049590 Bacteria 1517
504 Ga0501074_0194015 3300049590 Bacteria 1448
505 Ga0501075_0005715 3300049591 Bacteria 8511
506 Ga0501075_0022204 3300049591 Bacteria 4633
507 Ga0501075_0075603 3300049591 Bacteria 2547
508 Ga0501076_0146698 3300049592 Bacteria 1918
509 Ga0501076_0222280 3300049592 Bacteria 1543
510 Ga0501076_0348299 3300049592 Bacteria 1216
511 Ga0501077_0005657 3300049593 Bacteria 7618
512 Ga0501077_0251614 3300049593 Bacteria 1124
513 Ga0501216_057816 3300049660 Unclassified 776
514 Ga0501257_059386 3300049686 Bacteria 965
515 Ga0501257_109623 3300049686 Bacteria 731
516 Ga0501079_0018603 3300049741 Bacteria 5307
517 Ga0501079_0154988 3300049741 Bacteria 1786
518 Ga0501079_0218002 3300049741 Bacteria 1490
519 Ga0501080_0270881 3300049742 Bacteria 1545
520 Ga0501081_0086749 3300049743 Bacteria 2197
521 Ga0501081_0126159 3300049743 Bacteria 1826
522 Ga0501283_037830 3300049779 Bacteria 828
523 Ga0501035_0550598 3300049822 Bacteria 945
524 Ga0501035_0673387 3300049822 Bacteria 837
525 Ga0501035_0890062 3300049822 Bacteria 706
526 Ga0501045_0012445 3300049824 Bacteria 5990
527 Ga0501045_0039036 3300049824 Bacteria 3455
528 Ga0501045_0108046 3300049824 Bacteria 2062
529 Ga0501045_0260857 3300049824 Bacteria 1290
530 Ga0501045_1035986 3300049824 Bacteria 601
531 nmdc:mga03683_4325_c1 3300050489 Bacteria 4696
532 nmdc:mga00v17_161908_c1 3300050491 Bacteria 1441
533 nmdc:mga0yw44_14693_c1 3300050492 Bacteria 4167
534 nmdc:mga0yw44_397008_c1 3300050492 Bacteria 932
535 nmdc:mga0k408_29325_c1 3300050493 Bacteria 3131
536 nmdc:mga0k408_388294_c1 3300050493 Bacteria 831
537 nmdc:mga06z11_11153_c1 3300050494 Bacteria 3862
538 nmdc:mga04h51_264191_c1 3300050495 Bacteria 693
539 nmdc:mga05p37_126090_c1 3300050507 Bacteria 3144
540 nmdc:mga05p37_1495108_c1 3300050507 Unclassified 673
541 nmdc:mga05p37_169024_c1 3300050507 Bacteria 2667
542 nmdc:mga05p37_188791_c1 3300050507 Bacteria 2504
543 nmdc:mga05p37_232573_c1 3300050507 Bacteria 2220
544 nmdc:mga05p37_285150_c1 3300050507 Bacteria 1968
545 nmdc:mga05p37_44172_c1 3300050507 Bacteria 5483
546 nmdc:mga05p37_445676_c1 3300050507 Bacteria 1500
547 nmdc:mga05p37_601457_c1 3300050507 Bacteria 1241
548 nmdc:mga05p37_77108_c1 3300050507 Bacteria 4103
549 nmdc:mga05p37_82072_c1 3300050507 Bacteria 3972
550 nmdc:mga05p37_92768_c1 3300050507 Bacteria 3721
551 nmdc:mga09592_1277391_c1 3300050508 Bacteria 604
552 nmdc:mga09592_1944_c1 3300050508 Bacteria 16641
553 nmdc:mga09592_51459_c1 3300050508 Bacteria 3475
554 nmdc:mga09592_5317_c1 3300050508 Bacteria 10464
555 nmdc:mga09592_62218_c1 3300050508 Bacteria 3158
556 nmdc:mga09592_70527_c1 3300050508 Bacteria 2965
557 nmdc:mga0qj67_21599_c1 3300050509 Bacteria 4938
558 nmdc:mga0qj67_24924_c1 3300050509 Bacteria 4616
559 nmdc:mga0qj67_385595_c1 3300050509 Bacteria 1131
560 nmdc:mga0qj67_61674_c1 3300050509 Bacteria 2977
561 nmdc:mga06r32_129889_c1 3300050510 Unclassified 2491
562 nmdc:mga06r32_1453367_c1 3300050510 Bacteria 627
563 nmdc:mga06r32_31833_c1 3300050510 Bacteria 4956
564 nmdc:mga06r32_3786_c1 3300050510 Bacteria 13535
565 nmdc:mga06r32_73196_c1 3300050510 Bacteria 3319
566 nmdc:mga08y16_1671183_c1 3300050511 Bacteria 593
567 nmdc:mga08y16_3252_c1 3300050511 Bacteria 16818
568 nmdc:mga08y16_4117_c1 3300050511 Bacteria 15173
569 nmdc:mga08y16_620967_c1 3300050511 Bacteria 1088
570 nmdc:mga08y16_682422_c1 3300050511 Bacteria 1029
571 nmdc:mga08y16_89595_c1 3300050511 Bacteria 3206
572 nmdc:mga0n895_116823_c1 3300050512 Bacteria 2687
573 nmdc:mga0n895_1212401_c1 3300050512 Unclassified 728
574 nmdc:mga0n895_142145_c1 3300050512 Bacteria 2429
575 nmdc:mga0n895_153195_c1 3300050512 Bacteria 2336
576 nmdc:mga0n895_2948_c1 3300050512 Bacteria 13506
577 nmdc:mga0n895_2964_c1 3300050512 Bacteria 13469
578 nmdc:mga0n895_332996_c1 3300050512 Bacteria 1538
579 nmdc:mga0n895_381987_c1 3300050512 Bacteria 1425
580 nmdc:mga0n895_69434_c1 3300050512 Bacteria 3491
581 nmdc:mga0n895_76187_c1 3300050512 Bacteria 3336
582 nmdc:mga0rr50_260551_c1 3300050513 Bacteria 1443
583 nmdc:mga0rr50_27330_c1 3300050513 Bacteria 3993
584 nmdc:mga0rr50_285729_c1 3300050513 Bacteria 1377
585 nmdc:mga0rr50_639080_c1 3300050513 Bacteria 908
586 nmdc:mga0rr50_64492_c1 3300050513 Bacteria 2771
587 nmdc:mga0rr50_72598_c1 3300050513 Bacteria 2629
588 nmdc:mga0rr50_768575_c1 3300050513 Bacteria 822
589 nmdc:mga0rr50_88492_c1 3300050513 Bacteria 2406
590 nmdc:mga08x19_20719_c1 3300050514 Bacteria 4051
591 nmdc:mga08x19_258152_c1 3300050514 Bacteria 1204
592 nmdc:mga0a205_101290_c1 3300050515 Bacteria 2779
593 nmdc:mga0a205_117013_c1 3300050515 Bacteria 2564
594 nmdc:mga0a205_1249047_c1 3300050515 Bacteria 590
595 nmdc:mga0a205_13697_c1 3300050515 Bacteria 4519
596 nmdc:mga0a205_171182_c1 3300050515 Bacteria 2068
597 nmdc:mga0a205_19058_c1 3300050515 Bacteria 6465
598 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
599 nmdc:mga0a205_29588_c1 3300050515 Bacteria 5242
600 nmdc:mga0a205_6155_c2 3300050515 Bacteria 7547
601 Ga0500628_038703 3300053129 Bacteria 1078
602 Ga0501084_0011395 3300054114 Bacteria 7362
603 Ga0501084_0038939 3300054114 Bacteria 3976
604 Ga0501084_0357875 3300054114 Bacteria 1233
605 Ga0590071_007657 3300059421 Bacteria 2553
606 Ga0590071_039690 3300059421 Bacteria 1132
607 Ga0590074_057642 3300059423 Unclassified 718
608 Ga0590074_060111 3300059423 Unclassified 705
609 Ga0590077_016885 3300059426 Bacteria 1533
610 Ga0590077_166202 3300059426 Bacteria 530
611 Ga0501082_0006260 3300060353 Bacteria 10330
612 Ga0501082_0102762 3300060353 Bacteria 2472
613 Ga0501082_0172268 3300060353 Bacteria 1882
614 Ga0501082_0760070 3300060353 Bacteria 848
615 Ga0501082_1050402 3300060353 Bacteria 712
616 Ga0501082_1200023 3300060353 Bacteria 663
617 Ga0530510_0043766 3300061734 Bacteria 3234
618 Ga0530510_0143827 3300061734 Bacteria 1758
619 Ga0530510_0720243 3300061734 Bacteria 760
620 Ga0530510_1098736 3300061734 Unclassified 609
621 Ga0530510_1101842 3300061734 Bacteria 608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0157639 Ga0501040_0157639_1276_1593 105
2 3300049593 Ga0501077_0251614 Ga0501077_0251614_769_1086 105
3 3300049822 Ga0501035_0890062 Ga0501035_0890062_348_665 105
4 3300044673 Ga0453683_0006627 Ga0453683_0006627_2944_3273 109
5 3300045051 Ga0451576_0202386 Ga0451576_0202386_512_841 109
6 3300005440 Ga0070705_100758454 Ga0070705_1007584541 112
7 3300005471 Ga0070698_101232879 Ga0070698_1012328791 112
8 3300049574 Ga0501038_0915208 Ga0501038_0915208_178_519 113
9 3300049575 Ga0501039_0173819 Ga0501039_0173819_208_549 113
10 3300049575 Ga0501039_0512239 Ga0501039_0512239_408_749 113
11 3300049576 Ga0501040_0543082 Ga0501040_0543082_484_825 113
12 3300049577 Ga0501041_0253643 Ga0501041_0253643_440_781 113
13 3300049582 Ga0501048_0373761 Ga0501048_0373761_377_718 113
14 3300049584 Ga0501068_1065086 Ga0501068_1065086_120_461 113
15 3300049588 Ga0501072_0005285 Ga0501072_0005285_118_459 113
16 3300049588 Ga0501072_0321762 Ga0501072_0321762_484_825 113
17 3300049741 Ga0501079_0154988 Ga0501079_0154988_1351_1692 113
18 3300049743 Ga0501081_0126159 Ga0501081_0126159_1269_1610 113
19 3300049824 Ga0501045_0039036 Ga0501045_0039036_924_1265 113
20 3300049824 Ga0501045_1035986 Ga0501045_1035986_192_533 113
21 3300054114 Ga0501084_0038939 Ga0501084_0038939_2000_2341 113
22 3300060353 Ga0501082_1050402 Ga0501082_1050402_224_565 113
23 3300061734 Ga0530510_0143827 Ga0530510_0143827_54_395 113
24 3300061734 Ga0530510_1101842 Ga0530510_1101842_102_443 113
25 3300050492 nmdc:mga0yw44_14693_c1 nmdc:mga0yw44_14693_c1_741_1088 114
26 3300050493 nmdc:mga0k408_388294_c1 nmdc:mga0k408_388294_c1_425_772 114
27 3300050511 nmdc:mga08y16_1671183_c1 nmdc:mga08y16_1671183_c1_51_398 114
28 3300009148 Ga0105243_10060967 Ga0105243_100609672 115
29 3300009174 Ga0105241_10001410 Ga0105241_100014105 115
30 3300009177 Ga0105248_10098036 Ga0105248_100980363 115
31 3300009545 Ga0105237_10211607 Ga0105237_102116072 115
32 3300009553 Ga0105249_10716842 Ga0105249_107168421 115
33 3300010375 Ga0105239_12007369 Ga0105239_120073691 115
34 3300011119 Ga0105246_10014486 Ga0105246_100144864 115
35 3300013100 Ga0157373_10015786 Ga0157373_100157868 115
36 3300013104 Ga0157370_10308851 Ga0157370_103088512 115
37 3300013105 Ga0157369_10059275 Ga0157369_100592752 115
38 3300013297 Ga0157378_10192904 Ga0157378_101929041 115
39 3300013306 Ga0163162_10215621 Ga0163162_102156212 115
40 3300013307 Ga0157372_10006472 Ga0157372_1000647211 115
41 3300013308 Ga0157375_10028617 Ga0157375_100286174 115
42 3300014325 Ga0163163_10057404 Ga0163163_100574045 115
43 3300015262 Ga0182007_10019299 Ga0182007_100192993 115
44 3300034819 Ga0373958_0048345 Ga0373958_0048345_415_813 115
45 3300035090 Ga0373949_0003943 Ga0373949_0003943_1166_1564 115
46 3300035091 Ga0373951_0018714 Ga0373951_0018714_89_487 115
47 3300035092 Ga0373952_0252156 Ga0373952_0252156_47_445 115
48 3300035241 Ga0373961_0007012 Ga0373961_0007012_600_998 115
49 3300038996 Ga0242420_071388 Ga0242420_071388_228_626 115
50 3300042005 Ga0439448_0085059 Ga0439448_0085059_300_698 115
51 3300042130 Ga0450892_012774 Ga0450892_012774_22_420 115
52 3300042157 Ga0439458_0002241 Ga0439458_0002241_2480_2878 115
53 3300042438 Ga0439459_0027302 Ga0439459_0027302_207_605 115
54 3300042876 Ga0451577_0052534 Ga0451577_0052534_2671_3069 115
55 3300044712 Ga0453684_0222177 Ga0453684_0222177_823_1221 115
56 3300045051 Ga0451576_0005764 Ga0451576_0005764_12414_12812 115
57 3300048905 Ga0496102_0034348 Ga0496102_0034348_2449_2847 115
58 3300048909 Ga0496106_0326302 Ga0496106_0326302_492_890 115
59 3300048913 Ga0496110_0144539 Ga0496110_0144539_1459_1857 115
60 3300048916 Ga0496113_0141061 Ga0496113_0141061_330_728 115
61 3300050507 nmdc:mga05p37_126090_c1 nmdc:mga05p37_126090_c1_763_1161 115
62 3300050513 nmdc:mga0rr50_27330_c1 nmdc:mga0rr50_27330_c1_1683_2081 115
63 3300050515 nmdc:mga0a205_19058_c1 nmdc:mga0a205_19058_c1_4573_4971 115
64 3300005616 Ga0068852_101628962 Ga0068852_1016289622 116
65 3300005617 Ga0068859_100849413 Ga0068859_1008494132 116
66 3300005618 Ga0068864_100586032 Ga0068864_1005860322 116
67 3300005841 Ga0068863_101062833 Ga0068863_1010628332 116
68 3300006931 Ga0097620_100849497 Ga0097620_1008494972 116
69 3300009094 Ga0111539_10308850 Ga0111539_103088501 116
70 3300014326 Ga0157380_11659355 Ga0157380_116593552 116
71 3300026095 Ga0207676_10843490 Ga0207676_108434902 116
72 3300027907 Ga0207428_10220260 Ga0207428_102202602 116
73 3300050511 nmdc:mga08y16_682422_c1 nmdc:mga08y16_682422_c1_47_400 116
74 3300003203 JGI25406J46586_10002893 JGI25406J46586_100028932 117
75 3300005290 Ga0065712_10003667 Ga0065712_100036676 117
76 3300005293 Ga0065715_10009447 Ga0065715_100094472 117
77 3300005293 Ga0065715_10093719 Ga0065715_100937193 117
78 3300005293 Ga0065715_10118663 Ga0065715_101186632 117
79 3300005295 Ga0065707_10207494 Ga0065707_102074942 117
80 3300005328 Ga0070676_10006734 Ga0070676_100067344 117
81 3300005329 Ga0070683_100014312 Ga0070683_1000143126 117
82 3300005331 Ga0070670_100019360 Ga0070670_1000193605 117
83 3300005331 Ga0070670_100491031 Ga0070670_1004910312 117
84 3300005334 Ga0068869_100001496 Ga0068869_10000149615 117
85 3300005334 Ga0068869_100136433 Ga0068869_1001364332 117
86 3300005334 Ga0068869_100160277 Ga0068869_1001602772 117
87 3300005334 Ga0068869_101054158 Ga0068869_1010541582 117
88 3300005336 Ga0070680_100000934 Ga0070680_10000093420 117
89 3300005336 Ga0070680_100111435 Ga0070680_1001114352 117
90 3300005336 Ga0070680_100282995 Ga0070680_1002829952 117
91 3300005337 Ga0070682_100001865 Ga0070682_10000186511 117
92 3300005338 Ga0068868_100044648 Ga0068868_1000446481 117
93 3300005338 Ga0068868_100938710 Ga0068868_1009387102 117
94 3300005339 Ga0070660_100024523 Ga0070660_1000245232 117
95 3300005340 Ga0070689_100736688 Ga0070689_1007366882 117
96 3300005340 Ga0070689_101620204 Ga0070689_1016202041 117
97 3300005341 Ga0070691_10002071 Ga0070691_100020719 117
98 3300005341 Ga0070691_10330860 Ga0070691_103308602 117
99 3300005343 Ga0070687_100140453 Ga0070687_1001404533 117
100 3300005343 Ga0070687_100330650 Ga0070687_1003306502 117
101 3300005344 Ga0070661_100000211 Ga0070661_10000021110 117
102 3300005345 Ga0070692_10002475 Ga0070692_100024756 117
103 3300005345 Ga0070692_10368949 Ga0070692_103689491 117
104 3300005345 Ga0070692_10535573 Ga0070692_105355731 117
105 3300005347 Ga0070668_100079796 Ga0070668_1000797963 117
106 3300005347 Ga0070668_100160833 Ga0070668_1001608332 117
107 3300005347 Ga0070668_100391262 Ga0070668_1003912621 117
108 3300005353 Ga0070669_100019045 Ga0070669_1000190452 117
109 3300005353 Ga0070669_100020540 Ga0070669_1000205404 117
110 3300005353 Ga0070669_100088728 Ga0070669_1000887282 117
111 3300005354 Ga0070675_100309347 Ga0070675_1003093471 117
112 3300005355 Ga0070671_101362795 Ga0070671_1013627951 117
113 3300005364 Ga0070673_100022870 Ga0070673_1000228703 117
114 3300005364 Ga0070673_101392182 Ga0070673_1013921822 117
115 3300005365 Ga0070688_101703130 Ga0070688_1017031302 117
116 3300005366 Ga0070659_100001505 Ga0070659_1000015058 117
117 3300005366 Ga0070659_100876943 Ga0070659_1008769432 117
118 3300005367 Ga0070667_100088984 Ga0070667_1000889843 117
119 3300005367 Ga0070667_100993799 Ga0070667_1009937992 117
120 3300005406 Ga0070703_10028898 Ga0070703_100288982 117
121 3300005406 Ga0070703_10114460 Ga0070703_101144602 117
122 3300005406 Ga0070703_10213748 Ga0070703_102137482 117
123 3300005406 Ga0070703_10389540 Ga0070703_103895401 117
124 3300005438 Ga0070701_10490662 Ga0070701_104906622 117
125 3300005438 Ga0070701_10637470 Ga0070701_106374701 117
126 3300005439 Ga0070711_100337382 Ga0070711_1003373822 117
127 3300005440 Ga0070705_100005391 Ga0070705_10000539110 117
128 3300005440 Ga0070705_100018832 Ga0070705_1000188322 117
129 3300005440 Ga0070705_100161089 Ga0070705_1001610893 117
130 3300005440 Ga0070705_100767238 Ga0070705_1007672381 117
131 3300005441 Ga0070700_100247920 Ga0070700_1002479201 117
132 3300005444 Ga0070694_100003319 Ga0070694_1000033198 117
133 3300005444 Ga0070694_100021019 Ga0070694_1000210192 117
134 3300005444 Ga0070694_100196049 Ga0070694_1001960492 117
135 3300005444 Ga0070694_100551631 Ga0070694_1005516312 117
136 3300005444 Ga0070694_100994426 Ga0070694_1009944262 117
137 3300005445 Ga0070708_100201245 Ga0070708_1002012451 117
138 3300005445 Ga0070708_100400239 Ga0070708_1004002391 117
139 3300005445 Ga0070708_100875009 Ga0070708_1008750092 117
140 3300005445 Ga0070708_100900046 Ga0070708_1009000461 117
141 3300005445 Ga0070708_101080412 Ga0070708_1010804122 117
142 3300005455 Ga0070663_100026467 Ga0070663_1000264672 117
143 3300005457 Ga0070662_100286622 Ga0070662_1002866221 117
144 3300005457 Ga0070662_100638521 Ga0070662_1006385212 117
145 3300005458 Ga0070681_10062390 Ga0070681_100623905 117
146 3300005458 Ga0070681_10247040 Ga0070681_102470401 117
147 3300005459 Ga0068867_100006675 Ga0068867_1000066752 117
148 3300005459 Ga0068867_100283723 Ga0068867_1002837233 117
149 3300005459 Ga0068867_100475128 Ga0068867_1004751282 117
150 3300005459 Ga0068867_101650454 Ga0068867_1016504541 117
151 3300005467 Ga0070706_100035858 Ga0070706_1000358583 117
152 3300005467 Ga0070706_100095440 Ga0070706_1000954403 117
153 3300005467 Ga0070706_100832164 Ga0070706_1008321642 117
154 3300005467 Ga0070706_100949681 Ga0070706_1009496811 117
155 3300005468 Ga0070707_100076882 Ga0070707_1000768824 117
156 3300005468 Ga0070707_100231760 Ga0070707_1002317602 117
157 3300005468 Ga0070707_100646572 Ga0070707_1006465722 117
158 3300005468 Ga0070707_100832395 Ga0070707_1008323952 117
159 3300005468 Ga0070707_101085066 Ga0070707_1010850662 117
160 3300005471 Ga0070698_100035071 Ga0070698_1000350714 117
161 3300005471 Ga0070698_100195389 Ga0070698_1001953891 117
162 3300005471 Ga0070698_101036465 Ga0070698_1010364652 117
163 3300005518 Ga0070699_100008025 Ga0070699_1000080259 117
164 3300005518 Ga0070699_100064987 Ga0070699_1000649874 117
165 3300005518 Ga0070699_100091594 Ga0070699_1000915944 117
166 3300005518 Ga0070699_100541622 Ga0070699_1005416221 117
167 3300005530 Ga0070679_100008274 Ga0070679_10000827412 117
168 3300005535 Ga0070684_100072662 Ga0070684_1000726623 117
169 3300005536 Ga0070697_100008644 Ga0070697_1000086443 117
170 3300005536 Ga0070697_100085434 Ga0070697_1000854342 117
171 3300005536 Ga0070697_100139504 Ga0070697_1001395042 117
172 3300005536 Ga0070697_100248301 Ga0070697_1002483013 117
173 3300005536 Ga0070697_100883483 Ga0070697_1008834831 117
174 3300005536 Ga0070697_100980987 Ga0070697_1009809871 117
175 3300005536 Ga0070697_101228978 Ga0070697_1012289781 117
176 3300005539 Ga0068853_100000678 Ga0068853_10000067820 117
177 3300005539 Ga0068853_101244189 Ga0068853_1012441892 117
178 3300005539 Ga0068853_101876163 Ga0068853_1018761632 117
179 3300005543 Ga0070672_100050763 Ga0070672_1000507632 117
180 3300005543 Ga0070672_100176944 Ga0070672_1001769443 117
181 3300005544 Ga0070686_100448179 Ga0070686_1004481792 117
182 3300005544 Ga0070686_100933752 Ga0070686_1009337522 117
183 3300005545 Ga0070695_100002498 Ga0070695_1000024981 117
184 3300005545 Ga0070695_100005383 Ga0070695_1000053834 117
185 3300005545 Ga0070695_100199280 Ga0070695_1001992802 117
186 3300005545 Ga0070695_100224007 Ga0070695_1002240073 117
187 3300005546 Ga0070696_100091216 Ga0070696_1000912162 117
188 3300005546 Ga0070696_100335766 Ga0070696_1003357662 117
189 3300005546 Ga0070696_100769995 Ga0070696_1007699952 117
190 3300005546 Ga0070696_101158797 Ga0070696_1011587972 117
191 3300005547 Ga0070693_100000189 Ga0070693_10000018919 117
192 3300005547 Ga0070693_100214766 Ga0070693_1002147662 117
193 3300005549 Ga0070704_100001133 Ga0070704_1000011339 117
194 3300005549 Ga0070704_100006591 Ga0070704_1000065914 117
195 3300005549 Ga0070704_100226172 Ga0070704_1002261722 117
196 3300005549 Ga0070704_100295349 Ga0070704_1002953492 117
197 3300005549 Ga0070704_100330325 Ga0070704_1003303252 117
198 3300005563 Ga0068855_100015121 Ga0068855_1000151219 117
199 3300005563 Ga0068855_100967163 Ga0068855_1009671632 117
200 3300005564 Ga0070664_100012522 Ga0070664_1000125223 117
201 3300005564 Ga0070664_100445210 Ga0070664_1004452102 117
202 3300005577 Ga0068857_100046341 Ga0068857_1000463414 117
203 3300005578 Ga0068854_100002061 Ga0068854_1000020617 117
204 3300005614 Ga0068856_100008288 Ga0068856_10000828810 117
205 3300005615 Ga0070702_100191925 Ga0070702_1001919253 117
206 3300005617 Ga0068859_100906665 Ga0068859_1009066652 117
207 3300005618 Ga0068864_100021673 Ga0068864_1000216731 117
208 3300005618 Ga0068864_100206245 Ga0068864_1002062452 117
209 3300005618 Ga0068864_100332396 Ga0068864_1003323962 117
210 3300005718 Ga0068866_10161459 Ga0068866_101614592 117
211 3300005719 Ga0068861_100006876 Ga0068861_1000068769 117
212 3300005719 Ga0068861_100291751 Ga0068861_1002917512 117
213 3300005719 Ga0068861_100772554 Ga0068861_1007725542 117
214 3300005840 Ga0068870_10007619 Ga0068870_100076194 117
215 3300005840 Ga0068870_10626455 Ga0068870_106264552 117
216 3300005841 Ga0068863_100005815 Ga0068863_10000581510 117
217 3300005841 Ga0068863_100168455 Ga0068863_1001684553 117
218 3300005841 Ga0068863_100314327 Ga0068863_1003143272 117
219 3300005842 Ga0068858_100076039 Ga0068858_1000760392 117
220 3300005843 Ga0068860_100004587 Ga0068860_10000458711 117
221 3300005843 Ga0068860_100042805 Ga0068860_1000428056 117
222 3300005843 Ga0068860_100231057 Ga0068860_1002310573 117
223 3300005844 Ga0068862_100015431 Ga0068862_1000154318 117
224 3300005844 Ga0068862_100117879 Ga0068862_1001178795 117
225 3300005844 Ga0068862_101286944 Ga0068862_1012869441 117
226 3300005844 Ga0068862_101617789 Ga0068862_1016177891 117
227 3300005937 Ga0081455_10022244 Ga0081455_100222447 117
228 3300005985 Ga0081539_10000096 Ga0081539_1000009694 117
229 3300006038 Ga0075365_10025483 Ga0075365_100254831 117
230 3300006038 Ga0075365_10321702 Ga0075365_103217022 117
231 3300006038 Ga0075365_10322661 Ga0075365_103226612 117
232 3300006051 Ga0075364_10029608 Ga0075364_100296085 117
233 3300006051 Ga0075364_10217964 Ga0075364_102179642 117
234 3300006058 Ga0075432_10416544 Ga0075432_104165441 117
235 3300006175 Ga0070712_100018868 Ga0070712_1000188685 117
236 3300006177 Ga0075362_10000233 Ga0075362_1000023312 117
237 3300006178 Ga0075367_10533041 Ga0075367_105330412 117
238 3300006195 Ga0075366_10039306 Ga0075366_100393062 117
239 3300006195 Ga0075366_10826849 Ga0075366_108268492 117
240 3300006237 Ga0097621_100444164 Ga0097621_1004441642 117
241 3300006844 Ga0075428_100003167 Ga0075428_1000031679 117
242 3300006844 Ga0075428_100026308 Ga0075428_1000263084 117
243 3300006844 Ga0075428_100115170 Ga0075428_1001151704 117
244 3300006844 Ga0075428_100136489 Ga0075428_1001364892 117
245 3300006844 Ga0075428_100900045 Ga0075428_1009000452 117
246 3300006844 Ga0075428_101425780 Ga0075428_1014257802 117
247 3300006846 Ga0075430_100000404 Ga0075430_1000004046 117
248 3300006846 Ga0075430_100044512 Ga0075430_1000445124 117
249 3300006846 Ga0075430_100143064 Ga0075430_1001430641 117
250 3300006846 Ga0075430_100269876 Ga0075430_1002698762 117
251 3300006847 Ga0075431_100000082 Ga0075431_10000008219 117
252 3300006847 Ga0075431_100001936 Ga0075431_10000193611 117
253 3300006847 Ga0075431_100049839 Ga0075431_1000498396 117
254 3300006847 Ga0075431_100338939 Ga0075431_1003389392 117
255 3300006847 Ga0075431_101165949 Ga0075431_1011659492 117
256 3300006852 Ga0075433_10000427 Ga0075433_1000042730 117
257 3300006852 Ga0075433_10010989 Ga0075433_100109897 117
258 3300006852 Ga0075433_10034070 Ga0075433_100340705 117
259 3300006852 Ga0075433_10039794 Ga0075433_100397944 117
260 3300006852 Ga0075433_10069763 Ga0075433_100697633 117
261 3300006852 Ga0075433_10075186 Ga0075433_100751864 117
262 3300006852 Ga0075433_10252706 Ga0075433_102527063 117
263 3300006852 Ga0075433_10358859 Ga0075433_103588592 117
264 3300006871 Ga0075434_100000180 Ga0075434_1000001808 117
265 3300006871 Ga0075434_100104105 Ga0075434_1001041054 117
266 3300006871 Ga0075434_100162184 Ga0075434_1001621842 117
267 3300006871 Ga0075434_100224438 Ga0075434_1002244383 117
268 3300006871 Ga0075434_100279243 Ga0075434_1002792433 117
269 3300006871 Ga0075434_100545263 Ga0075434_1005452632 117
270 3300006871 Ga0075434_100957100 Ga0075434_1009571002 117
271 3300006871 Ga0075434_101172210 Ga0075434_1011722102 117
272 3300006880 Ga0075429_100002106 Ga0075429_1000021068 117
273 3300006880 Ga0075429_100002856 Ga0075429_1000028565 117
274 3300006880 Ga0075429_100016759 Ga0075429_1000167594 117
275 3300006880 Ga0075429_100031684 Ga0075429_1000316842 117
276 3300006880 Ga0075429_100127202 Ga0075429_1001272023 117
277 3300006881 Ga0068865_100286646 Ga0068865_1002866462 117
278 3300006914 Ga0075436_100023165 Ga0075436_1000231653 117
279 3300006914 Ga0075436_100034917 Ga0075436_1000349174 117
280 3300006914 Ga0075436_100286513 Ga0075436_1002865133 117
281 3300006931 Ga0097620_100906662 Ga0097620_1009066622 117
282 3300007076 Ga0075435_100045243 Ga0075435_1000452434 117
283 3300007076 Ga0075435_100059789 Ga0075435_1000597892 117
284 3300007076 Ga0075435_100067064 Ga0075435_1000670643 117
285 3300007076 Ga0075435_100069510 Ga0075435_1000695103 117
286 3300007076 Ga0075435_100161323 Ga0075435_1001613234 117
287 3300007076 Ga0075435_100241170 Ga0075435_1002411702 117
288 3300007076 Ga0075435_100488659 Ga0075435_1004886592 117
289 3300007076 Ga0075435_100637335 Ga0075435_1006373352 117
290 3300007076 Ga0075435_101232754 Ga0075435_1012327542 117
291 3300007265 Ga0099794_10011283 Ga0099794_100112832 117
292 3300007265 Ga0099794_10038325 Ga0099794_100383254 117
293 3300007265 Ga0099794_10359180 Ga0099794_103591802 117
294 3300007265 Ga0099794_10430881 Ga0099794_104308812 117
295 3300009094 Ga0111539_10001292 Ga0111539_1000129219 117
296 3300009094 Ga0111539_10001353 Ga0111539_1000135324 117
297 3300009094 Ga0111539_10012644 Ga0111539_100126444 117
298 3300009094 Ga0111539_10586624 Ga0111539_105866242 117
299 3300009094 Ga0111539_10695151 Ga0111539_106951512 117
300 3300009147 Ga0114129_10000110 Ga0114129_1000011043 117
301 3300009147 Ga0114129_10086949 Ga0114129_100869492 117
302 3300009147 Ga0114129_10096779 Ga0114129_100967792 117
303 3300009147 Ga0114129_10106434 Ga0114129_101064343 117
304 3300009147 Ga0114129_10202186 Ga0114129_102021864 117
305 3300009147 Ga0114129_10321107 Ga0114129_103211073 117
306 3300009147 Ga0114129_10657937 Ga0114129_106579372 117
307 3300009147 Ga0114129_11189838 Ga0114129_111898382 117
308 3300009147 Ga0114129_11219606 Ga0114129_112196062 117
309 3300009147 Ga0114129_11671934 Ga0114129_116719342 117
310 3300009147 Ga0114129_12576384 Ga0114129_125763841 117
311 3300009147 Ga0114129_13026216 Ga0114129_130262161 117
312 3300009148 Ga0105243_11799387 Ga0105243_117993871 117
313 3300009176 Ga0105242_10623388 Ga0105242_106233882 117
314 3300009553 Ga0105249_10813350 Ga0105249_108133502 117
315 3300009553 Ga0105249_12452720 Ga0105249_124527201 117
316 3300010375 Ga0105239_10952802 Ga0105239_109528022 117
317 3300013102 Ga0157371_10234753 Ga0157371_102347533 117
318 3300013297 Ga0157378_10135169 Ga0157378_101351692 117
319 3300013306 Ga0163162_10036717 Ga0163162_100367176 117
320 3300013308 Ga0157375_10803431 Ga0157375_108034312 117
321 3300014325 Ga0163163_11491609 Ga0163163_114916092 117
322 3300014326 Ga0157380_10643578 Ga0157380_106435782 117
323 3300014326 Ga0157380_10894460 Ga0157380_108944601 117
324 3300014326 Ga0157380_11200699 Ga0157380_112006991 117
325 3300014326 Ga0157380_12434014 Ga0157380_124340141 117
326 3300025885 Ga0207653_10001516 Ga0207653_100015162 117
327 3300025899 Ga0207642_10159378 Ga0207642_101593783 117
328 3300025904 Ga0207647_10032509 Ga0207647_100325092 117
329 3300025904 Ga0207647_10114886 Ga0207647_101148862 117
330 3300025904 Ga0207647_10126024 Ga0207647_101260242 117
331 3300025907 Ga0207645_10000400 Ga0207645_1000040021 117
332 3300025908 Ga0207643_10000424 Ga0207643_1000042416 117
333 3300025910 Ga0207684_10040466 Ga0207684_100404661 117
334 3300025910 Ga0207684_10067040 Ga0207684_100670405 117
335 3300025910 Ga0207684_10168420 Ga0207684_101684202 117
336 3300025910 Ga0207684_10668124 Ga0207684_106681242 117
337 3300025911 Ga0207654_10002440 Ga0207654_100024405 117
338 3300025911 Ga0207654_11033238 Ga0207654_110332381 117
339 3300025912 Ga0207707_10000116 Ga0207707_1000011637 117
340 3300025912 Ga0207707_10068879 Ga0207707_100688795 117
341 3300025912 Ga0207707_11078509 Ga0207707_110785092 117
342 3300025915 Ga0207693_10141026 Ga0207693_101410263 117
343 3300025916 Ga0207663_10161883 Ga0207663_101618832 117
344 3300025917 Ga0207660_10003214 Ga0207660_1000321412 117
345 3300025917 Ga0207660_10111790 Ga0207660_101117902 117
346 3300025917 Ga0207660_10516419 Ga0207660_105164192 117
347 3300025919 Ga0207657_10000211 Ga0207657_1000021126 117
348 3300025920 Ga0207649_10001872 Ga0207649_1000187212 117
349 3300025921 Ga0207652_10003841 Ga0207652_100038411 117
350 3300025922 Ga0207646_10021998 Ga0207646_100219984 117
351 3300025922 Ga0207646_10082210 Ga0207646_100822103 117
352 3300025922 Ga0207646_10316445 Ga0207646_103164451 117
353 3300025922 Ga0207646_11245015 Ga0207646_112450152 117
354 3300025923 Ga0207681_10040372 Ga0207681_100403722 117
355 3300025925 Ga0207650_10005754 Ga0207650_100057546 117
356 3300025927 Ga0207687_10537379 Ga0207687_105373792 117
357 3300025931 Ga0207644_10069716 Ga0207644_100697163 117
358 3300025932 Ga0207690_10001495 Ga0207690_1000149514 117
359 3300025932 Ga0207690_10708204 Ga0207690_107082042 117
360 3300025933 Ga0207706_10002411 Ga0207706_1000241120 117
361 3300025933 Ga0207706_10243256 Ga0207706_102432562 117
362 3300025935 Ga0207709_10068840 Ga0207709_100688403 117
363 3300025936 Ga0207670_10198564 Ga0207670_101985642 117
364 3300025936 Ga0207670_10241411 Ga0207670_102414113 117
365 3300025938 Ga0207704_10223450 Ga0207704_102234502 117
366 3300025938 Ga0207704_10439741 Ga0207704_104397412 117
367 3300025938 Ga0207704_10831932 Ga0207704_108319321 117
368 3300025940 Ga0207691_10009557 Ga0207691_100095574 117
369 3300025940 Ga0207691_10044674 Ga0207691_100446743 117
370 3300025941 Ga0207711_11213804 Ga0207711_112138042 117
371 3300025941 Ga0207711_11454070 Ga0207711_114540702 117
372 3300025942 Ga0207689_10000201 Ga0207689_1000020137 117
373 3300025942 Ga0207689_10006142 Ga0207689_100061422 117
374 3300025942 Ga0207689_10487208 Ga0207689_104872082 117
375 3300025942 Ga0207689_11358503 Ga0207689_113585031 117
376 3300025944 Ga0207661_10116000 Ga0207661_101160002 117
377 3300025949 Ga0207667_10000342 Ga0207667_1000034210 117
378 3300025960 Ga0207651_10256909 Ga0207651_102569092 117
379 3300025961 Ga0207712_10193760 Ga0207712_101937603 117
380 3300025961 Ga0207712_10540514 Ga0207712_105405142 117
381 3300025961 Ga0207712_10624758 Ga0207712_106247582 117
382 3300025961 Ga0207712_11248727 Ga0207712_112487272 117
383 3300025972 Ga0207668_10168930 Ga0207668_101689302 117
384 3300025981 Ga0207640_10005238 Ga0207640_100052384 117
385 3300025986 Ga0207658_11099868 Ga0207658_110998682 117
386 3300026023 Ga0207677_10046871 Ga0207677_100468715 117
387 3300026023 Ga0207677_11520584 Ga0207677_115205842 117
388 3300026035 Ga0207703_11282773 Ga0207703_112827731 117
389 3300026041 Ga0207639_10010274 Ga0207639_100102745 117
390 3300026041 Ga0207639_12241353 Ga0207639_122413531 117
391 3300026067 Ga0207678_10038622 Ga0207678_100386226 117
392 3300026075 Ga0207708_10342509 Ga0207708_103425091 117
393 3300026075 Ga0207708_10511633 Ga0207708_105116331 117
394 3300026078 Ga0207702_10001143 Ga0207702_1000114315 117
395 3300026088 Ga0207641_10032523 Ga0207641_100325236 117
396 3300026088 Ga0207641_10193852 Ga0207641_101938523 117
397 3300026088 Ga0207641_10555201 Ga0207641_105552012 117
398 3300026088 Ga0207641_10662907 Ga0207641_106629072 117
399 3300026089 Ga0207648_10027633 Ga0207648_100276336 117
400 3300026089 Ga0207648_10106824 Ga0207648_101068242 117
401 3300026089 Ga0207648_10230014 Ga0207648_102300142 117
402 3300026089 Ga0207648_11453338 Ga0207648_114533382 117
403 3300026095 Ga0207676_10009069 Ga0207676_100090696 117
404 3300026095 Ga0207676_10158776 Ga0207676_101587762 117
405 3300026116 Ga0207674_10000951 Ga0207674_1000095119 117
406 3300026118 Ga0207675_100025354 Ga0207675_1000253543 117
407 3300026118 Ga0207675_100135871 Ga0207675_1001358711 117
408 3300026118 Ga0207675_100323798 Ga0207675_1003237982 117
409 3300026118 Ga0207675_100366788 Ga0207675_1003667882 117
410 3300026118 Ga0207675_100575684 Ga0207675_1005756842 117
411 3300026118 Ga0207675_100873446 Ga0207675_1008734461 117
412 3300027471 Ga0209995_1000169 Ga0209995_10001696 117
413 3300027665 Ga0209983_1060072 Ga0209983_10600722 117
414 3300027671 Ga0209588_1004754 Ga0209588_10047545 117
415 3300027671 Ga0209588_1036728 Ga0209588_10367283 117
416 3300027682 Ga0209971_1011663 Ga0209971_10116634 117
417 3300027695 Ga0209966_1013125 Ga0209966_10131252 117
418 3300027866 Ga0209813_10235709 Ga0209813_102357092 117
419 3300027876 Ga0209974_10138703 Ga0209974_101387032 117
420 3300027907 Ga0207428_10000027 Ga0207428_10000027189 117
421 3300027907 Ga0207428_10007638 Ga0207428_100076386 117
422 3300027907 Ga0207428_10074725 Ga0207428_100747253 117
423 3300028380 Ga0268265_10059441 Ga0268265_100594415 117
424 3300028380 Ga0268265_10265627 Ga0268265_102656273 117
425 3300028380 Ga0268265_10503280 Ga0268265_105032802 117
426 3300028381 Ga0268264_10096020 Ga0268264_100960205 117
427 3300028381 Ga0268264_10202676 Ga0268264_102026762 117
428 3300031548 Ga0307408_100499703 Ga0307408_1004997032 117
429 3300031548 Ga0307408_100728564 Ga0307408_1007285642 117
430 3300031731 Ga0307405_10197582 Ga0307405_101975822 117
431 3300031824 Ga0307413_10391682 Ga0307413_103916822 117
432 3300031852 Ga0307410_10178705 Ga0307410_101787052 117
433 3300031852 Ga0307410_10640101 Ga0307410_106401011 117
434 3300031852 Ga0307410_11414308 Ga0307410_114143081 117
435 3300031901 Ga0307406_11955937 Ga0307406_119559371 117
436 3300031911 Ga0307412_10304083 Ga0307412_103040833 117
437 3300031995 Ga0307409_100656752 Ga0307409_1006567522 117
438 3300031995 Ga0307409_100901315 Ga0307409_1009013152 117
439 3300032002 Ga0307416_100257623 Ga0307416_1002576232 117
440 3300032002 Ga0307416_100915983 Ga0307416_1009159832 117
441 3300032002 Ga0307416_101861492 Ga0307416_1018614922 117
442 3300032126 Ga0307415_101195895 Ga0307415_1011958952 117
443 3300034816 Ga0373930_0176866 Ga0373930_0176866_114_467 117
444 3300034957 Ga0373938_0141948 Ga0373938_0141948_197_607 117
445 3300035088 Ga0373940_0116788 Ga0373940_0116788_244_597 117
446 3300035090 Ga0373949_0007754 Ga0373949_0007754_471_824 117
447 3300035091 Ga0373951_0043855 Ga0373951_0043855_566_919 117
448 3300035091 Ga0373951_0056481 Ga0373951_0056481_421_831 117
449 3300035112 Ga0373932_0072441 Ga0373932_0072441_515_868 117
450 3300035112 Ga0373932_0114056 Ga0373932_0114056_72_482 117
451 3300035114 Ga0373939_0168786 Ga0373939_0168786_367_720 117
452 3300035121 Ga0373960_0163024 Ga0373960_0163024_279_632 117
453 3300035691 Ga0373931_0002228 Ga0373931_0002228_944_1354 117
454 3300035691 Ga0373931_0014296 Ga0373931_0014296_1648_2001 117
455 3300035691 Ga0373931_0016884 Ga0373931_0016884_1723_2076 117
456 3300037068 Ga0373925_0223760 Ga0373925_0223760_836_1189 117
457 3300038443 Ga0395901_0581846 Ga0395901_0581846_35_388 117
458 3300038996 Ga0242420_039629 Ga0242420_039629_44_397 117
459 3300038996 Ga0242420_113550 Ga0242420_113550_145_498 117
460 3300041452 Ga0451793_0808498 Ga0451793_0808498_304_657 117
461 3300042436 Ga0439435_0013810 Ga0439435_0013810_1438_1848 117
462 3300042530 Ga0450916_024428 Ga0450916_024428_61_420 117
463 3300042876 Ga0451577_0129629 Ga0451577_0129629_1323_1733 117
464 3300042876 Ga0451577_0147755 Ga0451577_0147755_330_683 117
465 3300042876 Ga0451577_0795654 Ga0451577_0795654_61_414 117
466 3300042993 Ga0439440_0058835 Ga0439440_0058835_271_630 117
467 3300044712 Ga0453684_2028502 Ga0453684_2028502_167_520 117
468 3300045051 Ga0451576_1167596 Ga0451576_1167596_18_371 117
469 3300046455 Ga0495603_0194346 Ga0495603_0194346_158_511 117
470 3300046472 Ga0495580_0000727 Ga0495580_0000727_2414_2767 117
471 3300046472 Ga0495580_0194137 Ga0495580_0194137_450_803 117
472 3300046491 Ga0495584_0520556 Ga0495584_0520556_137_490 117
473 3300046499 Ga0495594_0201000 Ga0495594_0201000_564_917 117
474 3300046528 Ga0495642_0003953 Ga0495642_0003953_2385_2738 117
475 3300046528 Ga0495642_0297417 Ga0495642_0297417_73_426 117
476 3300046537 Ga0495598_0140461 Ga0495598_0140461_313_666 117
477 3300046664 Ga0495659_0056697 Ga0495659_0056697_1046_1399 117
478 3300046664 Ga0495659_0071461 Ga0495659_0071461_211_564 117
479 3300046684 Ga0495669_0015347 Ga0495669_0015347_2482_2835 117
480 3300046684 Ga0495669_0103315 Ga0495669_0103315_946_1299 117
481 3300046691 Ga0495670_0451062 Ga0495670_0451062_140_493 117
482 3300048904 Ga0496101_0229143 Ga0496101_0229143_412_765 117
483 3300048905 Ga0496102_0025757 Ga0496102_0025757_2743_3153 117
484 3300048908 Ga0496105_0731430 Ga0496105_0731430_203_556 117
485 3300048909 Ga0496106_0081850 Ga0496106_0081850_191_544 117
486 3300048909 Ga0496106_0116979 Ga0496106_0116979_101_511 117
487 3300048912 Ga0496109_0545007 Ga0496109_0545007_198_554 117
488 3300048913 Ga0496110_1022548 Ga0496110_1022548_274_645 117
489 3300048915 Ga0496112_0457355 Ga0496112_0457355_738_1094 117
490 3300048916 Ga0496113_0404058 Ga0496113_0404058_460_831 117
491 3300048916 Ga0496113_0783271 Ga0496113_0783271_185_541 117
492 3300049522 Ga0501299_073823 Ga0501299_073823_171_524 117
493 3300049570 Ga0501033_0443022 Ga0501033_0443022_227_583 117
494 3300049571 Ga0501034_0135000 Ga0501034_0135000_487_879 117
495 3300049574 Ga0501038_0053411 Ga0501038_0053411_79_435 117
496 3300049574 Ga0501038_0147136 Ga0501038_0147136_224_580 117
497 3300049574 Ga0501038_0312917 Ga0501038_0312917_663_1016 117
498 3300049575 Ga0501039_0225437 Ga0501039_0225437_690_1046 117
499 3300049575 Ga0501039_0402937 Ga0501039_0402937_369_755 117
500 3300049576 Ga0501040_0026162 Ga0501040_0026162_1819_2175 117
501 3300049576 Ga0501040_0091918 Ga0501040_0091918_650_1003 117
502 3300049576 Ga0501040_0141398 Ga0501040_0141398_97_483 117
503 3300049576 Ga0501040_1433847 Ga0501040_1433847_108_467 117
504 3300049577 Ga0501041_0084372 Ga0501041_0084372_1427_1783 117
505 3300049577 Ga0501041_0108514 Ga0501041_0108514_164_520 117
506 3300049577 Ga0501041_0947811 Ga0501041_0947811_101_454 117
507 3300049578 Ga0501042_0103837 Ga0501042_0103837_1026_1379 117
508 3300049579 Ga0501043_0565639 Ga0501043_0565639_158_550 117
509 3300049581 Ga0501047_0631743 Ga0501047_0631743_94_486 117
510 3300049582 Ga0501048_0035123 Ga0501048_0035123_527_883 117
511 3300049584 Ga0501068_0076651 Ga0501068_0076651_245_601 117
512 3300049586 Ga0501070_0480895 Ga0501070_0480895_256_612 117
513 3300049587 Ga0501071_0085807 Ga0501071_0085807_1391_1777 117
514 3300049588 Ga0501072_0032175 Ga0501072_0032175_3509_3865 117
515 3300049588 Ga0501072_0106740 Ga0501072_0106740_1665_2051 117
516 3300049588 Ga0501072_1023120 Ga0501072_1023120_58_411 117
517 3300049589 Ga0501073_0486027 Ga0501073_0486027_416_808 117
518 3300049590 Ga0501074_0019399 Ga0501074_0019399_1009_1365 117
519 3300049590 Ga0501074_0087561 Ga0501074_0087561_661_1017 117
520 3300049590 Ga0501074_0178173 Ga0501074_0178173_758_1150 117
521 3300049590 Ga0501074_0194015 Ga0501074_0194015_810_1196 117
522 3300049591 Ga0501075_0005715 Ga0501075_0005715_7079_7435 117
523 3300049591 Ga0501075_0022204 Ga0501075_0022204_1591_1947 117
524 3300049591 Ga0501075_0075603 Ga0501075_0075603_330_683 117
525 3300049592 Ga0501076_0146698 Ga0501076_0146698_245_601 117
526 3300049592 Ga0501076_0222280 Ga0501076_0222280_613_969 117
527 3300049592 Ga0501076_0348299 Ga0501076_0348299_814_1167 117
528 3300049593 Ga0501077_0005657 Ga0501077_0005657_420_776 117
529 3300049660 Ga0501216_057816 Ga0501216_057816_380_733 117
530 3300049686 Ga0501257_059386 Ga0501257_059386_31_387 117
531 3300049686 Ga0501257_109623 Ga0501257_109623_107_460 117
532 3300049741 Ga0501079_0018603 Ga0501079_0018603_4527_4883 117
533 3300049741 Ga0501079_0218002 Ga0501079_0218002_245_601 117
534 3300049742 Ga0501080_0270881 Ga0501080_0270881_781_1137 117
535 3300049743 Ga0501081_0086749 Ga0501081_0086749_1757_2113 117
536 3300049779 Ga0501283_037830 Ga0501283_037830_101_457 117
537 3300049822 Ga0501035_0550598 Ga0501035_0550598_29_382 117
538 3300049822 Ga0501035_0673387 Ga0501035_0673387_230_586 117
539 3300049824 Ga0501045_0012445 Ga0501045_0012445_2844_3200 117
540 3300049824 Ga0501045_0108046 Ga0501045_0108046_1242_1595 117
541 3300049824 Ga0501045_0260857 Ga0501045_0260857_812_1165 117
542 3300050489 nmdc:mga03683_4325_c1 nmdc:mga03683_4325_c1_3400_3756 117
543 3300050491 nmdc:mga00v17_161908_c1 nmdc:mga00v17_161908_c1_19_375 117
544 3300050492 nmdc:mga0yw44_397008_c1 nmdc:mga0yw44_397008_c1_50_415 117
545 3300050493 nmdc:mga0k408_29325_c1 nmdc:mga0k408_29325_c1_1523_1879 117
546 3300050494 nmdc:mga06z11_11153_c1 nmdc:mga06z11_11153_c1_1122_1478 117
547 3300050495 nmdc:mga04h51_264191_c1 nmdc:mga04h51_264191_c1_228_584 117
548 3300050507 nmdc:mga05p37_1495108_c1 nmdc:mga05p37_1495108_c1_97_450 117
549 3300050507 nmdc:mga05p37_169024_c1 nmdc:mga05p37_169024_c1_2152_2505 117
550 3300050507 nmdc:mga05p37_188791_c1 nmdc:mga05p37_188791_c1_2018_2371 117
551 3300050507 nmdc:mga05p37_232573_c1 nmdc:mga05p37_232573_c1_1655_2008 117
552 3300050507 nmdc:mga05p37_285150_c1 nmdc:mga05p37_285150_c1_852_1205 117
553 3300050507 nmdc:mga05p37_44172_c1 nmdc:mga05p37_44172_c1_1194_1547 117
554 3300050507 nmdc:mga05p37_445676_c1 nmdc:mga05p37_445676_c1_408_761 117
555 3300050507 nmdc:mga05p37_601457_c1 nmdc:mga05p37_601457_c1_547_903 117
556 3300050507 nmdc:mga05p37_77108_c1 nmdc:mga05p37_77108_c1_2968_3324 117
557 3300050507 nmdc:mga05p37_82072_c1 nmdc:mga05p37_82072_c1_175_528 117
558 3300050507 nmdc:mga05p37_92768_c1 nmdc:mga05p37_92768_c1_1412_1765 117
559 3300050508 nmdc:mga09592_1277391_c1 nmdc:mga09592_1277391_c1_216_569 117
560 3300050508 nmdc:mga09592_1944_c1 nmdc:mga09592_1944_c1_6028_6384 117
561 3300050508 nmdc:mga09592_51459_c1 nmdc:mga09592_51459_c1_3018_3371 117
562 3300050508 nmdc:mga09592_5317_c1 nmdc:mga09592_5317_c1_1360_1713 117
563 3300050508 nmdc:mga09592_62218_c1 nmdc:mga09592_62218_c1_1779_2132 117
564 3300050508 nmdc:mga09592_70527_c1 nmdc:mga09592_70527_c1_1368_1724 117
565 3300050509 nmdc:mga0qj67_21599_c1 nmdc:mga0qj67_21599_c1_523_879 117
566 3300050509 nmdc:mga0qj67_24924_c1 nmdc:mga0qj67_24924_c1_1981_2337 117
567 3300050509 nmdc:mga0qj67_385595_c1 nmdc:mga0qj67_385595_c1_423_776 117
568 3300050509 nmdc:mga0qj67_61674_c1 nmdc:mga0qj67_61674_c1_279_635 117
569 3300050510 nmdc:mga06r32_129889_c1 nmdc:mga06r32_129889_c1_129_485 117
570 3300050510 nmdc:mga06r32_1453367_c1 nmdc:mga06r32_1453367_c1_104_457 117
571 3300050510 nmdc:mga06r32_31833_c1 nmdc:mga06r32_31833_c1_2987_3340 117
572 3300050510 nmdc:mga06r32_3786_c1 nmdc:mga06r32_3786_c1_979_1335 117
573 3300050510 nmdc:mga06r32_73196_c1 nmdc:mga06r32_73196_c1_2158_2514 117
574 3300050511 nmdc:mga08y16_3252_c1 nmdc:mga08y16_3252_c1_10926_11279 117
575 3300050511 nmdc:mga08y16_4117_c1 nmdc:mga08y16_4117_c1_3126_3479 117
576 3300050511 nmdc:mga08y16_620967_c1 nmdc:mga08y16_620967_c1_286_639 117
577 3300050511 nmdc:mga08y16_89595_c1 nmdc:mga08y16_89595_c1_2036_2389 117
578 3300050512 nmdc:mga0n895_116823_c1 nmdc:mga0n895_116823_c1_434_787 117
579 3300050512 nmdc:mga0n895_1212401_c1 nmdc:mga0n895_1212401_c1_121_474 117
580 3300050512 nmdc:mga0n895_142145_c1 nmdc:mga0n895_142145_c1_991_1344 117
581 3300050512 nmdc:mga0n895_153195_c1 nmdc:mga0n895_153195_c1_587_940 117
582 3300050512 nmdc:mga0n895_2948_c1 nmdc:mga0n895_2948_c1_1526_1879 117
583 3300050512 nmdc:mga0n895_2964_c1 nmdc:mga0n895_2964_c1_12316_12669 117
584 3300050512 nmdc:mga0n895_332996_c1 nmdc:mga0n895_332996_c1_1002_1355 117
585 3300050512 nmdc:mga0n895_381987_c1 nmdc:mga0n895_381987_c1_887_1240 117
586 3300050512 nmdc:mga0n895_69434_c1 nmdc:mga0n895_69434_c1_516_869 117
587 3300050512 nmdc:mga0n895_76187_c1 nmdc:mga0n895_76187_c1_1066_1419 117
588 3300050513 nmdc:mga0rr50_260551_c1 nmdc:mga0rr50_260551_c1_39_392 117
589 3300050513 nmdc:mga0rr50_285729_c1 nmdc:mga0rr50_285729_c1_313_666 117
590 3300050513 nmdc:mga0rr50_639080_c1 nmdc:mga0rr50_639080_c1_232_585 117
591 3300050513 nmdc:mga0rr50_64492_c1 nmdc:mga0rr50_64492_c1_687_1040 117
592 3300050513 nmdc:mga0rr50_72598_c1 nmdc:mga0rr50_72598_c1_2196_2549 117
593 3300050513 nmdc:mga0rr50_768575_c1 nmdc:mga0rr50_768575_c1_56_409 117
594 3300050513 nmdc:mga0rr50_88492_c1 nmdc:mga0rr50_88492_c1_525_878 117
595 3300050514 nmdc:mga08x19_20719_c1 nmdc:mga08x19_20719_c1_2730_3083 117
596 3300050514 nmdc:mga08x19_258152_c1 nmdc:mga08x19_258152_c1_838_1191 117
597 3300050515 nmdc:mga0a205_101290_c1 nmdc:mga0a205_101290_c1_1726_2079 117
598 3300050515 nmdc:mga0a205_117013_c1 nmdc:mga0a205_117013_c1_381_734 117
599 3300050515 nmdc:mga0a205_1249047_c1 nmdc:mga0a205_1249047_c1_133_486 117
600 3300050515 nmdc:mga0a205_13697_c1 nmdc:mga0a205_13697_c1_3432_3785 117
601 3300050515 nmdc:mga0a205_171182_c1 nmdc:mga0a205_171182_c1_1526_1879 117
602 3300050515 nmdc:mga0a205_227_c1 nmdc:mga0a205_227_c1_23837_24190 117
603 3300050515 nmdc:mga0a205_29588_c1 nmdc:mga0a205_29588_c1_1112_1465 117
604 3300050515 nmdc:mga0a205_6155_c2 nmdc:mga0a205_6155_c2_3494_3847 117
605 3300053129 Ga0500628_038703 Ga0500628_038703_333_686 117
606 3300054114 Ga0501084_0011395 Ga0501084_0011395_2424_2780 117
607 3300054114 Ga0501084_0357875 Ga0501084_0357875_221_574 117
608 3300059421 Ga0590071_007657 Ga0590071_007657_1224_1577 117
609 3300059421 Ga0590071_039690 Ga0590071_039690_267_620 117
610 3300059423 Ga0590074_057642 Ga0590074_057642_314_667 117
611 3300059423 Ga0590074_060111 Ga0590074_060111_302_658 117
612 3300059426 Ga0590077_016885 Ga0590077_016885_478_834 117
613 3300059426 Ga0590077_166202 Ga0590077_166202_81_434 117
614 3300060353 Ga0501082_0006260 Ga0501082_0006260_5813_6169 117
615 3300060353 Ga0501082_0102762 Ga0501082_0102762_1937_2293 117
616 3300060353 Ga0501082_0172268 Ga0501082_0172268_205_558 117
617 3300060353 Ga0501082_0760070 Ga0501082_0760070_31_384 117
618 3300060353 Ga0501082_1200023 Ga0501082_1200023_229_582 117
619 3300061734 Ga0530510_0043766 Ga0530510_0043766_127_483 117
620 3300061734 Ga0530510_0720243 Ga0530510_0720243_393_749 117
621 3300061734 Ga0530510_1098736 Ga0530510_1098736_31_384 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

18

118

0.97

Feature Viewer

pLDDT pTM Quality
79.09 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map