F470013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 621 | 266 | 621 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100257623|Ga0307416_1002576232 |
| Length | 119 |
| Sequence | VSGYLPVAIYLALIIGFAAISLIMARLLRPSRPNSSYAKEQNYECGAEPIGTAWVQFPVGFYLVALVFIVFDTLAIFLFPFALVLRELGVWALGAMGAFVAVLTLGWIYAYREGILDWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 175 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 188 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 191 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 192 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 193 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 194 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 238 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 239 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 249 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 263 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.06 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 94.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002893 | 3300003203 | Bacteria | 8098 |
| 2 | Ga0065712_10003667 | 3300005290 | Bacteria | 6051 |
| 3 | Ga0065715_10009447 | 3300005293 | Bacteria | 2906 |
| 4 | Ga0065715_10093719 | 3300005293 | Bacteria | 4583 |
| 5 | Ga0065715_10118663 | 3300005293 | Bacteria | 2310 |
| 6 | Ga0065707_10207494 | 3300005295 | Bacteria | 1281 |
| 7 | Ga0070676_10006734 | 3300005328 | Bacteria | 6155 |
| 8 | Ga0070683_100014312 | 3300005329 | Bacteria | 6937 |
| 9 | Ga0070670_100019360 | 3300005331 | Bacteria | 5840 |
| 10 | Ga0070670_100491031 | 3300005331 | Bacteria | 1091 |
| 11 | Ga0068869_100001496 | 3300005334 | Bacteria | 13845 |
| 12 | Ga0068869_100136433 | 3300005334 | Bacteria | 1891 |
| 13 | Ga0068869_100160277 | 3300005334 | Bacteria | 1751 |
| 14 | Ga0068869_101054158 | 3300005334 | Unclassified | 710 |
| 15 | Ga0070680_100000934 | 3300005336 | Bacteria | 20654 |
| 16 | Ga0070680_100111435 | 3300005336 | Bacteria | 2278 |
| 17 | Ga0070680_100282995 | 3300005336 | Bacteria | 1405 |
| 18 | Ga0070682_100001865 | 3300005337 | Bacteria | 11757 |
| 19 | Ga0068868_100044648 | 3300005338 | Bacteria | 3465 |
| 20 | Ga0068868_100938710 | 3300005338 | Bacteria | 788 |
| 21 | Ga0070660_100024523 | 3300005339 | Bacteria | 4474 |
| 22 | Ga0070689_100736688 | 3300005340 | Bacteria | 863 |
| 23 | Ga0070689_101620204 | 3300005340 | Bacteria | 588 |
| 24 | Ga0070691_10002071 | 3300005341 | Bacteria | 8856 |
| 25 | Ga0070691_10330860 | 3300005341 | Bacteria | 841 |
| 26 | Ga0070687_100140453 | 3300005343 | Bacteria | 1406 |
| 27 | Ga0070687_100330650 | 3300005343 | Bacteria | 977 |
| 28 | Ga0070661_100000211 | 3300005344 | Bacteria | 48345 |
| 29 | Ga0070692_10002475 | 3300005345 | Bacteria | 7181 |
| 30 | Ga0070692_10368949 | 3300005345 | Bacteria | 897 |
| 31 | Ga0070692_10535573 | 3300005345 | Bacteria | 765 |
| 32 | Ga0070668_100079796 | 3300005347 | Bacteria | 2563 |
| 33 | Ga0070668_100160833 | 3300005347 | Bacteria | 1822 |
| 34 | Ga0070668_100391262 | 3300005347 | Bacteria | 1185 |
| 35 | Ga0070669_100019045 | 3300005353 | Bacteria | 4907 |
| 36 | Ga0070669_100020540 | 3300005353 | Bacteria | 4717 |
| 37 | Ga0070669_100088728 | 3300005353 | Bacteria | 2315 |
| 38 | Ga0070675_100309347 | 3300005354 | Bacteria | 1394 |
| 39 | Ga0070671_101362795 | 3300005355 | Unclassified | 626 |
| 40 | Ga0070673_100022870 | 3300005364 | Bacteria | 4559 |
| 41 | Ga0070673_101392182 | 3300005364 | Bacteria | 660 |
| 42 | Ga0070688_101703130 | 3300005365 | Unclassified | 516 |
| 43 | Ga0070659_100001505 | 3300005366 | Bacteria | 16800 |
| 44 | Ga0070659_100876943 | 3300005366 | Bacteria | 783 |
| 45 | Ga0070667_100088984 | 3300005367 | Bacteria | 2652 |
| 46 | Ga0070667_100993799 | 3300005367 | Bacteria | 783 |
| 47 | Ga0070703_10028898 | 3300005406 | Bacteria | 1660 |
| 48 | Ga0070703_10114460 | 3300005406 | Bacteria | 970 |
| 49 | Ga0070703_10213748 | 3300005406 | Bacteria | 764 |
| 50 | Ga0070703_10389540 | 3300005406 | Bacteria | 604 |
| 51 | Ga0070701_10490662 | 3300005438 | Bacteria | 796 |
| 52 | Ga0070701_10637470 | 3300005438 | Bacteria | 710 |
| 53 | Ga0070711_100337382 | 3300005439 | Bacteria | 1208 |
| 54 | Ga0070705_100005391 | 3300005440 | Bacteria | 6231 |
| 55 | Ga0070705_100018832 | 3300005440 | Bacteria | 3625 |
| 56 | Ga0070705_100161089 | 3300005440 | Bacteria | 1500 |
| 57 | Ga0070705_100758454 | 3300005440 | Bacteria | 768 |
| 58 | Ga0070705_100767238 | 3300005440 | Bacteria | 764 |
| 59 | Ga0070700_100247920 | 3300005441 | Bacteria | 1276 |
| 60 | Ga0070694_100003319 | 3300005444 | Bacteria | 9628 |
| 61 | Ga0070694_100021019 | 3300005444 | Bacteria | 4166 |
| 62 | Ga0070694_100196049 | 3300005444 | Bacteria | 1503 |
| 63 | Ga0070694_100551631 | 3300005444 | Bacteria | 923 |
| 64 | Ga0070694_100994426 | 3300005444 | Unclassified | 696 |
| 65 | Ga0070708_100201245 | 3300005445 | Bacteria | 1864 |
| 66 | Ga0070708_100400239 | 3300005445 | Bacteria | 1295 |
| 67 | Ga0070708_100875009 | 3300005445 | Bacteria | 844 |
| 68 | Ga0070708_100900046 | 3300005445 | Bacteria | 831 |
| 69 | Ga0070708_101080412 | 3300005445 | Bacteria | 752 |
| 70 | Ga0070663_100026467 | 3300005455 | Bacteria | 3930 |
| 71 | Ga0070662_100286622 | 3300005457 | Bacteria | 1334 |
| 72 | Ga0070662_100638521 | 3300005457 | Bacteria | 897 |
| 73 | Ga0070681_10062390 | 3300005458 | Bacteria | 3701 |
| 74 | Ga0070681_10247040 | 3300005458 | Bacteria | 1697 |
| 75 | Ga0068867_100006675 | 3300005459 | Bacteria | 8159 |
| 76 | Ga0068867_100283723 | 3300005459 | Bacteria | 1359 |
| 77 | Ga0068867_100475128 | 3300005459 | Bacteria | 1070 |
| 78 | Ga0068867_101650454 | 3300005459 | Unclassified | 600 |
| 79 | Ga0070706_100035858 | 3300005467 | Bacteria | 4580 |
| 80 | Ga0070706_100095440 | 3300005467 | Bacteria | 2760 |
| 81 | Ga0070706_100832164 | 3300005467 | Bacteria | 854 |
| 82 | Ga0070706_100949681 | 3300005467 | Bacteria | 793 |
| 83 | Ga0070707_100076882 | 3300005468 | Bacteria | 3220 |
| 84 | Ga0070707_100231760 | 3300005468 | Unclassified | 1797 |
| 85 | Ga0070707_100646572 | 3300005468 | Bacteria | 1020 |
| 86 | Ga0070707_100832395 | 3300005468 | Bacteria | 887 |
| 87 | Ga0070707_101085066 | 3300005468 | Bacteria | 766 |
| 88 | Ga0070698_100035071 | 3300005471 | Bacteria | 5188 |
| 89 | Ga0070698_100195389 | 3300005471 | Bacteria | 1960 |
| 90 | Ga0070698_101036465 | 3300005471 | Bacteria | 768 |
| 91 | Ga0070698_101232879 | 3300005471 | Bacteria | 697 |
| 92 | Ga0070699_100008025 | 3300005518 | Bacteria | 9167 |
| 93 | Ga0070699_100064987 | 3300005518 | Bacteria | 3165 |
| 94 | Ga0070699_100091594 | 3300005518 | Bacteria | 2658 |
| 95 | Ga0070699_100541622 | 3300005518 | Unclassified | 1059 |
| 96 | Ga0070679_100008274 | 3300005530 | Bacteria | 9785 |
| 97 | Ga0070684_100072662 | 3300005535 | Bacteria | 3029 |
| 98 | Ga0070697_100008644 | 3300005536 | Bacteria | 7953 |
| 99 | Ga0070697_100085434 | 3300005536 | Bacteria | 2603 |
| 100 | Ga0070697_100139504 | 3300005536 | Bacteria | 2038 |
| 101 | Ga0070697_100248301 | 3300005536 | Bacteria | 1521 |
| 102 | Ga0070697_100883483 | 3300005536 | Bacteria | 793 |
| 103 | Ga0070697_100980987 | 3300005536 | Bacteria | 751 |
| 104 | Ga0070697_101228978 | 3300005536 | Bacteria | 668 |
| 105 | Ga0068853_100000678 | 3300005539 | Bacteria | 23432 |
| 106 | Ga0068853_101244189 | 3300005539 | Bacteria | 719 |
| 107 | Ga0068853_101876163 | 3300005539 | Bacteria | 581 |
| 108 | Ga0070672_100050763 | 3300005543 | Bacteria | 3233 |
| 109 | Ga0070672_100176944 | 3300005543 | Bacteria | 1777 |
| 110 | Ga0070686_100448179 | 3300005544 | Bacteria | 992 |
| 111 | Ga0070686_100933752 | 3300005544 | Bacteria | 708 |
| 112 | Ga0070695_100002498 | 3300005545 | Bacteria | 10593 |
| 113 | Ga0070695_100005383 | 3300005545 | Bacteria | 7533 |
| 114 | Ga0070695_100199280 | 3300005545 | Bacteria | 1430 |
| 115 | Ga0070695_100224007 | 3300005545 | Bacteria | 1356 |
| 116 | Ga0070696_100091216 | 3300005546 | Bacteria | 2169 |
| 117 | Ga0070696_100335766 | 3300005546 | Bacteria | 1167 |
| 118 | Ga0070696_100769995 | 3300005546 | Bacteria | 790 |
| 119 | Ga0070696_101158797 | 3300005546 | Unclassified | 652 |
| 120 | Ga0070693_100000189 | 3300005547 | Bacteria | 28531 |
| 121 | Ga0070693_100214766 | 3300005547 | Bacteria | 1257 |
| 122 | Ga0070704_100001133 | 3300005549 | Bacteria | 13909 |
| 123 | Ga0070704_100006591 | 3300005549 | Bacteria | 6850 |
| 124 | Ga0070704_100226172 | 3300005549 | Bacteria | 1524 |
| 125 | Ga0070704_100295349 | 3300005549 | Bacteria | 1348 |
| 126 | Ga0070704_100330325 | 3300005549 | Bacteria | 1280 |
| 127 | Ga0068855_100015121 | 3300005563 | Bacteria | 9293 |
| 128 | Ga0068855_100967163 | 3300005563 | Bacteria | 896 |
| 129 | Ga0070664_100012522 | 3300005564 | Bacteria | 6898 |
| 130 | Ga0070664_100445210 | 3300005564 | Bacteria | 1189 |
| 131 | Ga0068857_100046341 | 3300005577 | Bacteria | 3858 |
| 132 | Ga0068854_100002061 | 3300005578 | Bacteria | 12321 |
| 133 | Ga0068856_100008288 | 3300005614 | Bacteria | 10131 |
| 134 | Ga0070702_100191925 | 3300005615 | Bacteria | 1345 |
| 135 | Ga0068852_101628962 | 3300005616 | Bacteria | 668 |
| 136 | Ga0068859_100849413 | 3300005617 | Bacteria | 999 |
| 137 | Ga0068859_100906665 | 3300005617 | Bacteria | 966 |
| 138 | Ga0068864_100021673 | 3300005618 | Bacteria | 5381 |
| 139 | Ga0068864_100206245 | 3300005618 | Bacteria | 1808 |
| 140 | Ga0068864_100332396 | 3300005618 | Bacteria | 1430 |
| 141 | Ga0068864_100586032 | 3300005618 | Unclassified | 1081 |
| 142 | Ga0068866_10161459 | 3300005718 | Bacteria | 1307 |
| 143 | Ga0068861_100006876 | 3300005719 | Bacteria | 7768 |
| 144 | Ga0068861_100291751 | 3300005719 | Bacteria | 1409 |
| 145 | Ga0068861_100772554 | 3300005719 | Bacteria | 899 |
| 146 | Ga0068870_10007619 | 3300005840 | Bacteria | 4839 |
| 147 | Ga0068870_10626455 | 3300005840 | Unclassified | 734 |
| 148 | Ga0068863_100005815 | 3300005841 | Bacteria | 12091 |
| 149 | Ga0068863_100168455 | 3300005841 | Bacteria | 2101 |
| 150 | Ga0068863_100314327 | 3300005841 | Bacteria | 1521 |
| 151 | Ga0068863_101062833 | 3300005841 | Unclassified | 813 |
| 152 | Ga0068858_100076039 | 3300005842 | Bacteria | 3119 |
| 153 | Ga0068860_100004587 | 3300005843 | Bacteria | 14099 |
| 154 | Ga0068860_100042805 | 3300005843 | Bacteria | 4322 |
| 155 | Ga0068860_100231057 | 3300005843 | Bacteria | 1797 |
| 156 | Ga0068862_100015431 | 3300005844 | Bacteria | 6345 |
| 157 | Ga0068862_100117879 | 3300005844 | Bacteria | 2337 |
| 158 | Ga0068862_101286944 | 3300005844 | Bacteria | 732 |
| 159 | Ga0068862_101617789 | 3300005844 | Bacteria | 655 |
| 160 | Ga0081455_10022244 | 3300005937 | Bacteria | 5930 |
| 161 | Ga0081539_10000096 | 3300005985 | Bacteria | 204059 |
| 162 | Ga0075365_10025483 | 3300006038 | Bacteria | 3744 |
| 163 | Ga0075365_10321702 | 3300006038 | Bacteria | 1089 |
| 164 | Ga0075365_10322661 | 3300006038 | Bacteria | 1088 |
| 165 | Ga0075364_10029608 | 3300006051 | Bacteria | 3512 |
| 166 | Ga0075364_10217964 | 3300006051 | Bacteria | 1294 |
| 167 | Ga0075432_10416544 | 3300006058 | Unclassified | 583 |
| 168 | Ga0070712_100018868 | 3300006175 | Bacteria | 4488 |
| 169 | Ga0075362_10000233 | 3300006177 | Bacteria | 15482 |
| 170 | Ga0075367_10533041 | 3300006178 | Unclassified | 745 |
| 171 | Ga0075366_10039306 | 3300006195 | Bacteria | 2797 |
| 172 | Ga0075366_10826849 | 3300006195 | Unclassified | 576 |
| 173 | Ga0097621_100444164 | 3300006237 | Bacteria | 1168 |
| 174 | Ga0075428_100003167 | 3300006844 | Bacteria | 17983 |
| 175 | Ga0075428_100026308 | 3300006844 | Bacteria | 6442 |
| 176 | Ga0075428_100115170 | 3300006844 | Bacteria | 2928 |
| 177 | Ga0075428_100136489 | 3300006844 | Unclassified | 2667 |
| 178 | Ga0075428_100900045 | 3300006844 | Bacteria | 939 |
| 179 | Ga0075428_101425780 | 3300006844 | Unclassified | 726 |
| 180 | Ga0075430_100000404 | 3300006846 | Bacteria | 31995 |
| 181 | Ga0075430_100044512 | 3300006846 | Bacteria | 3752 |
| 182 | Ga0075430_100143064 | 3300006846 | Bacteria | 1992 |
| 183 | Ga0075430_100269876 | 3300006846 | Bacteria | 1408 |
| 184 | Ga0075431_100000082 | 3300006847 | Bacteria | 56660 |
| 185 | Ga0075431_100001936 | 3300006847 | Bacteria | 19722 |
| 186 | Ga0075431_100049839 | 3300006847 | Bacteria | 4317 |
| 187 | Ga0075431_100338939 | 3300006847 | Bacteria | 1513 |
| 188 | Ga0075431_101165949 | 3300006847 | Bacteria | 734 |
| 189 | Ga0075433_10000427 | 3300006852 | Bacteria | 27010 |
| 190 | Ga0075433_10010989 | 3300006852 | Bacteria | 7280 |
| 191 | Ga0075433_10034070 | 3300006852 | Bacteria | 4371 |
| 192 | Ga0075433_10039794 | 3300006852 | Bacteria | 4066 |
| 193 | Ga0075433_10069763 | 3300006852 | Bacteria | 3087 |
| 194 | Ga0075433_10075186 | 3300006852 | Bacteria | 2972 |
| 195 | Ga0075433_10252706 | 3300006852 | Bacteria | 1564 |
| 196 | Ga0075433_10358859 | 3300006852 | Bacteria | 1288 |
| 197 | Ga0075434_100000180 | 3300006871 | Bacteria | 41040 |
| 198 | Ga0075434_100104105 | 3300006871 | Bacteria | 2847 |
| 199 | Ga0075434_100162184 | 3300006871 | Bacteria | 2255 |
| 200 | Ga0075434_100224438 | 3300006871 | Bacteria | 1898 |
| 201 | Ga0075434_100279243 | 3300006871 | Unclassified | 1690 |
| 202 | Ga0075434_100545263 | 3300006871 | Bacteria | 1179 |
| 203 | Ga0075434_100957100 | 3300006871 | Bacteria | 871 |
| 204 | Ga0075434_101172210 | 3300006871 | Unclassified | 781 |
| 205 | Ga0075429_100002106 | 3300006880 | Bacteria | 16613 |
| 206 | Ga0075429_100002856 | 3300006880 | Bacteria | 14619 |
| 207 | Ga0075429_100016759 | 3300006880 | Bacteria | 6344 |
| 208 | Ga0075429_100031684 | 3300006880 | Bacteria | 4595 |
| 209 | Ga0075429_100127202 | 3300006880 | Unclassified | 2228 |
| 210 | Ga0068865_100286646 | 3300006881 | Bacteria | 1313 |
| 211 | Ga0075436_100023165 | 3300006914 | Bacteria | 4266 |
| 212 | Ga0075436_100034917 | 3300006914 | Bacteria | 3468 |
| 213 | Ga0075436_100286513 | 3300006914 | Unclassified | 1178 |
| 214 | Ga0097620_100849497 | 3300006931 | Bacteria | 999 |
| 215 | Ga0097620_100906662 | 3300006931 | Bacteria | 966 |
| 216 | Ga0075435_100045243 | 3300007076 | Bacteria | 3528 |
| 217 | Ga0075435_100059789 | 3300007076 | Bacteria | 3089 |
| 218 | Ga0075435_100067064 | 3300007076 | Bacteria | 2921 |
| 219 | Ga0075435_100069510 | 3300007076 | Bacteria | 2872 |
| 220 | Ga0075435_100161323 | 3300007076 | Bacteria | 1889 |
| 221 | Ga0075435_100241170 | 3300007076 | Bacteria | 1537 |
| 222 | Ga0075435_100488659 | 3300007076 | Bacteria | 1064 |
| 223 | Ga0075435_100637335 | 3300007076 | Bacteria | 925 |
| 224 | Ga0075435_101232754 | 3300007076 | Unclassified | 655 |
| 225 | Ga0099794_10011283 | 3300007265 | Bacteria | 3820 |
| 226 | Ga0099794_10038325 | 3300007265 | Bacteria | 2270 |
| 227 | Ga0099794_10359180 | 3300007265 | Bacteria | 758 |
| 228 | Ga0099794_10430881 | 3300007265 | Bacteria | 690 |
| 229 | Ga0111539_10001292 | 3300009094 | Bacteria | 33417 |
| 230 | Ga0111539_10001353 | 3300009094 | Bacteria | 32630 |
| 231 | Ga0111539_10012644 | 3300009094 | Bacteria | 10575 |
| 232 | Ga0111539_10308850 | 3300009094 | Bacteria | 1840 |
| 233 | Ga0111539_10586624 | 3300009094 | Bacteria | 1298 |
| 234 | Ga0111539_10695151 | 3300009094 | Bacteria | 1184 |
| 235 | Ga0114129_10000110 | 3300009147 | Bacteria | 81178 |
| 236 | Ga0114129_10086949 | 3300009147 | Bacteria | 4335 |
| 237 | Ga0114129_10096779 | 3300009147 | Bacteria | 4086 |
| 238 | Ga0114129_10106434 | 3300009147 | Bacteria | 3874 |
| 239 | Ga0114129_10202186 | 3300009147 | Bacteria | 2690 |
| 240 | Ga0114129_10321107 | 3300009147 | Bacteria | 2058 |
| 241 | Ga0114129_10657937 | 3300009147 | Bacteria | 1351 |
| 242 | Ga0114129_11189838 | 3300009147 | Bacteria | 950 |
| 243 | Ga0114129_11219606 | 3300009147 | Bacteria | 936 |
| 244 | Ga0114129_11671934 | 3300009147 | Bacteria | 778 |
| 245 | Ga0114129_12576384 | 3300009147 | Bacteria | 607 |
| 246 | Ga0114129_13026216 | 3300009147 | Bacteria | 552 |
| 247 | Ga0105243_10060967 | 3300009148 | Bacteria | 3015 |
| 248 | Ga0105243_11799387 | 3300009148 | Bacteria | 643 |
| 249 | Ga0105241_10001410 | 3300009174 | Bacteria | 18406 |
| 250 | Ga0105242_10623388 | 3300009176 | Bacteria | 1045 |
| 251 | Ga0105248_10098036 | 3300009177 | Bacteria | 3302 |
| 252 | Ga0105237_10211607 | 3300009545 | Bacteria | 1939 |
| 253 | Ga0105249_10716842 | 3300009553 | Bacteria | 1061 |
| 254 | Ga0105249_10813350 | 3300009553 | Bacteria | 999 |
| 255 | Ga0105249_12452720 | 3300009553 | Bacteria | 594 |
| 256 | Ga0105239_10952802 | 3300010375 | Bacteria | 986 |
| 257 | Ga0105239_12007369 | 3300010375 | Unclassified | 671 |
| 258 | Ga0105246_10014486 | 3300011119 | Bacteria | 4960 |
| 259 | Ga0157373_10015786 | 3300013100 | Bacteria | 5513 |
| 260 | Ga0157371_10234753 | 3300013102 | Bacteria | 1318 |
| 261 | Ga0157370_10308851 | 3300013104 | Bacteria | 1459 |
| 262 | Ga0157369_10059275 | 3300013105 | Bacteria | 4128 |
| 263 | Ga0157378_10135169 | 3300013297 | Bacteria | 2286 |
| 264 | Ga0157378_10192904 | 3300013297 | Bacteria | 1923 |
| 265 | Ga0163162_10036717 | 3300013306 | Bacteria | 4886 |
| 266 | Ga0163162_10215621 | 3300013306 | Bacteria | 2050 |
| 267 | Ga0157372_10006472 | 3300013307 | Bacteria | 12468 |
| 268 | Ga0157375_10028617 | 3300013308 | Bacteria | 5227 |
| 269 | Ga0157375_10803431 | 3300013308 | Bacteria | 1089 |
| 270 | Ga0163163_10057404 | 3300014325 | Bacteria | 3849 |
| 271 | Ga0163163_11491609 | 3300014325 | Bacteria | 738 |
| 272 | Ga0157380_10643578 | 3300014326 | Bacteria | 1056 |
| 273 | Ga0157380_10894460 | 3300014326 | Bacteria | 913 |
| 274 | Ga0157380_11200699 | 3300014326 | Bacteria | 802 |
| 275 | Ga0157380_11659355 | 3300014326 | Bacteria | 696 |
| 276 | Ga0157380_12434014 | 3300014326 | Bacteria | 589 |
| 277 | Ga0182007_10019299 | 3300015262 | Bacteria | 2453 |
| 278 | Ga0207653_10001516 | 3300025885 | Bacteria | 7515 |
| 279 | Ga0207642_10159378 | 3300025899 | Bacteria | 1210 |
| 280 | Ga0207647_10032509 | 3300025904 | Bacteria | 3350 |
| 281 | Ga0207647_10114886 | 3300025904 | Bacteria | 1590 |
| 282 | Ga0207647_10126024 | 3300025904 | Bacteria | 1507 |
| 283 | Ga0207645_10000400 | 3300025907 | Bacteria | 35898 |
| 284 | Ga0207643_10000424 | 3300025908 | Bacteria | 27864 |
| 285 | Ga0207684_10040466 | 3300025910 | Bacteria | 3951 |
| 286 | Ga0207684_10067040 | 3300025910 | Bacteria | 3049 |
| 287 | Ga0207684_10168420 | 3300025910 | Bacteria | 1888 |
| 288 | Ga0207684_10668124 | 3300025910 | Bacteria | 884 |
| 289 | Ga0207654_10002440 | 3300025911 | Bacteria | 9494 |
| 290 | Ga0207654_11033238 | 3300025911 | Bacteria | 598 |
| 291 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 292 | Ga0207707_10068879 | 3300025912 | Unclassified | 3084 |
| 293 | Ga0207707_11078509 | 3300025912 | Bacteria | 656 |
| 294 | Ga0207693_10141026 | 3300025915 | Bacteria | 1895 |
| 295 | Ga0207663_10161883 | 3300025916 | Bacteria | 1580 |
| 296 | Ga0207660_10003214 | 3300025917 | Bacteria | 10691 |
| 297 | Ga0207660_10111790 | 3300025917 | Bacteria | 2057 |
| 298 | Ga0207660_10516419 | 3300025917 | Bacteria | 970 |
| 299 | Ga0207657_10000211 | 3300025919 | Bacteria | 60392 |
| 300 | Ga0207649_10001872 | 3300025920 | Bacteria | 12020 |
| 301 | Ga0207652_10003841 | 3300025921 | Bacteria | 12319 |
| 302 | Ga0207646_10021998 | 3300025922 | Bacteria | 5883 |
| 303 | Ga0207646_10082210 | 3300025922 | Bacteria | 2880 |
| 304 | Ga0207646_10316445 | 3300025922 | Unclassified | 1410 |
| 305 | Ga0207646_11245015 | 3300025922 | Unclassified | 651 |
| 306 | Ga0207681_10040372 | 3300025923 | Bacteria | 3105 |
| 307 | Ga0207650_10005754 | 3300025925 | Bacteria | 8456 |
| 308 | Ga0207687_10537379 | 3300025927 | Bacteria | 979 |
| 309 | Ga0207644_10069716 | 3300025931 | Bacteria | 2568 |
| 310 | Ga0207690_10001495 | 3300025932 | Bacteria | 14606 |
| 311 | Ga0207690_10708204 | 3300025932 | Bacteria | 828 |
| 312 | Ga0207706_10002411 | 3300025933 | Bacteria | 18232 |
| 313 | Ga0207706_10243256 | 3300025933 | Bacteria | 1573 |
| 314 | Ga0207709_10068840 | 3300025935 | Bacteria | 2239 |
| 315 | Ga0207670_10198564 | 3300025936 | Bacteria | 1522 |
| 316 | Ga0207670_10241411 | 3300025936 | Bacteria | 1392 |
| 317 | Ga0207704_10223450 | 3300025938 | Bacteria | 1395 |
| 318 | Ga0207704_10439741 | 3300025938 | Bacteria | 1038 |
| 319 | Ga0207704_10831932 | 3300025938 | Bacteria | 773 |
| 320 | Ga0207691_10009557 | 3300025940 | Bacteria | 9307 |
| 321 | Ga0207691_10044674 | 3300025940 | Bacteria | 4077 |
| 322 | Ga0207711_11213804 | 3300025941 | Unclassified | 696 |
| 323 | Ga0207711_11454070 | 3300025941 | Bacteria | 628 |
| 324 | Ga0207689_10000201 | 3300025942 | Bacteria | 52554 |
| 325 | Ga0207689_10006142 | 3300025942 | Bacteria | 10632 |
| 326 | Ga0207689_10487208 | 3300025942 | Bacteria | 1033 |
| 327 | Ga0207689_11358503 | 3300025942 | Bacteria | 596 |
| 328 | Ga0207661_10116000 | 3300025944 | Bacteria | 2273 |
| 329 | Ga0207667_10000342 | 3300025949 | Bacteria | 63745 |
| 330 | Ga0207651_10256909 | 3300025960 | Bacteria | 1432 |
| 331 | Ga0207712_10193760 | 3300025961 | Bacteria | 1606 |
| 332 | Ga0207712_10540514 | 3300025961 | Bacteria | 1001 |
| 333 | Ga0207712_10624758 | 3300025961 | Bacteria | 934 |
| 334 | Ga0207712_11248727 | 3300025961 | Bacteria | 663 |
| 335 | Ga0207668_10168930 | 3300025972 | Bacteria | 1713 |
| 336 | Ga0207640_10005238 | 3300025981 | Bacteria | 7056 |
| 337 | Ga0207658_11099868 | 3300025986 | Bacteria | 726 |
| 338 | Ga0207677_10046871 | 3300026023 | Bacteria | 2897 |
| 339 | Ga0207677_11520584 | 3300026023 | Bacteria | 618 |
| 340 | Ga0207703_11282773 | 3300026035 | Unclassified | 704 |
| 341 | Ga0207639_10010274 | 3300026041 | Bacteria | 6480 |
| 342 | Ga0207639_12241353 | 3300026041 | Unclassified | 508 |
| 343 | Ga0207678_10038622 | 3300026067 | Bacteria | 4147 |
| 344 | Ga0207708_10342509 | 3300026075 | Bacteria | 1225 |
| 345 | Ga0207708_10511633 | 3300026075 | Bacteria | 1008 |
| 346 | Ga0207702_10001143 | 3300026078 | Bacteria | 27129 |
| 347 | Ga0207641_10032523 | 3300026088 | Bacteria | 4331 |
| 348 | Ga0207641_10193852 | 3300026088 | Bacteria | 1869 |
| 349 | Ga0207641_10555201 | 3300026088 | Bacteria | 1120 |
| 350 | Ga0207641_10662907 | 3300026088 | Unclassified | 1025 |
| 351 | Ga0207648_10027633 | 3300026089 | Bacteria | 5036 |
| 352 | Ga0207648_10106824 | 3300026089 | Bacteria | 2456 |
| 353 | Ga0207648_10230014 | 3300026089 | Bacteria | 1649 |
| 354 | Ga0207648_11453338 | 3300026089 | Bacteria | 644 |
| 355 | Ga0207676_10009069 | 3300026095 | Bacteria | 7084 |
| 356 | Ga0207676_10158776 | 3300026095 | Bacteria | 1957 |
| 357 | Ga0207676_10843490 | 3300026095 | Bacteria | 896 |
| 358 | Ga0207674_10000951 | 3300026116 | Bacteria | 37804 |
| 359 | Ga0207675_100025354 | 3300026118 | Bacteria | 5518 |
| 360 | Ga0207675_100135871 | 3300026118 | Bacteria | 2333 |
| 361 | Ga0207675_100323798 | 3300026118 | Bacteria | 1505 |
| 362 | Ga0207675_100366788 | 3300026118 | Bacteria | 1414 |
| 363 | Ga0207675_100575684 | 3300026118 | Bacteria | 1127 |
| 364 | Ga0207675_100873446 | 3300026118 | Bacteria | 915 |
| 365 | Ga0209995_1000169 | 3300027471 | Bacteria | 10476 |
| 366 | Ga0209983_1060072 | 3300027665 | Bacteria | 839 |
| 367 | Ga0209588_1004754 | 3300027671 | Bacteria | 3852 |
| 368 | Ga0209588_1036728 | 3300027671 | Bacteria | 1577 |
| 369 | Ga0209971_1011663 | 3300027682 | Bacteria | 2082 |
| 370 | Ga0209966_1013125 | 3300027695 | Bacteria | 1529 |
| 371 | Ga0209813_10235709 | 3300027866 | Bacteria | 690 |
| 372 | Ga0209974_10138703 | 3300027876 | Unclassified | 871 |
| 373 | Ga0207428_10000027 | 3300027907 | Bacteria | 250186 |
| 374 | Ga0207428_10007638 | 3300027907 | Bacteria | 9844 |
| 375 | Ga0207428_10074725 | 3300027907 | Bacteria | 2657 |
| 376 | Ga0207428_10220260 | 3300027907 | Bacteria | 1423 |
| 377 | Ga0268265_10059441 | 3300028380 | Bacteria | 2924 |
| 378 | Ga0268265_10265627 | 3300028380 | Bacteria | 1528 |
| 379 | Ga0268265_10503280 | 3300028380 | Bacteria | 1142 |
| 380 | Ga0268264_10096020 | 3300028381 | Bacteria | 2566 |
| 381 | Ga0268264_10202676 | 3300028381 | Bacteria | 1816 |
| 382 | Ga0307408_100499703 | 3300031548 | Bacteria | 1064 |
| 383 | Ga0307408_100728564 | 3300031548 | Unclassified | 894 |
| 384 | Ga0307405_10197582 | 3300031731 | Bacteria | 1458 |
| 385 | Ga0307413_10391682 | 3300031824 | Bacteria | 1086 |
| 386 | Ga0307410_10178705 | 3300031852 | Bacteria | 1605 |
| 387 | Ga0307410_10640101 | 3300031852 | Bacteria | 891 |
| 388 | Ga0307410_11414308 | 3300031852 | Bacteria | 611 |
| 389 | Ga0307406_11955937 | 3300031901 | Unclassified | 523 |
| 390 | Ga0307412_10304083 | 3300031911 | Bacteria | 1262 |
| 391 | Ga0307409_100656752 | 3300031995 | Bacteria | 1043 |
| 392 | Ga0307409_100901315 | 3300031995 | Bacteria | 898 |
| 393 | Ga0307416_100257623 | 3300032002 | Bacteria | 1703 |
| 394 | Ga0307416_100915983 | 3300032002 | Bacteria | 977 |
| 395 | Ga0307416_101861492 | 3300032002 | Bacteria | 705 |
| 396 | Ga0307415_101195895 | 3300032126 | Bacteria | 716 |
| 397 | Ga0373930_0176866 | 3300034816 | Bacteria | 546 |
| 398 | Ga0373958_0048345 | 3300034819 | Bacteria | 892 |
| 399 | Ga0373938_0141948 | 3300034957 | Bacteria | 634 |
| 400 | Ga0373940_0116788 | 3300035088 | Bacteria | 824 |
| 401 | Ga0373949_0003943 | 3300035090 | Bacteria | 3446 |
| 402 | Ga0373949_0007754 | 3300035090 | Bacteria | 2352 |
| 403 | Ga0373951_0018714 | 3300035091 | Bacteria | 1574 |
| 404 | Ga0373951_0043855 | 3300035091 | Bacteria | 1085 |
| 405 | Ga0373951_0056481 | 3300035091 | Bacteria | 975 |
| 406 | Ga0373952_0252156 | 3300035092 | Bacteria | 535 |
| 407 | Ga0373932_0072441 | 3300035112 | Bacteria | 1071 |
| 408 | Ga0373932_0114056 | 3300035112 | Bacteria | 894 |
| 409 | Ga0373939_0168786 | 3300035114 | Bacteria | 808 |
| 410 | Ga0373960_0163024 | 3300035121 | Bacteria | 769 |
| 411 | Ga0373961_0007012 | 3300035241 | Bacteria | 2713 |
| 412 | Ga0373931_0002228 | 3300035691 | Bacteria | 8566 |
| 413 | Ga0373931_0014296 | 3300035691 | Bacteria | 3877 |
| 414 | Ga0373931_0016884 | 3300035691 | Bacteria | 3600 |
| 415 | Ga0373925_0223760 | 3300037068 | Bacteria | 1503 |
| 416 | Ga0395901_0581846 | 3300038443 | Bacteria | 1131 |
| 417 | Ga0242420_039629 | 3300038996 | Bacteria | 897 |
| 418 | Ga0242420_071388 | 3300038996 | Bacteria | 706 |
| 419 | Ga0242420_113550 | 3300038996 | Unclassified | 585 |
| 420 | Ga0451793_0808498 | 3300041452 | Bacteria | 698 |
| 421 | Ga0439448_0085059 | 3300042005 | Bacteria | 1065 |
| 422 | Ga0450892_012774 | 3300042130 | Bacteria | 760 |
| 423 | Ga0439458_0002241 | 3300042157 | Bacteria | 4760 |
| 424 | Ga0439435_0013810 | 3300042436 | Bacteria | 1985 |
| 425 | Ga0439459_0027302 | 3300042438 | Bacteria | 1139 |
| 426 | Ga0450916_024428 | 3300042530 | Archaea | 848 |
| 427 | Ga0451577_0052534 | 3300042876 | Bacteria | 3638 |
| 428 | Ga0451577_0129629 | 3300042876 | Bacteria | 2262 |
| 429 | Ga0451577_0147755 | 3300042876 | Bacteria | 2114 |
| 430 | Ga0451577_0795654 | 3300042876 | Bacteria | 854 |
| 431 | Ga0439440_0058835 | 3300042993 | Bacteria | 977 |
| 432 | Ga0453683_0006627 | 3300044673 | Bacteria | 7932 |
| 433 | Ga0453684_0222177 | 3300044712 | Bacteria | 2187 |
| 434 | Ga0453684_2028502 | 3300044712 | Bacteria | 579 |
| 435 | Ga0451576_0005764 | 3300045051 | Bacteria | 15422 |
| 436 | Ga0451576_0202386 | 3300045051 | Bacteria | 2074 |
| 437 | Ga0451576_1167596 | 3300045051 | Bacteria | 804 |
| 438 | Ga0495603_0194346 | 3300046455 | Bacteria | 1173 |
| 439 | Ga0495580_0000727 | 3300046472 | Bacteria | 28206 |
| 440 | Ga0495580_0194137 | 3300046472 | Bacteria | 1400 |
| 441 | Ga0495584_0520556 | 3300046491 | Unclassified | 606 |
| 442 | Ga0495594_0201000 | 3300046499 | Bacteria | 1136 |
| 443 | Ga0495642_0003953 | 3300046528 | Bacteria | 5801 |
| 444 | Ga0495642_0297417 | 3300046528 | Bacteria | 707 |
| 445 | Ga0495598_0140461 | 3300046537 | Bacteria | 835 |
| 446 | Ga0495659_0056697 | 3300046664 | Bacteria | 1438 |
| 447 | Ga0495659_0071461 | 3300046664 | Bacteria | 1301 |
| 448 | Ga0495669_0015347 | 3300046684 | Bacteria | 3280 |
| 449 | Ga0495669_0103315 | 3300046684 | Unclassified | 1325 |
| 450 | Ga0495670_0451062 | 3300046691 | Bacteria | 697 |
| 451 | Ga0496101_0229143 | 3300048904 | Bacteria | 1444 |
| 452 | Ga0496102_0025757 | 3300048905 | Bacteria | 5238 |
| 453 | Ga0496102_0034348 | 3300048905 | Bacteria | 4560 |
| 454 | Ga0496105_0731430 | 3300048908 | Bacteria | 757 |
| 455 | Ga0496106_0081850 | 3300048909 | Unclassified | 2481 |
| 456 | Ga0496106_0116979 | 3300048909 | Bacteria | 2080 |
| 457 | Ga0496106_0326302 | 3300048909 | Bacteria | 1232 |
| 458 | Ga0496109_0545007 | 3300048912 | Bacteria | 1094 |
| 459 | Ga0496110_0144539 | 3300048913 | Bacteria | 2151 |
| 460 | Ga0496110_1022548 | 3300048913 | Bacteria | 734 |
| 461 | Ga0496112_0457355 | 3300048915 | Bacteria | 1214 |
| 462 | Ga0496113_0141061 | 3300048916 | Bacteria | 1896 |
| 463 | Ga0496113_0404058 | 3300048916 | Bacteria | 1097 |
| 464 | Ga0496113_0783271 | 3300048916 | Bacteria | 758 |
| 465 | Ga0501299_073823 | 3300049522 | Unclassified | 745 |
| 466 | Ga0501033_0443022 | 3300049570 | Bacteria | 903 |
| 467 | Ga0501034_0135000 | 3300049571 | Bacteria | 2448 |
| 468 | Ga0501038_0053411 | 3300049574 | Bacteria | 3479 |
| 469 | Ga0501038_0147136 | 3300049574 | Bacteria | 1923 |
| 470 | Ga0501038_0312917 | 3300049574 | Unclassified | 1230 |
| 471 | Ga0501038_0915208 | 3300049574 | Bacteria | 647 |
| 472 | Ga0501039_0173819 | 3300049575 | Bacteria | 1694 |
| 473 | Ga0501039_0225437 | 3300049575 | Bacteria | 1473 |
| 474 | Ga0501039_0402937 | 3300049575 | Bacteria | 1074 |
| 475 | Ga0501039_0512239 | 3300049575 | Bacteria | 942 |
| 476 | Ga0501040_0026162 | 3300049576 | Bacteria | 3924 |
| 477 | Ga0501040_0091918 | 3300049576 | Bacteria | 2110 |
| 478 | Ga0501040_0141398 | 3300049576 | Bacteria | 1696 |
| 479 | Ga0501040_0157639 | 3300049576 | Bacteria | 1603 |
| 480 | Ga0501040_0543082 | 3300049576 | Bacteria | 839 |
| 481 | Ga0501040_1433847 | 3300049576 | Unclassified | 501 |
| 482 | Ga0501041_0084372 | 3300049577 | Bacteria | 1958 |
| 483 | Ga0501041_0108514 | 3300049577 | Bacteria | 1721 |
| 484 | Ga0501041_0253643 | 3300049577 | Bacteria | 1106 |
| 485 | Ga0501041_0947811 | 3300049577 | Unclassified | 553 |
| 486 | Ga0501042_0103837 | 3300049578 | Bacteria | 2045 |
| 487 | Ga0501043_0565639 | 3300049579 | Unclassified | 843 |
| 488 | Ga0501047_0631743 | 3300049581 | Bacteria | 891 |
| 489 | Ga0501048_0035123 | 3300049582 | Bacteria | 3610 |
| 490 | Ga0501048_0373761 | 3300049582 | Bacteria | 1017 |
| 491 | Ga0501068_0076651 | 3300049584 | Bacteria | 2047 |
| 492 | Ga0501068_1065086 | 3300049584 | Bacteria | 534 |
| 493 | Ga0501070_0480895 | 3300049586 | Bacteria | 999 |
| 494 | Ga0501071_0085807 | 3300049587 | Bacteria | 2309 |
| 495 | Ga0501072_0005285 | 3300049588 | Bacteria | 9833 |
| 496 | Ga0501072_0032175 | 3300049588 | Bacteria | 4108 |
| 497 | Ga0501072_0106740 | 3300049588 | Bacteria | 2227 |
| 498 | Ga0501072_0321762 | 3300049588 | Bacteria | 1229 |
| 499 | Ga0501072_1023120 | 3300049588 | Unclassified | 644 |
| 500 | Ga0501073_0486027 | 3300049589 | Bacteria | 854 |
| 501 | Ga0501074_0019399 | 3300049590 | Bacteria | 4939 |
| 502 | Ga0501074_0087561 | 3300049590 | Bacteria | 2230 |
| 503 | Ga0501074_0178173 | 3300049590 | Bacteria | 1517 |
| 504 | Ga0501074_0194015 | 3300049590 | Bacteria | 1448 |
| 505 | Ga0501075_0005715 | 3300049591 | Bacteria | 8511 |
| 506 | Ga0501075_0022204 | 3300049591 | Bacteria | 4633 |
| 507 | Ga0501075_0075603 | 3300049591 | Bacteria | 2547 |
| 508 | Ga0501076_0146698 | 3300049592 | Bacteria | 1918 |
| 509 | Ga0501076_0222280 | 3300049592 | Bacteria | 1543 |
| 510 | Ga0501076_0348299 | 3300049592 | Bacteria | 1216 |
| 511 | Ga0501077_0005657 | 3300049593 | Bacteria | 7618 |
| 512 | Ga0501077_0251614 | 3300049593 | Bacteria | 1124 |
| 513 | Ga0501216_057816 | 3300049660 | Unclassified | 776 |
| 514 | Ga0501257_059386 | 3300049686 | Bacteria | 965 |
| 515 | Ga0501257_109623 | 3300049686 | Bacteria | 731 |
| 516 | Ga0501079_0018603 | 3300049741 | Bacteria | 5307 |
| 517 | Ga0501079_0154988 | 3300049741 | Bacteria | 1786 |
| 518 | Ga0501079_0218002 | 3300049741 | Bacteria | 1490 |
| 519 | Ga0501080_0270881 | 3300049742 | Bacteria | 1545 |
| 520 | Ga0501081_0086749 | 3300049743 | Bacteria | 2197 |
| 521 | Ga0501081_0126159 | 3300049743 | Bacteria | 1826 |
| 522 | Ga0501283_037830 | 3300049779 | Bacteria | 828 |
| 523 | Ga0501035_0550598 | 3300049822 | Bacteria | 945 |
| 524 | Ga0501035_0673387 | 3300049822 | Bacteria | 837 |
| 525 | Ga0501035_0890062 | 3300049822 | Bacteria | 706 |
| 526 | Ga0501045_0012445 | 3300049824 | Bacteria | 5990 |
| 527 | Ga0501045_0039036 | 3300049824 | Bacteria | 3455 |
| 528 | Ga0501045_0108046 | 3300049824 | Bacteria | 2062 |
| 529 | Ga0501045_0260857 | 3300049824 | Bacteria | 1290 |
| 530 | Ga0501045_1035986 | 3300049824 | Bacteria | 601 |
| 531 | nmdc:mga03683_4325_c1 | 3300050489 | Bacteria | 4696 |
| 532 | nmdc:mga00v17_161908_c1 | 3300050491 | Bacteria | 1441 |
| 533 | nmdc:mga0yw44_14693_c1 | 3300050492 | Bacteria | 4167 |
| 534 | nmdc:mga0yw44_397008_c1 | 3300050492 | Bacteria | 932 |
| 535 | nmdc:mga0k408_29325_c1 | 3300050493 | Bacteria | 3131 |
| 536 | nmdc:mga0k408_388294_c1 | 3300050493 | Bacteria | 831 |
| 537 | nmdc:mga06z11_11153_c1 | 3300050494 | Bacteria | 3862 |
| 538 | nmdc:mga04h51_264191_c1 | 3300050495 | Bacteria | 693 |
| 539 | nmdc:mga05p37_126090_c1 | 3300050507 | Bacteria | 3144 |
| 540 | nmdc:mga05p37_1495108_c1 | 3300050507 | Unclassified | 673 |
| 541 | nmdc:mga05p37_169024_c1 | 3300050507 | Bacteria | 2667 |
| 542 | nmdc:mga05p37_188791_c1 | 3300050507 | Bacteria | 2504 |
| 543 | nmdc:mga05p37_232573_c1 | 3300050507 | Bacteria | 2220 |
| 544 | nmdc:mga05p37_285150_c1 | 3300050507 | Bacteria | 1968 |
| 545 | nmdc:mga05p37_44172_c1 | 3300050507 | Bacteria | 5483 |
| 546 | nmdc:mga05p37_445676_c1 | 3300050507 | Bacteria | 1500 |
| 547 | nmdc:mga05p37_601457_c1 | 3300050507 | Bacteria | 1241 |
| 548 | nmdc:mga05p37_77108_c1 | 3300050507 | Bacteria | 4103 |
| 549 | nmdc:mga05p37_82072_c1 | 3300050507 | Bacteria | 3972 |
| 550 | nmdc:mga05p37_92768_c1 | 3300050507 | Bacteria | 3721 |
| 551 | nmdc:mga09592_1277391_c1 | 3300050508 | Bacteria | 604 |
| 552 | nmdc:mga09592_1944_c1 | 3300050508 | Bacteria | 16641 |
| 553 | nmdc:mga09592_51459_c1 | 3300050508 | Bacteria | 3475 |
| 554 | nmdc:mga09592_5317_c1 | 3300050508 | Bacteria | 10464 |
| 555 | nmdc:mga09592_62218_c1 | 3300050508 | Bacteria | 3158 |
| 556 | nmdc:mga09592_70527_c1 | 3300050508 | Bacteria | 2965 |
| 557 | nmdc:mga0qj67_21599_c1 | 3300050509 | Bacteria | 4938 |
| 558 | nmdc:mga0qj67_24924_c1 | 3300050509 | Bacteria | 4616 |
| 559 | nmdc:mga0qj67_385595_c1 | 3300050509 | Bacteria | 1131 |
| 560 | nmdc:mga0qj67_61674_c1 | 3300050509 | Bacteria | 2977 |
| 561 | nmdc:mga06r32_129889_c1 | 3300050510 | Unclassified | 2491 |
| 562 | nmdc:mga06r32_1453367_c1 | 3300050510 | Bacteria | 627 |
| 563 | nmdc:mga06r32_31833_c1 | 3300050510 | Bacteria | 4956 |
| 564 | nmdc:mga06r32_3786_c1 | 3300050510 | Bacteria | 13535 |
| 565 | nmdc:mga06r32_73196_c1 | 3300050510 | Bacteria | 3319 |
| 566 | nmdc:mga08y16_1671183_c1 | 3300050511 | Bacteria | 593 |
| 567 | nmdc:mga08y16_3252_c1 | 3300050511 | Bacteria | 16818 |
| 568 | nmdc:mga08y16_4117_c1 | 3300050511 | Bacteria | 15173 |
| 569 | nmdc:mga08y16_620967_c1 | 3300050511 | Bacteria | 1088 |
| 570 | nmdc:mga08y16_682422_c1 | 3300050511 | Bacteria | 1029 |
| 571 | nmdc:mga08y16_89595_c1 | 3300050511 | Bacteria | 3206 |
| 572 | nmdc:mga0n895_116823_c1 | 3300050512 | Bacteria | 2687 |
| 573 | nmdc:mga0n895_1212401_c1 | 3300050512 | Unclassified | 728 |
| 574 | nmdc:mga0n895_142145_c1 | 3300050512 | Bacteria | 2429 |
| 575 | nmdc:mga0n895_153195_c1 | 3300050512 | Bacteria | 2336 |
| 576 | nmdc:mga0n895_2948_c1 | 3300050512 | Bacteria | 13506 |
| 577 | nmdc:mga0n895_2964_c1 | 3300050512 | Bacteria | 13469 |
| 578 | nmdc:mga0n895_332996_c1 | 3300050512 | Bacteria | 1538 |
| 579 | nmdc:mga0n895_381987_c1 | 3300050512 | Bacteria | 1425 |
| 580 | nmdc:mga0n895_69434_c1 | 3300050512 | Bacteria | 3491 |
| 581 | nmdc:mga0n895_76187_c1 | 3300050512 | Bacteria | 3336 |
| 582 | nmdc:mga0rr50_260551_c1 | 3300050513 | Bacteria | 1443 |
| 583 | nmdc:mga0rr50_27330_c1 | 3300050513 | Bacteria | 3993 |
| 584 | nmdc:mga0rr50_285729_c1 | 3300050513 | Bacteria | 1377 |
| 585 | nmdc:mga0rr50_639080_c1 | 3300050513 | Bacteria | 908 |
| 586 | nmdc:mga0rr50_64492_c1 | 3300050513 | Bacteria | 2771 |
| 587 | nmdc:mga0rr50_72598_c1 | 3300050513 | Bacteria | 2629 |
| 588 | nmdc:mga0rr50_768575_c1 | 3300050513 | Bacteria | 822 |
| 589 | nmdc:mga0rr50_88492_c1 | 3300050513 | Bacteria | 2406 |
| 590 | nmdc:mga08x19_20719_c1 | 3300050514 | Bacteria | 4051 |
| 591 | nmdc:mga08x19_258152_c1 | 3300050514 | Bacteria | 1204 |
| 592 | nmdc:mga0a205_101290_c1 | 3300050515 | Bacteria | 2779 |
| 593 | nmdc:mga0a205_117013_c1 | 3300050515 | Bacteria | 2564 |
| 594 | nmdc:mga0a205_1249047_c1 | 3300050515 | Bacteria | 590 |
| 595 | nmdc:mga0a205_13697_c1 | 3300050515 | Bacteria | 4519 |
| 596 | nmdc:mga0a205_171182_c1 | 3300050515 | Bacteria | 2068 |
| 597 | nmdc:mga0a205_19058_c1 | 3300050515 | Bacteria | 6465 |
| 598 | nmdc:mga0a205_227_c1 | 3300050515 | Bacteria | 39744 |
| 599 | nmdc:mga0a205_29588_c1 | 3300050515 | Bacteria | 5242 |
| 600 | nmdc:mga0a205_6155_c2 | 3300050515 | Bacteria | 7547 |
| 601 | Ga0500628_038703 | 3300053129 | Bacteria | 1078 |
| 602 | Ga0501084_0011395 | 3300054114 | Bacteria | 7362 |
| 603 | Ga0501084_0038939 | 3300054114 | Bacteria | 3976 |
| 604 | Ga0501084_0357875 | 3300054114 | Bacteria | 1233 |
| 605 | Ga0590071_007657 | 3300059421 | Bacteria | 2553 |
| 606 | Ga0590071_039690 | 3300059421 | Bacteria | 1132 |
| 607 | Ga0590074_057642 | 3300059423 | Unclassified | 718 |
| 608 | Ga0590074_060111 | 3300059423 | Unclassified | 705 |
| 609 | Ga0590077_016885 | 3300059426 | Bacteria | 1533 |
| 610 | Ga0590077_166202 | 3300059426 | Bacteria | 530 |
| 611 | Ga0501082_0006260 | 3300060353 | Bacteria | 10330 |
| 612 | Ga0501082_0102762 | 3300060353 | Bacteria | 2472 |
| 613 | Ga0501082_0172268 | 3300060353 | Bacteria | 1882 |
| 614 | Ga0501082_0760070 | 3300060353 | Bacteria | 848 |
| 615 | Ga0501082_1050402 | 3300060353 | Bacteria | 712 |
| 616 | Ga0501082_1200023 | 3300060353 | Bacteria | 663 |
| 617 | Ga0530510_0043766 | 3300061734 | Bacteria | 3234 |
| 618 | Ga0530510_0143827 | 3300061734 | Bacteria | 1758 |
| 619 | Ga0530510_0720243 | 3300061734 | Bacteria | 760 |
| 620 | Ga0530510_1098736 | 3300061734 | Unclassified | 609 |
| 621 | Ga0530510_1101842 | 3300061734 | Bacteria | 608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0157639 | Ga0501040_0157639_1276_1593 | 105 |
| 2 | 3300049593 | Ga0501077_0251614 | Ga0501077_0251614_769_1086 | 105 |
| 3 | 3300049822 | Ga0501035_0890062 | Ga0501035_0890062_348_665 | 105 |
| 4 | 3300044673 | Ga0453683_0006627 | Ga0453683_0006627_2944_3273 | 109 |
| 5 | 3300045051 | Ga0451576_0202386 | Ga0451576_0202386_512_841 | 109 |
| 6 | 3300005440 | Ga0070705_100758454 | Ga0070705_1007584541 | 112 |
| 7 | 3300005471 | Ga0070698_101232879 | Ga0070698_1012328791 | 112 |
| 8 | 3300049574 | Ga0501038_0915208 | Ga0501038_0915208_178_519 | 113 |
| 9 | 3300049575 | Ga0501039_0173819 | Ga0501039_0173819_208_549 | 113 |
| 10 | 3300049575 | Ga0501039_0512239 | Ga0501039_0512239_408_749 | 113 |
| 11 | 3300049576 | Ga0501040_0543082 | Ga0501040_0543082_484_825 | 113 |
| 12 | 3300049577 | Ga0501041_0253643 | Ga0501041_0253643_440_781 | 113 |
| 13 | 3300049582 | Ga0501048_0373761 | Ga0501048_0373761_377_718 | 113 |
| 14 | 3300049584 | Ga0501068_1065086 | Ga0501068_1065086_120_461 | 113 |
| 15 | 3300049588 | Ga0501072_0005285 | Ga0501072_0005285_118_459 | 113 |
| 16 | 3300049588 | Ga0501072_0321762 | Ga0501072_0321762_484_825 | 113 |
| 17 | 3300049741 | Ga0501079_0154988 | Ga0501079_0154988_1351_1692 | 113 |
| 18 | 3300049743 | Ga0501081_0126159 | Ga0501081_0126159_1269_1610 | 113 |
| 19 | 3300049824 | Ga0501045_0039036 | Ga0501045_0039036_924_1265 | 113 |
| 20 | 3300049824 | Ga0501045_1035986 | Ga0501045_1035986_192_533 | 113 |
| 21 | 3300054114 | Ga0501084_0038939 | Ga0501084_0038939_2000_2341 | 113 |
| 22 | 3300060353 | Ga0501082_1050402 | Ga0501082_1050402_224_565 | 113 |
| 23 | 3300061734 | Ga0530510_0143827 | Ga0530510_0143827_54_395 | 113 |
| 24 | 3300061734 | Ga0530510_1101842 | Ga0530510_1101842_102_443 | 113 |
| 25 | 3300050492 | nmdc:mga0yw44_14693_c1 | nmdc:mga0yw44_14693_c1_741_1088 | 114 |
| 26 | 3300050493 | nmdc:mga0k408_388294_c1 | nmdc:mga0k408_388294_c1_425_772 | 114 |
| 27 | 3300050511 | nmdc:mga08y16_1671183_c1 | nmdc:mga08y16_1671183_c1_51_398 | 114 |
| 28 | 3300009148 | Ga0105243_10060967 | Ga0105243_100609672 | 115 |
| 29 | 3300009174 | Ga0105241_10001410 | Ga0105241_100014105 | 115 |
| 30 | 3300009177 | Ga0105248_10098036 | Ga0105248_100980363 | 115 |
| 31 | 3300009545 | Ga0105237_10211607 | Ga0105237_102116072 | 115 |
| 32 | 3300009553 | Ga0105249_10716842 | Ga0105249_107168421 | 115 |
| 33 | 3300010375 | Ga0105239_12007369 | Ga0105239_120073691 | 115 |
| 34 | 3300011119 | Ga0105246_10014486 | Ga0105246_100144864 | 115 |
| 35 | 3300013100 | Ga0157373_10015786 | Ga0157373_100157868 | 115 |
| 36 | 3300013104 | Ga0157370_10308851 | Ga0157370_103088512 | 115 |
| 37 | 3300013105 | Ga0157369_10059275 | Ga0157369_100592752 | 115 |
| 38 | 3300013297 | Ga0157378_10192904 | Ga0157378_101929041 | 115 |
| 39 | 3300013306 | Ga0163162_10215621 | Ga0163162_102156212 | 115 |
| 40 | 3300013307 | Ga0157372_10006472 | Ga0157372_1000647211 | 115 |
| 41 | 3300013308 | Ga0157375_10028617 | Ga0157375_100286174 | 115 |
| 42 | 3300014325 | Ga0163163_10057404 | Ga0163163_100574045 | 115 |
| 43 | 3300015262 | Ga0182007_10019299 | Ga0182007_100192993 | 115 |
| 44 | 3300034819 | Ga0373958_0048345 | Ga0373958_0048345_415_813 | 115 |
| 45 | 3300035090 | Ga0373949_0003943 | Ga0373949_0003943_1166_1564 | 115 |
| 46 | 3300035091 | Ga0373951_0018714 | Ga0373951_0018714_89_487 | 115 |
| 47 | 3300035092 | Ga0373952_0252156 | Ga0373952_0252156_47_445 | 115 |
| 48 | 3300035241 | Ga0373961_0007012 | Ga0373961_0007012_600_998 | 115 |
| 49 | 3300038996 | Ga0242420_071388 | Ga0242420_071388_228_626 | 115 |
| 50 | 3300042005 | Ga0439448_0085059 | Ga0439448_0085059_300_698 | 115 |
| 51 | 3300042130 | Ga0450892_012774 | Ga0450892_012774_22_420 | 115 |
| 52 | 3300042157 | Ga0439458_0002241 | Ga0439458_0002241_2480_2878 | 115 |
| 53 | 3300042438 | Ga0439459_0027302 | Ga0439459_0027302_207_605 | 115 |
| 54 | 3300042876 | Ga0451577_0052534 | Ga0451577_0052534_2671_3069 | 115 |
| 55 | 3300044712 | Ga0453684_0222177 | Ga0453684_0222177_823_1221 | 115 |
| 56 | 3300045051 | Ga0451576_0005764 | Ga0451576_0005764_12414_12812 | 115 |
| 57 | 3300048905 | Ga0496102_0034348 | Ga0496102_0034348_2449_2847 | 115 |
| 58 | 3300048909 | Ga0496106_0326302 | Ga0496106_0326302_492_890 | 115 |
| 59 | 3300048913 | Ga0496110_0144539 | Ga0496110_0144539_1459_1857 | 115 |
| 60 | 3300048916 | Ga0496113_0141061 | Ga0496113_0141061_330_728 | 115 |
| 61 | 3300050507 | nmdc:mga05p37_126090_c1 | nmdc:mga05p37_126090_c1_763_1161 | 115 |
| 62 | 3300050513 | nmdc:mga0rr50_27330_c1 | nmdc:mga0rr50_27330_c1_1683_2081 | 115 |
| 63 | 3300050515 | nmdc:mga0a205_19058_c1 | nmdc:mga0a205_19058_c1_4573_4971 | 115 |
| 64 | 3300005616 | Ga0068852_101628962 | Ga0068852_1016289622 | 116 |
| 65 | 3300005617 | Ga0068859_100849413 | Ga0068859_1008494132 | 116 |
| 66 | 3300005618 | Ga0068864_100586032 | Ga0068864_1005860322 | 116 |
| 67 | 3300005841 | Ga0068863_101062833 | Ga0068863_1010628332 | 116 |
| 68 | 3300006931 | Ga0097620_100849497 | Ga0097620_1008494972 | 116 |
| 69 | 3300009094 | Ga0111539_10308850 | Ga0111539_103088501 | 116 |
| 70 | 3300014326 | Ga0157380_11659355 | Ga0157380_116593552 | 116 |
| 71 | 3300026095 | Ga0207676_10843490 | Ga0207676_108434902 | 116 |
| 72 | 3300027907 | Ga0207428_10220260 | Ga0207428_102202602 | 116 |
| 73 | 3300050511 | nmdc:mga08y16_682422_c1 | nmdc:mga08y16_682422_c1_47_400 | 116 |
| 74 | 3300003203 | JGI25406J46586_10002893 | JGI25406J46586_100028932 | 117 |
| 75 | 3300005290 | Ga0065712_10003667 | Ga0065712_100036676 | 117 |
| 76 | 3300005293 | Ga0065715_10009447 | Ga0065715_100094472 | 117 |
| 77 | 3300005293 | Ga0065715_10093719 | Ga0065715_100937193 | 117 |
| 78 | 3300005293 | Ga0065715_10118663 | Ga0065715_101186632 | 117 |
| 79 | 3300005295 | Ga0065707_10207494 | Ga0065707_102074942 | 117 |
| 80 | 3300005328 | Ga0070676_10006734 | Ga0070676_100067344 | 117 |
| 81 | 3300005329 | Ga0070683_100014312 | Ga0070683_1000143126 | 117 |
| 82 | 3300005331 | Ga0070670_100019360 | Ga0070670_1000193605 | 117 |
| 83 | 3300005331 | Ga0070670_100491031 | Ga0070670_1004910312 | 117 |
| 84 | 3300005334 | Ga0068869_100001496 | Ga0068869_10000149615 | 117 |
| 85 | 3300005334 | Ga0068869_100136433 | Ga0068869_1001364332 | 117 |
| 86 | 3300005334 | Ga0068869_100160277 | Ga0068869_1001602772 | 117 |
| 87 | 3300005334 | Ga0068869_101054158 | Ga0068869_1010541582 | 117 |
| 88 | 3300005336 | Ga0070680_100000934 | Ga0070680_10000093420 | 117 |
| 89 | 3300005336 | Ga0070680_100111435 | Ga0070680_1001114352 | 117 |
| 90 | 3300005336 | Ga0070680_100282995 | Ga0070680_1002829952 | 117 |
| 91 | 3300005337 | Ga0070682_100001865 | Ga0070682_10000186511 | 117 |
| 92 | 3300005338 | Ga0068868_100044648 | Ga0068868_1000446481 | 117 |
| 93 | 3300005338 | Ga0068868_100938710 | Ga0068868_1009387102 | 117 |
| 94 | 3300005339 | Ga0070660_100024523 | Ga0070660_1000245232 | 117 |
| 95 | 3300005340 | Ga0070689_100736688 | Ga0070689_1007366882 | 117 |
| 96 | 3300005340 | Ga0070689_101620204 | Ga0070689_1016202041 | 117 |
| 97 | 3300005341 | Ga0070691_10002071 | Ga0070691_100020719 | 117 |
| 98 | 3300005341 | Ga0070691_10330860 | Ga0070691_103308602 | 117 |
| 99 | 3300005343 | Ga0070687_100140453 | Ga0070687_1001404533 | 117 |
| 100 | 3300005343 | Ga0070687_100330650 | Ga0070687_1003306502 | 117 |
| 101 | 3300005344 | Ga0070661_100000211 | Ga0070661_10000021110 | 117 |
| 102 | 3300005345 | Ga0070692_10002475 | Ga0070692_100024756 | 117 |
| 103 | 3300005345 | Ga0070692_10368949 | Ga0070692_103689491 | 117 |
| 104 | 3300005345 | Ga0070692_10535573 | Ga0070692_105355731 | 117 |
| 105 | 3300005347 | Ga0070668_100079796 | Ga0070668_1000797963 | 117 |
| 106 | 3300005347 | Ga0070668_100160833 | Ga0070668_1001608332 | 117 |
| 107 | 3300005347 | Ga0070668_100391262 | Ga0070668_1003912621 | 117 |
| 108 | 3300005353 | Ga0070669_100019045 | Ga0070669_1000190452 | 117 |
| 109 | 3300005353 | Ga0070669_100020540 | Ga0070669_1000205404 | 117 |
| 110 | 3300005353 | Ga0070669_100088728 | Ga0070669_1000887282 | 117 |
| 111 | 3300005354 | Ga0070675_100309347 | Ga0070675_1003093471 | 117 |
| 112 | 3300005355 | Ga0070671_101362795 | Ga0070671_1013627951 | 117 |
| 113 | 3300005364 | Ga0070673_100022870 | Ga0070673_1000228703 | 117 |
| 114 | 3300005364 | Ga0070673_101392182 | Ga0070673_1013921822 | 117 |
| 115 | 3300005365 | Ga0070688_101703130 | Ga0070688_1017031302 | 117 |
| 116 | 3300005366 | Ga0070659_100001505 | Ga0070659_1000015058 | 117 |
| 117 | 3300005366 | Ga0070659_100876943 | Ga0070659_1008769432 | 117 |
| 118 | 3300005367 | Ga0070667_100088984 | Ga0070667_1000889843 | 117 |
| 119 | 3300005367 | Ga0070667_100993799 | Ga0070667_1009937992 | 117 |
| 120 | 3300005406 | Ga0070703_10028898 | Ga0070703_100288982 | 117 |
| 121 | 3300005406 | Ga0070703_10114460 | Ga0070703_101144602 | 117 |
| 122 | 3300005406 | Ga0070703_10213748 | Ga0070703_102137482 | 117 |
| 123 | 3300005406 | Ga0070703_10389540 | Ga0070703_103895401 | 117 |
| 124 | 3300005438 | Ga0070701_10490662 | Ga0070701_104906622 | 117 |
| 125 | 3300005438 | Ga0070701_10637470 | Ga0070701_106374701 | 117 |
| 126 | 3300005439 | Ga0070711_100337382 | Ga0070711_1003373822 | 117 |
| 127 | 3300005440 | Ga0070705_100005391 | Ga0070705_10000539110 | 117 |
| 128 | 3300005440 | Ga0070705_100018832 | Ga0070705_1000188322 | 117 |
| 129 | 3300005440 | Ga0070705_100161089 | Ga0070705_1001610893 | 117 |
| 130 | 3300005440 | Ga0070705_100767238 | Ga0070705_1007672381 | 117 |
| 131 | 3300005441 | Ga0070700_100247920 | Ga0070700_1002479201 | 117 |
| 132 | 3300005444 | Ga0070694_100003319 | Ga0070694_1000033198 | 117 |
| 133 | 3300005444 | Ga0070694_100021019 | Ga0070694_1000210192 | 117 |
| 134 | 3300005444 | Ga0070694_100196049 | Ga0070694_1001960492 | 117 |
| 135 | 3300005444 | Ga0070694_100551631 | Ga0070694_1005516312 | 117 |
| 136 | 3300005444 | Ga0070694_100994426 | Ga0070694_1009944262 | 117 |
| 137 | 3300005445 | Ga0070708_100201245 | Ga0070708_1002012451 | 117 |
| 138 | 3300005445 | Ga0070708_100400239 | Ga0070708_1004002391 | 117 |
| 139 | 3300005445 | Ga0070708_100875009 | Ga0070708_1008750092 | 117 |
| 140 | 3300005445 | Ga0070708_100900046 | Ga0070708_1009000461 | 117 |
| 141 | 3300005445 | Ga0070708_101080412 | Ga0070708_1010804122 | 117 |
| 142 | 3300005455 | Ga0070663_100026467 | Ga0070663_1000264672 | 117 |
| 143 | 3300005457 | Ga0070662_100286622 | Ga0070662_1002866221 | 117 |
| 144 | 3300005457 | Ga0070662_100638521 | Ga0070662_1006385212 | 117 |
| 145 | 3300005458 | Ga0070681_10062390 | Ga0070681_100623905 | 117 |
| 146 | 3300005458 | Ga0070681_10247040 | Ga0070681_102470401 | 117 |
| 147 | 3300005459 | Ga0068867_100006675 | Ga0068867_1000066752 | 117 |
| 148 | 3300005459 | Ga0068867_100283723 | Ga0068867_1002837233 | 117 |
| 149 | 3300005459 | Ga0068867_100475128 | Ga0068867_1004751282 | 117 |
| 150 | 3300005459 | Ga0068867_101650454 | Ga0068867_1016504541 | 117 |
| 151 | 3300005467 | Ga0070706_100035858 | Ga0070706_1000358583 | 117 |
| 152 | 3300005467 | Ga0070706_100095440 | Ga0070706_1000954403 | 117 |
| 153 | 3300005467 | Ga0070706_100832164 | Ga0070706_1008321642 | 117 |
| 154 | 3300005467 | Ga0070706_100949681 | Ga0070706_1009496811 | 117 |
| 155 | 3300005468 | Ga0070707_100076882 | Ga0070707_1000768824 | 117 |
| 156 | 3300005468 | Ga0070707_100231760 | Ga0070707_1002317602 | 117 |
| 157 | 3300005468 | Ga0070707_100646572 | Ga0070707_1006465722 | 117 |
| 158 | 3300005468 | Ga0070707_100832395 | Ga0070707_1008323952 | 117 |
| 159 | 3300005468 | Ga0070707_101085066 | Ga0070707_1010850662 | 117 |
| 160 | 3300005471 | Ga0070698_100035071 | Ga0070698_1000350714 | 117 |
| 161 | 3300005471 | Ga0070698_100195389 | Ga0070698_1001953891 | 117 |
| 162 | 3300005471 | Ga0070698_101036465 | Ga0070698_1010364652 | 117 |
| 163 | 3300005518 | Ga0070699_100008025 | Ga0070699_1000080259 | 117 |
| 164 | 3300005518 | Ga0070699_100064987 | Ga0070699_1000649874 | 117 |
| 165 | 3300005518 | Ga0070699_100091594 | Ga0070699_1000915944 | 117 |
| 166 | 3300005518 | Ga0070699_100541622 | Ga0070699_1005416221 | 117 |
| 167 | 3300005530 | Ga0070679_100008274 | Ga0070679_10000827412 | 117 |
| 168 | 3300005535 | Ga0070684_100072662 | Ga0070684_1000726623 | 117 |
| 169 | 3300005536 | Ga0070697_100008644 | Ga0070697_1000086443 | 117 |
| 170 | 3300005536 | Ga0070697_100085434 | Ga0070697_1000854342 | 117 |
| 171 | 3300005536 | Ga0070697_100139504 | Ga0070697_1001395042 | 117 |
| 172 | 3300005536 | Ga0070697_100248301 | Ga0070697_1002483013 | 117 |
| 173 | 3300005536 | Ga0070697_100883483 | Ga0070697_1008834831 | 117 |
| 174 | 3300005536 | Ga0070697_100980987 | Ga0070697_1009809871 | 117 |
| 175 | 3300005536 | Ga0070697_101228978 | Ga0070697_1012289781 | 117 |
| 176 | 3300005539 | Ga0068853_100000678 | Ga0068853_10000067820 | 117 |
| 177 | 3300005539 | Ga0068853_101244189 | Ga0068853_1012441892 | 117 |
| 178 | 3300005539 | Ga0068853_101876163 | Ga0068853_1018761632 | 117 |
| 179 | 3300005543 | Ga0070672_100050763 | Ga0070672_1000507632 | 117 |
| 180 | 3300005543 | Ga0070672_100176944 | Ga0070672_1001769443 | 117 |
| 181 | 3300005544 | Ga0070686_100448179 | Ga0070686_1004481792 | 117 |
| 182 | 3300005544 | Ga0070686_100933752 | Ga0070686_1009337522 | 117 |
| 183 | 3300005545 | Ga0070695_100002498 | Ga0070695_1000024981 | 117 |
| 184 | 3300005545 | Ga0070695_100005383 | Ga0070695_1000053834 | 117 |
| 185 | 3300005545 | Ga0070695_100199280 | Ga0070695_1001992802 | 117 |
| 186 | 3300005545 | Ga0070695_100224007 | Ga0070695_1002240073 | 117 |
| 187 | 3300005546 | Ga0070696_100091216 | Ga0070696_1000912162 | 117 |
| 188 | 3300005546 | Ga0070696_100335766 | Ga0070696_1003357662 | 117 |
| 189 | 3300005546 | Ga0070696_100769995 | Ga0070696_1007699952 | 117 |
| 190 | 3300005546 | Ga0070696_101158797 | Ga0070696_1011587972 | 117 |
| 191 | 3300005547 | Ga0070693_100000189 | Ga0070693_10000018919 | 117 |
| 192 | 3300005547 | Ga0070693_100214766 | Ga0070693_1002147662 | 117 |
| 193 | 3300005549 | Ga0070704_100001133 | Ga0070704_1000011339 | 117 |
| 194 | 3300005549 | Ga0070704_100006591 | Ga0070704_1000065914 | 117 |
| 195 | 3300005549 | Ga0070704_100226172 | Ga0070704_1002261722 | 117 |
| 196 | 3300005549 | Ga0070704_100295349 | Ga0070704_1002953492 | 117 |
| 197 | 3300005549 | Ga0070704_100330325 | Ga0070704_1003303252 | 117 |
| 198 | 3300005563 | Ga0068855_100015121 | Ga0068855_1000151219 | 117 |
| 199 | 3300005563 | Ga0068855_100967163 | Ga0068855_1009671632 | 117 |
| 200 | 3300005564 | Ga0070664_100012522 | Ga0070664_1000125223 | 117 |
| 201 | 3300005564 | Ga0070664_100445210 | Ga0070664_1004452102 | 117 |
| 202 | 3300005577 | Ga0068857_100046341 | Ga0068857_1000463414 | 117 |
| 203 | 3300005578 | Ga0068854_100002061 | Ga0068854_1000020617 | 117 |
| 204 | 3300005614 | Ga0068856_100008288 | Ga0068856_10000828810 | 117 |
| 205 | 3300005615 | Ga0070702_100191925 | Ga0070702_1001919253 | 117 |
| 206 | 3300005617 | Ga0068859_100906665 | Ga0068859_1009066652 | 117 |
| 207 | 3300005618 | Ga0068864_100021673 | Ga0068864_1000216731 | 117 |
| 208 | 3300005618 | Ga0068864_100206245 | Ga0068864_1002062452 | 117 |
| 209 | 3300005618 | Ga0068864_100332396 | Ga0068864_1003323962 | 117 |
| 210 | 3300005718 | Ga0068866_10161459 | Ga0068866_101614592 | 117 |
| 211 | 3300005719 | Ga0068861_100006876 | Ga0068861_1000068769 | 117 |
| 212 | 3300005719 | Ga0068861_100291751 | Ga0068861_1002917512 | 117 |
| 213 | 3300005719 | Ga0068861_100772554 | Ga0068861_1007725542 | 117 |
| 214 | 3300005840 | Ga0068870_10007619 | Ga0068870_100076194 | 117 |
| 215 | 3300005840 | Ga0068870_10626455 | Ga0068870_106264552 | 117 |
| 216 | 3300005841 | Ga0068863_100005815 | Ga0068863_10000581510 | 117 |
| 217 | 3300005841 | Ga0068863_100168455 | Ga0068863_1001684553 | 117 |
| 218 | 3300005841 | Ga0068863_100314327 | Ga0068863_1003143272 | 117 |
| 219 | 3300005842 | Ga0068858_100076039 | Ga0068858_1000760392 | 117 |
| 220 | 3300005843 | Ga0068860_100004587 | Ga0068860_10000458711 | 117 |
| 221 | 3300005843 | Ga0068860_100042805 | Ga0068860_1000428056 | 117 |
| 222 | 3300005843 | Ga0068860_100231057 | Ga0068860_1002310573 | 117 |
| 223 | 3300005844 | Ga0068862_100015431 | Ga0068862_1000154318 | 117 |
| 224 | 3300005844 | Ga0068862_100117879 | Ga0068862_1001178795 | 117 |
| 225 | 3300005844 | Ga0068862_101286944 | Ga0068862_1012869441 | 117 |
| 226 | 3300005844 | Ga0068862_101617789 | Ga0068862_1016177891 | 117 |
| 227 | 3300005937 | Ga0081455_10022244 | Ga0081455_100222447 | 117 |
| 228 | 3300005985 | Ga0081539_10000096 | Ga0081539_1000009694 | 117 |
| 229 | 3300006038 | Ga0075365_10025483 | Ga0075365_100254831 | 117 |
| 230 | 3300006038 | Ga0075365_10321702 | Ga0075365_103217022 | 117 |
| 231 | 3300006038 | Ga0075365_10322661 | Ga0075365_103226612 | 117 |
| 232 | 3300006051 | Ga0075364_10029608 | Ga0075364_100296085 | 117 |
| 233 | 3300006051 | Ga0075364_10217964 | Ga0075364_102179642 | 117 |
| 234 | 3300006058 | Ga0075432_10416544 | Ga0075432_104165441 | 117 |
| 235 | 3300006175 | Ga0070712_100018868 | Ga0070712_1000188685 | 117 |
| 236 | 3300006177 | Ga0075362_10000233 | Ga0075362_1000023312 | 117 |
| 237 | 3300006178 | Ga0075367_10533041 | Ga0075367_105330412 | 117 |
| 238 | 3300006195 | Ga0075366_10039306 | Ga0075366_100393062 | 117 |
| 239 | 3300006195 | Ga0075366_10826849 | Ga0075366_108268492 | 117 |
| 240 | 3300006237 | Ga0097621_100444164 | Ga0097621_1004441642 | 117 |
| 241 | 3300006844 | Ga0075428_100003167 | Ga0075428_1000031679 | 117 |
| 242 | 3300006844 | Ga0075428_100026308 | Ga0075428_1000263084 | 117 |
| 243 | 3300006844 | Ga0075428_100115170 | Ga0075428_1001151704 | 117 |
| 244 | 3300006844 | Ga0075428_100136489 | Ga0075428_1001364892 | 117 |
| 245 | 3300006844 | Ga0075428_100900045 | Ga0075428_1009000452 | 117 |
| 246 | 3300006844 | Ga0075428_101425780 | Ga0075428_1014257802 | 117 |
| 247 | 3300006846 | Ga0075430_100000404 | Ga0075430_1000004046 | 117 |
| 248 | 3300006846 | Ga0075430_100044512 | Ga0075430_1000445124 | 117 |
| 249 | 3300006846 | Ga0075430_100143064 | Ga0075430_1001430641 | 117 |
| 250 | 3300006846 | Ga0075430_100269876 | Ga0075430_1002698762 | 117 |
| 251 | 3300006847 | Ga0075431_100000082 | Ga0075431_10000008219 | 117 |
| 252 | 3300006847 | Ga0075431_100001936 | Ga0075431_10000193611 | 117 |
| 253 | 3300006847 | Ga0075431_100049839 | Ga0075431_1000498396 | 117 |
| 254 | 3300006847 | Ga0075431_100338939 | Ga0075431_1003389392 | 117 |
| 255 | 3300006847 | Ga0075431_101165949 | Ga0075431_1011659492 | 117 |
| 256 | 3300006852 | Ga0075433_10000427 | Ga0075433_1000042730 | 117 |
| 257 | 3300006852 | Ga0075433_10010989 | Ga0075433_100109897 | 117 |
| 258 | 3300006852 | Ga0075433_10034070 | Ga0075433_100340705 | 117 |
| 259 | 3300006852 | Ga0075433_10039794 | Ga0075433_100397944 | 117 |
| 260 | 3300006852 | Ga0075433_10069763 | Ga0075433_100697633 | 117 |
| 261 | 3300006852 | Ga0075433_10075186 | Ga0075433_100751864 | 117 |
| 262 | 3300006852 | Ga0075433_10252706 | Ga0075433_102527063 | 117 |
| 263 | 3300006852 | Ga0075433_10358859 | Ga0075433_103588592 | 117 |
| 264 | 3300006871 | Ga0075434_100000180 | Ga0075434_1000001808 | 117 |
| 265 | 3300006871 | Ga0075434_100104105 | Ga0075434_1001041054 | 117 |
| 266 | 3300006871 | Ga0075434_100162184 | Ga0075434_1001621842 | 117 |
| 267 | 3300006871 | Ga0075434_100224438 | Ga0075434_1002244383 | 117 |
| 268 | 3300006871 | Ga0075434_100279243 | Ga0075434_1002792433 | 117 |
| 269 | 3300006871 | Ga0075434_100545263 | Ga0075434_1005452632 | 117 |
| 270 | 3300006871 | Ga0075434_100957100 | Ga0075434_1009571002 | 117 |
| 271 | 3300006871 | Ga0075434_101172210 | Ga0075434_1011722102 | 117 |
| 272 | 3300006880 | Ga0075429_100002106 | Ga0075429_1000021068 | 117 |
| 273 | 3300006880 | Ga0075429_100002856 | Ga0075429_1000028565 | 117 |
| 274 | 3300006880 | Ga0075429_100016759 | Ga0075429_1000167594 | 117 |
| 275 | 3300006880 | Ga0075429_100031684 | Ga0075429_1000316842 | 117 |
| 276 | 3300006880 | Ga0075429_100127202 | Ga0075429_1001272023 | 117 |
| 277 | 3300006881 | Ga0068865_100286646 | Ga0068865_1002866462 | 117 |
| 278 | 3300006914 | Ga0075436_100023165 | Ga0075436_1000231653 | 117 |
| 279 | 3300006914 | Ga0075436_100034917 | Ga0075436_1000349174 | 117 |
| 280 | 3300006914 | Ga0075436_100286513 | Ga0075436_1002865133 | 117 |
| 281 | 3300006931 | Ga0097620_100906662 | Ga0097620_1009066622 | 117 |
| 282 | 3300007076 | Ga0075435_100045243 | Ga0075435_1000452434 | 117 |
| 283 | 3300007076 | Ga0075435_100059789 | Ga0075435_1000597892 | 117 |
| 284 | 3300007076 | Ga0075435_100067064 | Ga0075435_1000670643 | 117 |
| 285 | 3300007076 | Ga0075435_100069510 | Ga0075435_1000695103 | 117 |
| 286 | 3300007076 | Ga0075435_100161323 | Ga0075435_1001613234 | 117 |
| 287 | 3300007076 | Ga0075435_100241170 | Ga0075435_1002411702 | 117 |
| 288 | 3300007076 | Ga0075435_100488659 | Ga0075435_1004886592 | 117 |
| 289 | 3300007076 | Ga0075435_100637335 | Ga0075435_1006373352 | 117 |
| 290 | 3300007076 | Ga0075435_101232754 | Ga0075435_1012327542 | 117 |
| 291 | 3300007265 | Ga0099794_10011283 | Ga0099794_100112832 | 117 |
| 292 | 3300007265 | Ga0099794_10038325 | Ga0099794_100383254 | 117 |
| 293 | 3300007265 | Ga0099794_10359180 | Ga0099794_103591802 | 117 |
| 294 | 3300007265 | Ga0099794_10430881 | Ga0099794_104308812 | 117 |
| 295 | 3300009094 | Ga0111539_10001292 | Ga0111539_1000129219 | 117 |
| 296 | 3300009094 | Ga0111539_10001353 | Ga0111539_1000135324 | 117 |
| 297 | 3300009094 | Ga0111539_10012644 | Ga0111539_100126444 | 117 |
| 298 | 3300009094 | Ga0111539_10586624 | Ga0111539_105866242 | 117 |
| 299 | 3300009094 | Ga0111539_10695151 | Ga0111539_106951512 | 117 |
| 300 | 3300009147 | Ga0114129_10000110 | Ga0114129_1000011043 | 117 |
| 301 | 3300009147 | Ga0114129_10086949 | Ga0114129_100869492 | 117 |
| 302 | 3300009147 | Ga0114129_10096779 | Ga0114129_100967792 | 117 |
| 303 | 3300009147 | Ga0114129_10106434 | Ga0114129_101064343 | 117 |
| 304 | 3300009147 | Ga0114129_10202186 | Ga0114129_102021864 | 117 |
| 305 | 3300009147 | Ga0114129_10321107 | Ga0114129_103211073 | 117 |
| 306 | 3300009147 | Ga0114129_10657937 | Ga0114129_106579372 | 117 |
| 307 | 3300009147 | Ga0114129_11189838 | Ga0114129_111898382 | 117 |
| 308 | 3300009147 | Ga0114129_11219606 | Ga0114129_112196062 | 117 |
| 309 | 3300009147 | Ga0114129_11671934 | Ga0114129_116719342 | 117 |
| 310 | 3300009147 | Ga0114129_12576384 | Ga0114129_125763841 | 117 |
| 311 | 3300009147 | Ga0114129_13026216 | Ga0114129_130262161 | 117 |
| 312 | 3300009148 | Ga0105243_11799387 | Ga0105243_117993871 | 117 |
| 313 | 3300009176 | Ga0105242_10623388 | Ga0105242_106233882 | 117 |
| 314 | 3300009553 | Ga0105249_10813350 | Ga0105249_108133502 | 117 |
| 315 | 3300009553 | Ga0105249_12452720 | Ga0105249_124527201 | 117 |
| 316 | 3300010375 | Ga0105239_10952802 | Ga0105239_109528022 | 117 |
| 317 | 3300013102 | Ga0157371_10234753 | Ga0157371_102347533 | 117 |
| 318 | 3300013297 | Ga0157378_10135169 | Ga0157378_101351692 | 117 |
| 319 | 3300013306 | Ga0163162_10036717 | Ga0163162_100367176 | 117 |
| 320 | 3300013308 | Ga0157375_10803431 | Ga0157375_108034312 | 117 |
| 321 | 3300014325 | Ga0163163_11491609 | Ga0163163_114916092 | 117 |
| 322 | 3300014326 | Ga0157380_10643578 | Ga0157380_106435782 | 117 |
| 323 | 3300014326 | Ga0157380_10894460 | Ga0157380_108944601 | 117 |
| 324 | 3300014326 | Ga0157380_11200699 | Ga0157380_112006991 | 117 |
| 325 | 3300014326 | Ga0157380_12434014 | Ga0157380_124340141 | 117 |
| 326 | 3300025885 | Ga0207653_10001516 | Ga0207653_100015162 | 117 |
| 327 | 3300025899 | Ga0207642_10159378 | Ga0207642_101593783 | 117 |
| 328 | 3300025904 | Ga0207647_10032509 | Ga0207647_100325092 | 117 |
| 329 | 3300025904 | Ga0207647_10114886 | Ga0207647_101148862 | 117 |
| 330 | 3300025904 | Ga0207647_10126024 | Ga0207647_101260242 | 117 |
| 331 | 3300025907 | Ga0207645_10000400 | Ga0207645_1000040021 | 117 |
| 332 | 3300025908 | Ga0207643_10000424 | Ga0207643_1000042416 | 117 |
| 333 | 3300025910 | Ga0207684_10040466 | Ga0207684_100404661 | 117 |
| 334 | 3300025910 | Ga0207684_10067040 | Ga0207684_100670405 | 117 |
| 335 | 3300025910 | Ga0207684_10168420 | Ga0207684_101684202 | 117 |
| 336 | 3300025910 | Ga0207684_10668124 | Ga0207684_106681242 | 117 |
| 337 | 3300025911 | Ga0207654_10002440 | Ga0207654_100024405 | 117 |
| 338 | 3300025911 | Ga0207654_11033238 | Ga0207654_110332381 | 117 |
| 339 | 3300025912 | Ga0207707_10000116 | Ga0207707_1000011637 | 117 |
| 340 | 3300025912 | Ga0207707_10068879 | Ga0207707_100688795 | 117 |
| 341 | 3300025912 | Ga0207707_11078509 | Ga0207707_110785092 | 117 |
| 342 | 3300025915 | Ga0207693_10141026 | Ga0207693_101410263 | 117 |
| 343 | 3300025916 | Ga0207663_10161883 | Ga0207663_101618832 | 117 |
| 344 | 3300025917 | Ga0207660_10003214 | Ga0207660_1000321412 | 117 |
| 345 | 3300025917 | Ga0207660_10111790 | Ga0207660_101117902 | 117 |
| 346 | 3300025917 | Ga0207660_10516419 | Ga0207660_105164192 | 117 |
| 347 | 3300025919 | Ga0207657_10000211 | Ga0207657_1000021126 | 117 |
| 348 | 3300025920 | Ga0207649_10001872 | Ga0207649_1000187212 | 117 |
| 349 | 3300025921 | Ga0207652_10003841 | Ga0207652_100038411 | 117 |
| 350 | 3300025922 | Ga0207646_10021998 | Ga0207646_100219984 | 117 |
| 351 | 3300025922 | Ga0207646_10082210 | Ga0207646_100822103 | 117 |
| 352 | 3300025922 | Ga0207646_10316445 | Ga0207646_103164451 | 117 |
| 353 | 3300025922 | Ga0207646_11245015 | Ga0207646_112450152 | 117 |
| 354 | 3300025923 | Ga0207681_10040372 | Ga0207681_100403722 | 117 |
| 355 | 3300025925 | Ga0207650_10005754 | Ga0207650_100057546 | 117 |
| 356 | 3300025927 | Ga0207687_10537379 | Ga0207687_105373792 | 117 |
| 357 | 3300025931 | Ga0207644_10069716 | Ga0207644_100697163 | 117 |
| 358 | 3300025932 | Ga0207690_10001495 | Ga0207690_1000149514 | 117 |
| 359 | 3300025932 | Ga0207690_10708204 | Ga0207690_107082042 | 117 |
| 360 | 3300025933 | Ga0207706_10002411 | Ga0207706_1000241120 | 117 |
| 361 | 3300025933 | Ga0207706_10243256 | Ga0207706_102432562 | 117 |
| 362 | 3300025935 | Ga0207709_10068840 | Ga0207709_100688403 | 117 |
| 363 | 3300025936 | Ga0207670_10198564 | Ga0207670_101985642 | 117 |
| 364 | 3300025936 | Ga0207670_10241411 | Ga0207670_102414113 | 117 |
| 365 | 3300025938 | Ga0207704_10223450 | Ga0207704_102234502 | 117 |
| 366 | 3300025938 | Ga0207704_10439741 | Ga0207704_104397412 | 117 |
| 367 | 3300025938 | Ga0207704_10831932 | Ga0207704_108319321 | 117 |
| 368 | 3300025940 | Ga0207691_10009557 | Ga0207691_100095574 | 117 |
| 369 | 3300025940 | Ga0207691_10044674 | Ga0207691_100446743 | 117 |
| 370 | 3300025941 | Ga0207711_11213804 | Ga0207711_112138042 | 117 |
| 371 | 3300025941 | Ga0207711_11454070 | Ga0207711_114540702 | 117 |
| 372 | 3300025942 | Ga0207689_10000201 | Ga0207689_1000020137 | 117 |
| 373 | 3300025942 | Ga0207689_10006142 | Ga0207689_100061422 | 117 |
| 374 | 3300025942 | Ga0207689_10487208 | Ga0207689_104872082 | 117 |
| 375 | 3300025942 | Ga0207689_11358503 | Ga0207689_113585031 | 117 |
| 376 | 3300025944 | Ga0207661_10116000 | Ga0207661_101160002 | 117 |
| 377 | 3300025949 | Ga0207667_10000342 | Ga0207667_1000034210 | 117 |
| 378 | 3300025960 | Ga0207651_10256909 | Ga0207651_102569092 | 117 |
| 379 | 3300025961 | Ga0207712_10193760 | Ga0207712_101937603 | 117 |
| 380 | 3300025961 | Ga0207712_10540514 | Ga0207712_105405142 | 117 |
| 381 | 3300025961 | Ga0207712_10624758 | Ga0207712_106247582 | 117 |
| 382 | 3300025961 | Ga0207712_11248727 | Ga0207712_112487272 | 117 |
| 383 | 3300025972 | Ga0207668_10168930 | Ga0207668_101689302 | 117 |
| 384 | 3300025981 | Ga0207640_10005238 | Ga0207640_100052384 | 117 |
| 385 | 3300025986 | Ga0207658_11099868 | Ga0207658_110998682 | 117 |
| 386 | 3300026023 | Ga0207677_10046871 | Ga0207677_100468715 | 117 |
| 387 | 3300026023 | Ga0207677_11520584 | Ga0207677_115205842 | 117 |
| 388 | 3300026035 | Ga0207703_11282773 | Ga0207703_112827731 | 117 |
| 389 | 3300026041 | Ga0207639_10010274 | Ga0207639_100102745 | 117 |
| 390 | 3300026041 | Ga0207639_12241353 | Ga0207639_122413531 | 117 |
| 391 | 3300026067 | Ga0207678_10038622 | Ga0207678_100386226 | 117 |
| 392 | 3300026075 | Ga0207708_10342509 | Ga0207708_103425091 | 117 |
| 393 | 3300026075 | Ga0207708_10511633 | Ga0207708_105116331 | 117 |
| 394 | 3300026078 | Ga0207702_10001143 | Ga0207702_1000114315 | 117 |
| 395 | 3300026088 | Ga0207641_10032523 | Ga0207641_100325236 | 117 |
| 396 | 3300026088 | Ga0207641_10193852 | Ga0207641_101938523 | 117 |
| 397 | 3300026088 | Ga0207641_10555201 | Ga0207641_105552012 | 117 |
| 398 | 3300026088 | Ga0207641_10662907 | Ga0207641_106629072 | 117 |
| 399 | 3300026089 | Ga0207648_10027633 | Ga0207648_100276336 | 117 |
| 400 | 3300026089 | Ga0207648_10106824 | Ga0207648_101068242 | 117 |
| 401 | 3300026089 | Ga0207648_10230014 | Ga0207648_102300142 | 117 |
| 402 | 3300026089 | Ga0207648_11453338 | Ga0207648_114533382 | 117 |
| 403 | 3300026095 | Ga0207676_10009069 | Ga0207676_100090696 | 117 |
| 404 | 3300026095 | Ga0207676_10158776 | Ga0207676_101587762 | 117 |
| 405 | 3300026116 | Ga0207674_10000951 | Ga0207674_1000095119 | 117 |
| 406 | 3300026118 | Ga0207675_100025354 | Ga0207675_1000253543 | 117 |
| 407 | 3300026118 | Ga0207675_100135871 | Ga0207675_1001358711 | 117 |
| 408 | 3300026118 | Ga0207675_100323798 | Ga0207675_1003237982 | 117 |
| 409 | 3300026118 | Ga0207675_100366788 | Ga0207675_1003667882 | 117 |
| 410 | 3300026118 | Ga0207675_100575684 | Ga0207675_1005756842 | 117 |
| 411 | 3300026118 | Ga0207675_100873446 | Ga0207675_1008734461 | 117 |
| 412 | 3300027471 | Ga0209995_1000169 | Ga0209995_10001696 | 117 |
| 413 | 3300027665 | Ga0209983_1060072 | Ga0209983_10600722 | 117 |
| 414 | 3300027671 | Ga0209588_1004754 | Ga0209588_10047545 | 117 |
| 415 | 3300027671 | Ga0209588_1036728 | Ga0209588_10367283 | 117 |
| 416 | 3300027682 | Ga0209971_1011663 | Ga0209971_10116634 | 117 |
| 417 | 3300027695 | Ga0209966_1013125 | Ga0209966_10131252 | 117 |
| 418 | 3300027866 | Ga0209813_10235709 | Ga0209813_102357092 | 117 |
| 419 | 3300027876 | Ga0209974_10138703 | Ga0209974_101387032 | 117 |
| 420 | 3300027907 | Ga0207428_10000027 | Ga0207428_10000027189 | 117 |
| 421 | 3300027907 | Ga0207428_10007638 | Ga0207428_100076386 | 117 |
| 422 | 3300027907 | Ga0207428_10074725 | Ga0207428_100747253 | 117 |
| 423 | 3300028380 | Ga0268265_10059441 | Ga0268265_100594415 | 117 |
| 424 | 3300028380 | Ga0268265_10265627 | Ga0268265_102656273 | 117 |
| 425 | 3300028380 | Ga0268265_10503280 | Ga0268265_105032802 | 117 |
| 426 | 3300028381 | Ga0268264_10096020 | Ga0268264_100960205 | 117 |
| 427 | 3300028381 | Ga0268264_10202676 | Ga0268264_102026762 | 117 |
| 428 | 3300031548 | Ga0307408_100499703 | Ga0307408_1004997032 | 117 |
| 429 | 3300031548 | Ga0307408_100728564 | Ga0307408_1007285642 | 117 |
| 430 | 3300031731 | Ga0307405_10197582 | Ga0307405_101975822 | 117 |
| 431 | 3300031824 | Ga0307413_10391682 | Ga0307413_103916822 | 117 |
| 432 | 3300031852 | Ga0307410_10178705 | Ga0307410_101787052 | 117 |
| 433 | 3300031852 | Ga0307410_10640101 | Ga0307410_106401011 | 117 |
| 434 | 3300031852 | Ga0307410_11414308 | Ga0307410_114143081 | 117 |
| 435 | 3300031901 | Ga0307406_11955937 | Ga0307406_119559371 | 117 |
| 436 | 3300031911 | Ga0307412_10304083 | Ga0307412_103040833 | 117 |
| 437 | 3300031995 | Ga0307409_100656752 | Ga0307409_1006567522 | 117 |
| 438 | 3300031995 | Ga0307409_100901315 | Ga0307409_1009013152 | 117 |
| 439 | 3300032002 | Ga0307416_100257623 | Ga0307416_1002576232 | 117 |
| 440 | 3300032002 | Ga0307416_100915983 | Ga0307416_1009159832 | 117 |
| 441 | 3300032002 | Ga0307416_101861492 | Ga0307416_1018614922 | 117 |
| 442 | 3300032126 | Ga0307415_101195895 | Ga0307415_1011958952 | 117 |
| 443 | 3300034816 | Ga0373930_0176866 | Ga0373930_0176866_114_467 | 117 |
| 444 | 3300034957 | Ga0373938_0141948 | Ga0373938_0141948_197_607 | 117 |
| 445 | 3300035088 | Ga0373940_0116788 | Ga0373940_0116788_244_597 | 117 |
| 446 | 3300035090 | Ga0373949_0007754 | Ga0373949_0007754_471_824 | 117 |
| 447 | 3300035091 | Ga0373951_0043855 | Ga0373951_0043855_566_919 | 117 |
| 448 | 3300035091 | Ga0373951_0056481 | Ga0373951_0056481_421_831 | 117 |
| 449 | 3300035112 | Ga0373932_0072441 | Ga0373932_0072441_515_868 | 117 |
| 450 | 3300035112 | Ga0373932_0114056 | Ga0373932_0114056_72_482 | 117 |
| 451 | 3300035114 | Ga0373939_0168786 | Ga0373939_0168786_367_720 | 117 |
| 452 | 3300035121 | Ga0373960_0163024 | Ga0373960_0163024_279_632 | 117 |
| 453 | 3300035691 | Ga0373931_0002228 | Ga0373931_0002228_944_1354 | 117 |
| 454 | 3300035691 | Ga0373931_0014296 | Ga0373931_0014296_1648_2001 | 117 |
| 455 | 3300035691 | Ga0373931_0016884 | Ga0373931_0016884_1723_2076 | 117 |
| 456 | 3300037068 | Ga0373925_0223760 | Ga0373925_0223760_836_1189 | 117 |
| 457 | 3300038443 | Ga0395901_0581846 | Ga0395901_0581846_35_388 | 117 |
| 458 | 3300038996 | Ga0242420_039629 | Ga0242420_039629_44_397 | 117 |
| 459 | 3300038996 | Ga0242420_113550 | Ga0242420_113550_145_498 | 117 |
| 460 | 3300041452 | Ga0451793_0808498 | Ga0451793_0808498_304_657 | 117 |
| 461 | 3300042436 | Ga0439435_0013810 | Ga0439435_0013810_1438_1848 | 117 |
| 462 | 3300042530 | Ga0450916_024428 | Ga0450916_024428_61_420 | 117 |
| 463 | 3300042876 | Ga0451577_0129629 | Ga0451577_0129629_1323_1733 | 117 |
| 464 | 3300042876 | Ga0451577_0147755 | Ga0451577_0147755_330_683 | 117 |
| 465 | 3300042876 | Ga0451577_0795654 | Ga0451577_0795654_61_414 | 117 |
| 466 | 3300042993 | Ga0439440_0058835 | Ga0439440_0058835_271_630 | 117 |
| 467 | 3300044712 | Ga0453684_2028502 | Ga0453684_2028502_167_520 | 117 |
| 468 | 3300045051 | Ga0451576_1167596 | Ga0451576_1167596_18_371 | 117 |
| 469 | 3300046455 | Ga0495603_0194346 | Ga0495603_0194346_158_511 | 117 |
| 470 | 3300046472 | Ga0495580_0000727 | Ga0495580_0000727_2414_2767 | 117 |
| 471 | 3300046472 | Ga0495580_0194137 | Ga0495580_0194137_450_803 | 117 |
| 472 | 3300046491 | Ga0495584_0520556 | Ga0495584_0520556_137_490 | 117 |
| 473 | 3300046499 | Ga0495594_0201000 | Ga0495594_0201000_564_917 | 117 |
| 474 | 3300046528 | Ga0495642_0003953 | Ga0495642_0003953_2385_2738 | 117 |
| 475 | 3300046528 | Ga0495642_0297417 | Ga0495642_0297417_73_426 | 117 |
| 476 | 3300046537 | Ga0495598_0140461 | Ga0495598_0140461_313_666 | 117 |
| 477 | 3300046664 | Ga0495659_0056697 | Ga0495659_0056697_1046_1399 | 117 |
| 478 | 3300046664 | Ga0495659_0071461 | Ga0495659_0071461_211_564 | 117 |
| 479 | 3300046684 | Ga0495669_0015347 | Ga0495669_0015347_2482_2835 | 117 |
| 480 | 3300046684 | Ga0495669_0103315 | Ga0495669_0103315_946_1299 | 117 |
| 481 | 3300046691 | Ga0495670_0451062 | Ga0495670_0451062_140_493 | 117 |
| 482 | 3300048904 | Ga0496101_0229143 | Ga0496101_0229143_412_765 | 117 |
| 483 | 3300048905 | Ga0496102_0025757 | Ga0496102_0025757_2743_3153 | 117 |
| 484 | 3300048908 | Ga0496105_0731430 | Ga0496105_0731430_203_556 | 117 |
| 485 | 3300048909 | Ga0496106_0081850 | Ga0496106_0081850_191_544 | 117 |
| 486 | 3300048909 | Ga0496106_0116979 | Ga0496106_0116979_101_511 | 117 |
| 487 | 3300048912 | Ga0496109_0545007 | Ga0496109_0545007_198_554 | 117 |
| 488 | 3300048913 | Ga0496110_1022548 | Ga0496110_1022548_274_645 | 117 |
| 489 | 3300048915 | Ga0496112_0457355 | Ga0496112_0457355_738_1094 | 117 |
| 490 | 3300048916 | Ga0496113_0404058 | Ga0496113_0404058_460_831 | 117 |
| 491 | 3300048916 | Ga0496113_0783271 | Ga0496113_0783271_185_541 | 117 |
| 492 | 3300049522 | Ga0501299_073823 | Ga0501299_073823_171_524 | 117 |
| 493 | 3300049570 | Ga0501033_0443022 | Ga0501033_0443022_227_583 | 117 |
| 494 | 3300049571 | Ga0501034_0135000 | Ga0501034_0135000_487_879 | 117 |
| 495 | 3300049574 | Ga0501038_0053411 | Ga0501038_0053411_79_435 | 117 |
| 496 | 3300049574 | Ga0501038_0147136 | Ga0501038_0147136_224_580 | 117 |
| 497 | 3300049574 | Ga0501038_0312917 | Ga0501038_0312917_663_1016 | 117 |
| 498 | 3300049575 | Ga0501039_0225437 | Ga0501039_0225437_690_1046 | 117 |
| 499 | 3300049575 | Ga0501039_0402937 | Ga0501039_0402937_369_755 | 117 |
| 500 | 3300049576 | Ga0501040_0026162 | Ga0501040_0026162_1819_2175 | 117 |
| 501 | 3300049576 | Ga0501040_0091918 | Ga0501040_0091918_650_1003 | 117 |
| 502 | 3300049576 | Ga0501040_0141398 | Ga0501040_0141398_97_483 | 117 |
| 503 | 3300049576 | Ga0501040_1433847 | Ga0501040_1433847_108_467 | 117 |
| 504 | 3300049577 | Ga0501041_0084372 | Ga0501041_0084372_1427_1783 | 117 |
| 505 | 3300049577 | Ga0501041_0108514 | Ga0501041_0108514_164_520 | 117 |
| 506 | 3300049577 | Ga0501041_0947811 | Ga0501041_0947811_101_454 | 117 |
| 507 | 3300049578 | Ga0501042_0103837 | Ga0501042_0103837_1026_1379 | 117 |
| 508 | 3300049579 | Ga0501043_0565639 | Ga0501043_0565639_158_550 | 117 |
| 509 | 3300049581 | Ga0501047_0631743 | Ga0501047_0631743_94_486 | 117 |
| 510 | 3300049582 | Ga0501048_0035123 | Ga0501048_0035123_527_883 | 117 |
| 511 | 3300049584 | Ga0501068_0076651 | Ga0501068_0076651_245_601 | 117 |
| 512 | 3300049586 | Ga0501070_0480895 | Ga0501070_0480895_256_612 | 117 |
| 513 | 3300049587 | Ga0501071_0085807 | Ga0501071_0085807_1391_1777 | 117 |
| 514 | 3300049588 | Ga0501072_0032175 | Ga0501072_0032175_3509_3865 | 117 |
| 515 | 3300049588 | Ga0501072_0106740 | Ga0501072_0106740_1665_2051 | 117 |
| 516 | 3300049588 | Ga0501072_1023120 | Ga0501072_1023120_58_411 | 117 |
| 517 | 3300049589 | Ga0501073_0486027 | Ga0501073_0486027_416_808 | 117 |
| 518 | 3300049590 | Ga0501074_0019399 | Ga0501074_0019399_1009_1365 | 117 |
| 519 | 3300049590 | Ga0501074_0087561 | Ga0501074_0087561_661_1017 | 117 |
| 520 | 3300049590 | Ga0501074_0178173 | Ga0501074_0178173_758_1150 | 117 |
| 521 | 3300049590 | Ga0501074_0194015 | Ga0501074_0194015_810_1196 | 117 |
| 522 | 3300049591 | Ga0501075_0005715 | Ga0501075_0005715_7079_7435 | 117 |
| 523 | 3300049591 | Ga0501075_0022204 | Ga0501075_0022204_1591_1947 | 117 |
| 524 | 3300049591 | Ga0501075_0075603 | Ga0501075_0075603_330_683 | 117 |
| 525 | 3300049592 | Ga0501076_0146698 | Ga0501076_0146698_245_601 | 117 |
| 526 | 3300049592 | Ga0501076_0222280 | Ga0501076_0222280_613_969 | 117 |
| 527 | 3300049592 | Ga0501076_0348299 | Ga0501076_0348299_814_1167 | 117 |
| 528 | 3300049593 | Ga0501077_0005657 | Ga0501077_0005657_420_776 | 117 |
| 529 | 3300049660 | Ga0501216_057816 | Ga0501216_057816_380_733 | 117 |
| 530 | 3300049686 | Ga0501257_059386 | Ga0501257_059386_31_387 | 117 |
| 531 | 3300049686 | Ga0501257_109623 | Ga0501257_109623_107_460 | 117 |
| 532 | 3300049741 | Ga0501079_0018603 | Ga0501079_0018603_4527_4883 | 117 |
| 533 | 3300049741 | Ga0501079_0218002 | Ga0501079_0218002_245_601 | 117 |
| 534 | 3300049742 | Ga0501080_0270881 | Ga0501080_0270881_781_1137 | 117 |
| 535 | 3300049743 | Ga0501081_0086749 | Ga0501081_0086749_1757_2113 | 117 |
| 536 | 3300049779 | Ga0501283_037830 | Ga0501283_037830_101_457 | 117 |
| 537 | 3300049822 | Ga0501035_0550598 | Ga0501035_0550598_29_382 | 117 |
| 538 | 3300049822 | Ga0501035_0673387 | Ga0501035_0673387_230_586 | 117 |
| 539 | 3300049824 | Ga0501045_0012445 | Ga0501045_0012445_2844_3200 | 117 |
| 540 | 3300049824 | Ga0501045_0108046 | Ga0501045_0108046_1242_1595 | 117 |
| 541 | 3300049824 | Ga0501045_0260857 | Ga0501045_0260857_812_1165 | 117 |
| 542 | 3300050489 | nmdc:mga03683_4325_c1 | nmdc:mga03683_4325_c1_3400_3756 | 117 |
| 543 | 3300050491 | nmdc:mga00v17_161908_c1 | nmdc:mga00v17_161908_c1_19_375 | 117 |
| 544 | 3300050492 | nmdc:mga0yw44_397008_c1 | nmdc:mga0yw44_397008_c1_50_415 | 117 |
| 545 | 3300050493 | nmdc:mga0k408_29325_c1 | nmdc:mga0k408_29325_c1_1523_1879 | 117 |
| 546 | 3300050494 | nmdc:mga06z11_11153_c1 | nmdc:mga06z11_11153_c1_1122_1478 | 117 |
| 547 | 3300050495 | nmdc:mga04h51_264191_c1 | nmdc:mga04h51_264191_c1_228_584 | 117 |
| 548 | 3300050507 | nmdc:mga05p37_1495108_c1 | nmdc:mga05p37_1495108_c1_97_450 | 117 |
| 549 | 3300050507 | nmdc:mga05p37_169024_c1 | nmdc:mga05p37_169024_c1_2152_2505 | 117 |
| 550 | 3300050507 | nmdc:mga05p37_188791_c1 | nmdc:mga05p37_188791_c1_2018_2371 | 117 |
| 551 | 3300050507 | nmdc:mga05p37_232573_c1 | nmdc:mga05p37_232573_c1_1655_2008 | 117 |
| 552 | 3300050507 | nmdc:mga05p37_285150_c1 | nmdc:mga05p37_285150_c1_852_1205 | 117 |
| 553 | 3300050507 | nmdc:mga05p37_44172_c1 | nmdc:mga05p37_44172_c1_1194_1547 | 117 |
| 554 | 3300050507 | nmdc:mga05p37_445676_c1 | nmdc:mga05p37_445676_c1_408_761 | 117 |
| 555 | 3300050507 | nmdc:mga05p37_601457_c1 | nmdc:mga05p37_601457_c1_547_903 | 117 |
| 556 | 3300050507 | nmdc:mga05p37_77108_c1 | nmdc:mga05p37_77108_c1_2968_3324 | 117 |
| 557 | 3300050507 | nmdc:mga05p37_82072_c1 | nmdc:mga05p37_82072_c1_175_528 | 117 |
| 558 | 3300050507 | nmdc:mga05p37_92768_c1 | nmdc:mga05p37_92768_c1_1412_1765 | 117 |
| 559 | 3300050508 | nmdc:mga09592_1277391_c1 | nmdc:mga09592_1277391_c1_216_569 | 117 |
| 560 | 3300050508 | nmdc:mga09592_1944_c1 | nmdc:mga09592_1944_c1_6028_6384 | 117 |
| 561 | 3300050508 | nmdc:mga09592_51459_c1 | nmdc:mga09592_51459_c1_3018_3371 | 117 |
| 562 | 3300050508 | nmdc:mga09592_5317_c1 | nmdc:mga09592_5317_c1_1360_1713 | 117 |
| 563 | 3300050508 | nmdc:mga09592_62218_c1 | nmdc:mga09592_62218_c1_1779_2132 | 117 |
| 564 | 3300050508 | nmdc:mga09592_70527_c1 | nmdc:mga09592_70527_c1_1368_1724 | 117 |
| 565 | 3300050509 | nmdc:mga0qj67_21599_c1 | nmdc:mga0qj67_21599_c1_523_879 | 117 |
| 566 | 3300050509 | nmdc:mga0qj67_24924_c1 | nmdc:mga0qj67_24924_c1_1981_2337 | 117 |
| 567 | 3300050509 | nmdc:mga0qj67_385595_c1 | nmdc:mga0qj67_385595_c1_423_776 | 117 |
| 568 | 3300050509 | nmdc:mga0qj67_61674_c1 | nmdc:mga0qj67_61674_c1_279_635 | 117 |
| 569 | 3300050510 | nmdc:mga06r32_129889_c1 | nmdc:mga06r32_129889_c1_129_485 | 117 |
| 570 | 3300050510 | nmdc:mga06r32_1453367_c1 | nmdc:mga06r32_1453367_c1_104_457 | 117 |
| 571 | 3300050510 | nmdc:mga06r32_31833_c1 | nmdc:mga06r32_31833_c1_2987_3340 | 117 |
| 572 | 3300050510 | nmdc:mga06r32_3786_c1 | nmdc:mga06r32_3786_c1_979_1335 | 117 |
| 573 | 3300050510 | nmdc:mga06r32_73196_c1 | nmdc:mga06r32_73196_c1_2158_2514 | 117 |
| 574 | 3300050511 | nmdc:mga08y16_3252_c1 | nmdc:mga08y16_3252_c1_10926_11279 | 117 |
| 575 | 3300050511 | nmdc:mga08y16_4117_c1 | nmdc:mga08y16_4117_c1_3126_3479 | 117 |
| 576 | 3300050511 | nmdc:mga08y16_620967_c1 | nmdc:mga08y16_620967_c1_286_639 | 117 |
| 577 | 3300050511 | nmdc:mga08y16_89595_c1 | nmdc:mga08y16_89595_c1_2036_2389 | 117 |
| 578 | 3300050512 | nmdc:mga0n895_116823_c1 | nmdc:mga0n895_116823_c1_434_787 | 117 |
| 579 | 3300050512 | nmdc:mga0n895_1212401_c1 | nmdc:mga0n895_1212401_c1_121_474 | 117 |
| 580 | 3300050512 | nmdc:mga0n895_142145_c1 | nmdc:mga0n895_142145_c1_991_1344 | 117 |
| 581 | 3300050512 | nmdc:mga0n895_153195_c1 | nmdc:mga0n895_153195_c1_587_940 | 117 |
| 582 | 3300050512 | nmdc:mga0n895_2948_c1 | nmdc:mga0n895_2948_c1_1526_1879 | 117 |
| 583 | 3300050512 | nmdc:mga0n895_2964_c1 | nmdc:mga0n895_2964_c1_12316_12669 | 117 |
| 584 | 3300050512 | nmdc:mga0n895_332996_c1 | nmdc:mga0n895_332996_c1_1002_1355 | 117 |
| 585 | 3300050512 | nmdc:mga0n895_381987_c1 | nmdc:mga0n895_381987_c1_887_1240 | 117 |
| 586 | 3300050512 | nmdc:mga0n895_69434_c1 | nmdc:mga0n895_69434_c1_516_869 | 117 |
| 587 | 3300050512 | nmdc:mga0n895_76187_c1 | nmdc:mga0n895_76187_c1_1066_1419 | 117 |
| 588 | 3300050513 | nmdc:mga0rr50_260551_c1 | nmdc:mga0rr50_260551_c1_39_392 | 117 |
| 589 | 3300050513 | nmdc:mga0rr50_285729_c1 | nmdc:mga0rr50_285729_c1_313_666 | 117 |
| 590 | 3300050513 | nmdc:mga0rr50_639080_c1 | nmdc:mga0rr50_639080_c1_232_585 | 117 |
| 591 | 3300050513 | nmdc:mga0rr50_64492_c1 | nmdc:mga0rr50_64492_c1_687_1040 | 117 |
| 592 | 3300050513 | nmdc:mga0rr50_72598_c1 | nmdc:mga0rr50_72598_c1_2196_2549 | 117 |
| 593 | 3300050513 | nmdc:mga0rr50_768575_c1 | nmdc:mga0rr50_768575_c1_56_409 | 117 |
| 594 | 3300050513 | nmdc:mga0rr50_88492_c1 | nmdc:mga0rr50_88492_c1_525_878 | 117 |
| 595 | 3300050514 | nmdc:mga08x19_20719_c1 | nmdc:mga08x19_20719_c1_2730_3083 | 117 |
| 596 | 3300050514 | nmdc:mga08x19_258152_c1 | nmdc:mga08x19_258152_c1_838_1191 | 117 |
| 597 | 3300050515 | nmdc:mga0a205_101290_c1 | nmdc:mga0a205_101290_c1_1726_2079 | 117 |
| 598 | 3300050515 | nmdc:mga0a205_117013_c1 | nmdc:mga0a205_117013_c1_381_734 | 117 |
| 599 | 3300050515 | nmdc:mga0a205_1249047_c1 | nmdc:mga0a205_1249047_c1_133_486 | 117 |
| 600 | 3300050515 | nmdc:mga0a205_13697_c1 | nmdc:mga0a205_13697_c1_3432_3785 | 117 |
| 601 | 3300050515 | nmdc:mga0a205_171182_c1 | nmdc:mga0a205_171182_c1_1526_1879 | 117 |
| 602 | 3300050515 | nmdc:mga0a205_227_c1 | nmdc:mga0a205_227_c1_23837_24190 | 117 |
| 603 | 3300050515 | nmdc:mga0a205_29588_c1 | nmdc:mga0a205_29588_c1_1112_1465 | 117 |
| 604 | 3300050515 | nmdc:mga0a205_6155_c2 | nmdc:mga0a205_6155_c2_3494_3847 | 117 |
| 605 | 3300053129 | Ga0500628_038703 | Ga0500628_038703_333_686 | 117 |
| 606 | 3300054114 | Ga0501084_0011395 | Ga0501084_0011395_2424_2780 | 117 |
| 607 | 3300054114 | Ga0501084_0357875 | Ga0501084_0357875_221_574 | 117 |
| 608 | 3300059421 | Ga0590071_007657 | Ga0590071_007657_1224_1577 | 117 |
| 609 | 3300059421 | Ga0590071_039690 | Ga0590071_039690_267_620 | 117 |
| 610 | 3300059423 | Ga0590074_057642 | Ga0590074_057642_314_667 | 117 |
| 611 | 3300059423 | Ga0590074_060111 | Ga0590074_060111_302_658 | 117 |
| 612 | 3300059426 | Ga0590077_016885 | Ga0590077_016885_478_834 | 117 |
| 613 | 3300059426 | Ga0590077_166202 | Ga0590077_166202_81_434 | 117 |
| 614 | 3300060353 | Ga0501082_0006260 | Ga0501082_0006260_5813_6169 | 117 |
| 615 | 3300060353 | Ga0501082_0102762 | Ga0501082_0102762_1937_2293 | 117 |
| 616 | 3300060353 | Ga0501082_0172268 | Ga0501082_0172268_205_558 | 117 |
| 617 | 3300060353 | Ga0501082_0760070 | Ga0501082_0760070_31_384 | 117 |
| 618 | 3300060353 | Ga0501082_1200023 | Ga0501082_1200023_229_582 | 117 |
| 619 | 3300061734 | Ga0530510_0043766 | Ga0530510_0043766_127_483 | 117 |
| 620 | 3300061734 | Ga0530510_0720243 | Ga0530510_0720243_393_749 | 117 |
| 621 | 3300061734 | Ga0530510_1098736 | Ga0530510_1098736_31_384 | 117 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar