F469984

General Info

Members Datasets Scaffolds Average Seq Length
621 287 1242 105

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_101658151|Ga0070700_1016581512
Length 115
Sequence VTPPPDDKAASRDKGAVTISLLGREFRVGCPEGEEKQLMASVDYLNRKLKEVRDVGKVVGNERIAMMAALNIAHEYMSNSGKAHAGSSDAAIRRRILAMQETLESALAADQENLF

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
126 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
231 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
234 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 2.25
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_101658151 3300005441 Bacteria 548
2 JGI24749J21850_1016868 3300002076 Unclassified 1026
3 JGI24744J21845_10030618 3300002077 Unclassified 1031
4 JGI24033J26618_1004675 3300002155 Unclassified 1485
5 JGI24034J26672_10028002 3300002239 Unclassified 908
6 rootL2_10070221 3300003322 Bacteria 1109
7 rootH1_10071737 3300003323 Bacteria 1051
8 Ga0058862_11120639 3300004803 Unclassified 666
9 Ga0065712_10031109 3300005290 Unclassified 1359
10 Ga0065712_10087502 3300005290 Bacteria 2570
11 Ga0065715_10009921 3300005293 Bacteria 2875
12 Ga0065707_10207532 3300005295 Bacteria 1281
13 Ga0065707_10775935 3300005295 Bacteria 603
14 Ga0065707_10781392 3300005295 Bacteria 606
15 Ga0070658_10000996 3300005327 Bacteria 24299
16 Ga0070658_10017879 3300005327 Bacteria 5671
17 Ga0070658_10143328 3300005327 Bacteria 1997
18 Ga0070658_10353121 3300005327 Bacteria 1259
19 Ga0070658_11385541 3300005327 Unclassified 610
20 Ga0070658_11830109 3300005327 Bacteria 525
21 Ga0070676_10166024 3300005328 Bacteria 1424
22 Ga0070683_100043668 3300005329 Bacteria 4131
23 Ga0070683_100073421 3300005329 Bacteria 3194
24 Ga0070683_100164896 3300005329 Bacteria 2102
25 Ga0070683_101101489 3300005329 Unclassified 763
26 Ga0070690_100071667 3300005330 Bacteria 2251
27 Ga0070690_100397395 3300005330 Bacteria 1011
28 Ga0070670_100000434 3300005331 Bacteria 34217
29 Ga0070670_101199722 3300005331 Bacteria 693
30 Ga0070677_10002889 3300005333 Bacteria 5522
31 Ga0070677_10089640 3300005333 Bacteria 1335
32 Ga0068869_101360803 3300005334 Unclassified 627
33 Ga0070666_10268961 3300005335 Bacteria 1209
34 Ga0070666_10445276 3300005335 Bacteria 935
35 Ga0070680_100097117 3300005336 Bacteria 2443
36 Ga0068868_100041527 3300005338 Bacteria 3584
37 Ga0068868_100053212 3300005338 Bacteria 3189
38 Ga0068868_100246206 3300005338 Bacteria 1503
39 Ga0070660_100065006 3300005339 Unclassified 2839
40 Ga0070660_100102779 3300005339 Bacteria 2265
41 Ga0070660_100408875 3300005339 Bacteria 1123
42 Ga0070660_100436599 3300005339 Bacteria 1085
43 Ga0070660_101068780 3300005339 Bacteria 683
44 Ga0070660_101205562 3300005339 Bacteria 642
45 Ga0070689_100265226 3300005340 Bacteria 1420
46 Ga0070691_10257284 3300005341 Bacteria 938
47 Ga0070687_100067627 3300005343 Bacteria 1907
48 Ga0070687_100091888 3300005343 Bacteria 1681
49 Ga0070687_100215744 3300005343 Bacteria 1172
50 Ga0070687_101090129 3300005343 Bacteria 583
51 Ga0070661_100078645 3300005344 Bacteria 2433
52 Ga0070661_100115662 3300005344 Bacteria 2006
53 Ga0070661_100178573 3300005344 Bacteria 1615
54 Ga0070661_100583209 3300005344 Bacteria 902
55 Ga0070692_10202468 3300005345 Bacteria 1163
56 Ga0070692_10315081 3300005345 Bacteria 960
57 Ga0070692_10731414 3300005345 Unclassified 669
58 Ga0070668_100205164 3300005347 Bacteria 1619
59 Ga0070668_100795414 3300005347 Bacteria 840
60 Ga0070668_100966051 3300005347 Bacteria 764
61 Ga0070668_101066842 3300005347 Bacteria 728
62 Ga0070669_100491816 3300005353 Bacteria 1016
63 Ga0070675_100062585 3300005354 Bacteria 3075
64 Ga0070675_101223686 3300005354 Bacteria 691
65 Ga0070675_101977983 3300005354 Unclassified 537
66 Ga0070671_100008414 3300005355 Bacteria 8269
67 Ga0070671_100053376 3300005355 Bacteria 3360
68 Ga0070671_100333015 3300005355 Bacteria 1294
69 Ga0070671_101550982 3300005355 Bacteria 587
70 Ga0070674_100013635 3300005356 Bacteria 5030
71 Ga0070674_100031980 3300005356 Bacteria 3492
72 Ga0070674_100100011 3300005356 Bacteria 2111
73 Ga0070674_100103136 3300005356 Bacteria 2082
74 Ga0070673_100020329 3300005364 Bacteria 4788
75 Ga0070673_101779905 3300005364 Bacteria 583
76 Ga0070688_100024609 3300005365 Bacteria 3555
77 Ga0070688_100165799 3300005365 Bacteria 1521
78 Ga0070659_100207800 3300005366 Bacteria 1613
79 Ga0070659_100230431 3300005366 Bacteria 1531
80 Ga0070659_100407987 3300005366 Bacteria 1148
81 Ga0070659_101273226 3300005366 Bacteria 652
82 Ga0070667_100079388 3300005367 Bacteria 2805
83 Ga0070703_10262038 3300005406 Bacteria 705
84 Ga0070709_10421161 3300005434 Bacteria 1001
85 Ga0070714_100032710 3300005435 Bacteria 4343
86 Ga0070714_100165478 3300005435 Bacteria 2004
87 Ga0070713_101012186 3300005436 Bacteria 802
88 Ga0070701_10109455 3300005438 Bacteria 1541
89 Ga0070701_10136073 3300005438 Bacteria 1400
90 Ga0070705_100096768 3300005440 Bacteria 1854
91 Ga0070705_100136677 3300005440 Bacteria 1607
92 Ga0070705_100223257 3300005440 Bacteria 1306
93 Ga0070700_100047668 3300005441 Bacteria 2652
94 Ga0070700_100397949 3300005441 Bacteria 1035
95 Ga0070694_100332301 3300005444 Bacteria 1173
96 Ga0070694_100764981 3300005444 Bacteria 790
97 Ga0070678_100005216 3300005456 Bacteria 7474
98 Ga0070678_102352091 3300005456 Bacteria 506
99 Ga0070662_100157390 3300005457 Bacteria 1774
100 Ga0070662_100282469 3300005457 Bacteria 1344
101 Ga0070662_100343362 3300005457 Bacteria 1222
102 Ga0070681_10009835 3300005458 Bacteria 9421
103 Ga0070681_10038565 3300005458 Bacteria 4790
104 Ga0068867_100025186 3300005459 Bacteria 4268
105 Ga0068867_100072303 3300005459 Bacteria 2581
106 Ga0068867_100202060 3300005459 Bacteria 1591
107 Ga0068867_100322258 3300005459 Bacteria 1281
108 Ga0068867_100335746 3300005459 Bacteria 1257
109 Ga0070685_10731225 3300005466 Bacteria 724
110 Ga0070706_100025181 3300005467 Bacteria 5477
111 Ga0070706_100707566 3300005467 Bacteria 934
112 Ga0070707_100236495 3300005468 Bacteria 1778
113 Ga0070699_100091770 3300005518 Bacteria 2656
114 Ga0070699_100304902 3300005518 Bacteria 1429
115 Ga0070679_100171442 3300005530 Bacteria 2143
116 Ga0070679_100219094 3300005530 Bacteria 1865
117 Ga0070679_101647557 3300005530 Bacteria 589
118 Ga0070684_100236293 3300005535 Bacteria 1669
119 Ga0070684_100673797 3300005535 Bacteria 963
120 Ga0070697_100092721 3300005536 Bacteria 2500
121 Ga0068853_100095702 3300005539 Bacteria 2619
122 Ga0068853_100266250 3300005539 Bacteria 1577
123 Ga0068853_100322934 3300005539 Unclassified 1431
124 Ga0068853_100388123 3300005539 Bacteria 1305
125 Ga0068853_100433748 3300005539 Bacteria 1234
126 Ga0068853_100725417 3300005539 Bacteria 949
127 Ga0070672_100009016 3300005543 Bacteria 6858
128 Ga0070672_100237797 3300005543 Bacteria 1531
129 Ga0070686_100056872 3300005544 Bacteria 2511
130 Ga0070695_100182536 3300005545 Bacteria 1488
131 Ga0070695_100349303 3300005545 Bacteria 1108
132 Ga0070696_100137123 3300005546 Bacteria 1784
133 Ga0070696_100236547 3300005546 Bacteria 1376
134 Ga0070696_100284306 3300005546 Bacteria 1262
135 Ga0070696_100955212 3300005546 Bacteria 714
136 Ga0070696_101280997 3300005546 Bacteria 622
137 Ga0070693_100031957 3300005547 Bacteria 2890
138 Ga0070693_100053377 3300005547 Bacteria 2320
139 Ga0070693_100191119 3300005547 Bacteria 1324
140 Ga0070693_100291118 3300005547 Bacteria 1097
141 Ga0070665_100054180 3300005548 Bacteria 4023
142 Ga0070665_100097141 3300005548 Bacteria 2950
143 Ga0070665_100538564 3300005548 Bacteria 1179
144 Ga0070665_100600261 3300005548 Bacteria 1114
145 Ga0070665_100849109 3300005548 Bacteria 926
146 Ga0070704_100032360 3300005549 Bacteria 3526
147 Ga0070704_100177747 3300005549 Bacteria 1699
148 Ga0070704_100248755 3300005549 Bacteria 1459
149 Ga0068855_100008479 3300005563 Bacteria 12425
150 Ga0068855_100023449 3300005563 Bacteria 7392
151 Ga0068855_100032659 3300005563 Bacteria 6214
152 Ga0068855_100146222 3300005563 Bacteria 2690
153 Ga0070664_100064815 3300005564 Bacteria 3116
154 Ga0070664_100424984 3300005564 Bacteria 1217
155 Ga0068857_100170083 3300005577 Bacteria 1980
156 Ga0068854_100040200 3300005578 Bacteria 3299
157 Ga0068854_100067218 3300005578 Bacteria 2611
158 Ga0068854_100177675 3300005578 Bacteria 1661
159 Ga0068856_100069498 3300005614 Bacteria 3483
160 Ga0070702_100040098 3300005615 Bacteria 2617
161 Ga0070702_100164644 3300005615 Unclassified 1437
162 Ga0068852_100000984 3300005616 Bacteria 18760
163 Ga0068852_100003537 3300005616 Bacteria 10937
164 Ga0068852_100069637 3300005616 Bacteria 3084
165 Ga0068852_100312235 3300005616 Bacteria 1525
166 Ga0068859_100020714 3300005617 Bacteria 6598
167 Ga0068859_100049745 3300005617 Bacteria 4210
168 Ga0068859_102767987 3300005617 Bacteria 539
169 Ga0068864_100115005 3300005618 Unclassified 2399
170 Ga0068864_102592964 3300005618 Bacteria 513
171 Ga0068866_10038511 3300005718 Bacteria 2354
172 Ga0068866_10170870 3300005718 Bacteria 1276
173 Ga0068861_100100943 3300005719 Bacteria 2294
174 Ga0068851_10001924 3300005834 Bacteria 9116
175 Ga0068851_10071235 3300005834 Unclassified 1798
176 Ga0068851_10165318 3300005834 Bacteria 1218
177 Ga0068870_10253501 3300005840 Bacteria 1092
178 Ga0068870_10434340 3300005840 Bacteria 862
179 Ga0068858_100011198 3300005842 Bacteria 8476
180 Ga0068858_100027702 3300005842 Bacteria 5265
181 Ga0068858_100355423 3300005842 Bacteria 1404
182 Ga0068858_101273529 3300005842 Unclassified 723
183 Ga0068860_100236334 3300005843 Bacteria 1777
184 Ga0068860_101756991 3300005843 Bacteria 642
185 Ga0068860_102501635 3300005843 Unclassified 536
186 Ga0068862_100339804 3300005844 Bacteria 1390
187 Ga0068862_100506232 3300005844 Bacteria 1147
188 Ga0068862_100959724 3300005844 Bacteria 843
189 Ga0068862_101021762 3300005844 Bacteria 818
190 Ga0070717_10404274 3300006028 Bacteria 1227
191 Ga0070717_10719239 3300006028 Bacteria 907
192 Ga0075364_10078600 3300006051 Bacteria 2179
193 Ga0075364_10305419 3300006051 Bacteria 1083
194 Ga0070715_10706341 3300006163 Bacteria 603
195 Ga0070716_100134473 3300006173 Bacteria 1568
196 Ga0070716_101647379 3300006173 Bacteria 528
197 Ga0075367_10939585 3300006178 Bacteria 552
198 Ga0075369_10056131 3300006186 Bacteria 1712
199 Ga0075366_10086841 3300006195 Bacteria 1871
200 Ga0075366_10130989 3300006195 Bacteria 1513
201 Ga0075366_10212838 3300006195 Bacteria 1177
202 Ga0097621_100016430 3300006237 Bacteria 5595
203 Ga0097621_100023505 3300006237 Bacteria 4800
204 Ga0097621_100182880 3300006237 Bacteria 1812
205 Ga0097621_100389337 3300006237 Bacteria 1246
206 Ga0075370_10076102 3300006353 Bacteria 1924
207 Ga0075370_10502545 3300006353 Bacteria 732
208 Ga0068871_100016582 3300006358 Bacteria 5553
209 Ga0068871_100033546 3300006358 Bacteria 4066
210 Ga0068871_100237385 3300006358 Bacteria 1584
211 Ga0068871_100315859 3300006358 Bacteria 1374
212 Ga0068871_101110138 3300006358 Bacteria 740
213 Ga0075428_100030768 3300006844 Bacteria 5935
214 Ga0075434_100196178 3300006871 Bacteria 2039
215 Ga0075429_100503873 3300006880 Bacteria 1061
216 Ga0068865_100013162 3300006881 Bacteria 5221
217 Ga0068865_100136618 3300006881 Bacteria 1843
218 Ga0068865_101140877 3300006881 Bacteria 688
219 Ga0097620_100020714 3300006931 Bacteria 6598
220 Ga0097620_100049741 3300006931 Bacteria 4210
221 Ga0097620_102768128 3300006931 Bacteria 539
222 Ga0075435_101848594 3300007076 Bacteria 530
223 Ga0099795_10183967 3300007788 Bacteria 874
224 Ga0105240_10009510 3300009093 Bacteria 13758
225 Ga0105240_10043169 3300009093 Bacteria 5740
226 Ga0105240_10173828 3300009093 Bacteria 2548
227 Ga0105240_10995398 3300009093 Bacteria 897
228 Ga0105240_12180721 3300009093 Bacteria 575
229 Ga0111539_10085389 3300009094 Bacteria 3710
230 Ga0111539_10710065 3300009094 Bacteria 1170
231 Ga0111539_12544208 3300009094 Unclassified 594
232 Ga0105245_10268755 3300009098 Bacteria 1662
233 Ga0105245_10650779 3300009098 Bacteria 1084
234 Ga0105245_11053920 3300009098 Bacteria 859
235 Ga0105245_11423602 3300009098 Bacteria 743
236 Ga0105247_10429563 3300009101 Bacteria 948
237 Ga0105247_10966610 3300009101 Unclassified 662
238 Ga0114129_10308540 3300009147 Bacteria 2107
239 Ga0105243_10048466 3300009148 Bacteria 3349
240 Ga0105243_10146279 3300009148 Bacteria 2022
241 Ga0105243_10303524 3300009148 Unclassified 1448
242 Ga0105243_10327789 3300009148 Bacteria 1397
243 Ga0105243_10601629 3300009148 Bacteria 1058
244 Ga0105241_10006515 3300009174 Bacteria 8605
245 Ga0105241_10644569 3300009174 Bacteria 961
246 Ga0105242_10001891 3300009176 Bacteria 16465
247 Ga0105242_10035730 3300009176 Bacteria 3985
248 Ga0105242_10367273 3300009176 Bacteria 1334
249 Ga0105242_10626473 3300009176 Bacteria 1043
250 Ga0105242_11260448 3300009176 Bacteria 761
251 Ga0105248_10268874 3300009177 Bacteria 1919
252 Ga0105248_10301585 3300009177 Bacteria 1804
253 Ga0105248_10777045 3300009177 Bacteria 1081
254 Ga0105248_12869673 3300009177 Bacteria 549
255 Ga0105237_11140907 3300009545 Bacteria 786
256 Ga0105237_12547554 3300009545 Bacteria 522
257 Ga0105238_10007584 3300009551 Bacteria 10869
258 Ga0105238_10097501 3300009551 Bacteria 2925
259 Ga0105238_10225168 3300009551 Bacteria 1852
260 Ga0105238_10429413 3300009551 Bacteria 1317
261 Ga0105238_10743626 3300009551 Bacteria 994
262 Ga0105238_10847587 3300009551 Bacteria 931
263 Ga0105238_10909971 3300009551 Bacteria 898
264 Ga0105238_11264548 3300009551 Bacteria 763
265 Ga0105238_13069749 3300009551 Bacteria 501
266 Ga0105249_10230693 3300009553 Bacteria 1826
267 Ga0105249_10549779 3300009553 Bacteria 1205
268 Ga0105249_10989552 3300009553 Unclassified 910
269 Ga0105249_11818612 3300009553 Bacteria 682
270 Ga0105239_10686912 3300010375 Bacteria 1170
271 Ga0105239_11256524 3300010375 Bacteria 854
272 Ga0105246_10680762 3300011119 Bacteria 899
273 Ga0157371_10537964 3300013102 Bacteria 865
274 Ga0157371_10937928 3300013102 Unclassified 658
275 Ga0157370_10013506 3300013104 Bacteria 8409
276 Ga0157370_11235207 3300013104 Bacteria 674
277 Ga0157370_11843339 3300013104 Bacteria 543
278 Ga0157369_10122088 3300013105 Bacteria 2763
279 Ga0157369_10268872 3300013105 Bacteria 1777
280 Ga0157369_10461708 3300013105 Bacteria 1315
281 Ga0157374_10003073 3300013296 Bacteria 13999
282 Ga0157374_10089651 3300013296 Bacteria 2930
283 Ga0157374_10090051 3300013296 Bacteria 2924
284 Ga0157374_11720910 3300013296 Bacteria 652
285 Ga0157374_12009034 3300013296 Unclassified 604
286 Ga0157378_10211987 3300013297 Bacteria 1837
287 Ga0157378_10359852 3300013297 Bacteria 1424
288 Ga0157378_11255072 3300013297 Bacteria 781
289 Ga0163162_10041632 3300013306 Bacteria 4597
290 Ga0163162_10264569 3300013306 Bacteria 1851
291 Ga0163162_10299706 3300013306 Bacteria 1739
292 Ga0163162_11495146 3300013306 Bacteria 769
293 Ga0157372_10003664 3300013307 Bacteria 16518
294 Ga0157372_10065846 3300013307 Bacteria 4069
295 Ga0157372_10551760 3300013307 Bacteria 1343
296 Ga0157372_10652346 3300013307 Bacteria 1226
297 Ga0157372_10666138 3300013307 Bacteria 1212
298 Ga0157372_11599267 3300013307 Bacteria 750
299 Ga0157372_12060641 3300013307 Bacteria 656
300 Ga0157375_10013363 3300013308 Bacteria 7302
301 Ga0157375_11029282 3300013308 Bacteria 962
302 Ga0157375_12212152 3300013308 Unclassified 655
303 Ga0157375_12212272 3300013308 Unclassified 655
304 Ga0157380_10016445 3300014326 Bacteria 5457
305 Ga0157380_10177805 3300014326 Bacteria 1867
306 Ga0157380_10449637 3300014326 Bacteria 1237
307 Ga0157380_11577146 3300014326 Bacteria 711
308 Ga0157380_11711526 3300014326 Bacteria 686
309 Ga0157377_10061684 3300014745 Unclassified 2143
310 Ga0157379_10067248 3300014968 Bacteria 3203
311 Ga0157379_10077148 3300014968 Bacteria 2983
312 Ga0157379_10952023 3300014968 Bacteria 817
313 Ga0157379_11933042 3300014968 Bacteria 582
314 Ga0157376_10003696 3300014969 Bacteria 10567
315 Ga0157376_10152666 3300014969 Bacteria 2084
316 Ga0157376_10395662 3300014969 Bacteria 1335
317 Ga0157376_10413636 3300014969 Bacteria 1307
318 Ga0157376_11615421 3300014969 Bacteria 683
319 Ga0157376_12919859 3300014969 Unclassified 517
320 Ga0157376_12919866 3300014969 Unclassified 517
321 Ga0163161_12058664 3300017792 Bacteria 508
322 Ga0206356_10404390 3300020070 Bacteria 1119
323 Ga0213876_10059775 3300021384 Bacteria 2011
324 Ga0213871_10113700 3300021441 Bacteria 802
325 Ga0207673_1010058 3300025290 Bacteria 1214
326 Ga0207697_10017597 3300025315 Bacteria 2936
327 Ga0207697_10128151 3300025315 Bacteria 1095
328 Ga0207656_10001064 3300025321 Bacteria 8982
329 Ga0207656_10008915 3300025321 Bacteria 3715
330 Ga0207682_10000259 3300025893 Bacteria 23848
331 Ga0207682_10147791 3300025893 Bacteria 1058
332 Ga0207642_10139833 3300025899 Bacteria 1275
333 Ga0207642_10821121 3300025899 Bacteria 592
334 Ga0207710_10261762 3300025900 Bacteria 867
335 Ga0207688_10006711 3300025901 Bacteria 6262
336 Ga0207688_10129901 3300025901 Bacteria 1476
337 Ga0207680_10074159 3300025903 Bacteria 2118
338 Ga0207680_11294507 3300025903 Unclassified 518
339 Ga0207699_10234025 3300025906 Bacteria 1259
340 Ga0207645_10003594 3300025907 Bacteria 11734
341 Ga0207645_10208486 3300025907 Bacteria 1287
342 Ga0207645_10304405 3300025907 Bacteria 1062
343 Ga0207643_10206779 3300025908 Bacteria 1197
344 Ga0207643_10534945 3300025908 Bacteria 751
345 Ga0207643_10743139 3300025908 Unclassified 635
346 Ga0207705_10008282 3300025909 Bacteria 7594
347 Ga0207705_10015638 3300025909 Bacteria 5448
348 Ga0207705_10111473 3300025909 Bacteria 2022
349 Ga0207705_10139928 3300025909 Bacteria 1807
350 Ga0207684_10142938 3300025910 Bacteria 2058
351 Ga0207654_10052896 3300025911 Bacteria 2342
352 Ga0207707_10052954 3300025912 Bacteria 3533
353 Ga0207707_10667817 3300025912 Bacteria 875
354 Ga0207695_10007753 3300025913 Bacteria 13598
355 Ga0207695_10028267 3300025913 Bacteria 6224
356 Ga0207695_10399541 3300025913 Bacteria 1259
357 Ga0207695_10405906 3300025913 Bacteria 1247
358 Ga0207671_10826677 3300025914 Bacteria 734
359 Ga0207660_10326139 3300025917 Bacteria 1227
360 Ga0207662_10155070 3300025918 Bacteria 1459
361 Ga0207662_10370606 3300025918 Bacteria 965
362 Ga0207657_10158779 3300025919 Bacteria 1837
363 Ga0207657_10264532 3300025919 Bacteria 1368
364 Ga0207657_10515520 3300025919 Bacteria 936
365 Ga0207657_10802941 3300025919 Bacteria 727
366 Ga0207649_10066954 3300025920 Unclassified 2278
367 Ga0207649_10413446 3300025920 Bacteria 1012
368 Ga0207649_10608987 3300025920 Bacteria 841
369 Ga0207649_10673080 3300025920 Unclassified 801
370 Ga0207649_10842905 3300025920 Bacteria 717
371 Ga0207649_10853609 3300025920 Bacteria 712
372 Ga0207649_10981087 3300025920 Bacteria 664
373 Ga0207649_11578177 3300025920 Bacteria 519
374 Ga0207652_10022111 3300025921 Bacteria 5257
375 Ga0207652_10344894 3300025921 Bacteria 1344
376 Ga0207646_10417496 3300025922 Bacteria 1211
377 Ga0207681_10810949 3300025923 Bacteria 782
378 Ga0207694_10022303 3300025924 Bacteria 4802
379 Ga0207694_10040023 3300025924 Bacteria 3608
380 Ga0207694_10854526 3300025924 Bacteria 769
381 Ga0207694_11168188 3300025924 Unclassified 651
382 Ga0207650_10003468 3300025925 Bacteria 10837
383 Ga0207650_10892858 3300025925 Bacteria 755
384 Ga0207659_10058270 3300025926 Bacteria 2772
385 Ga0207659_10582962 3300025926 Bacteria 952
386 Ga0207687_10365439 3300025927 Bacteria 1179
387 Ga0207687_10414163 3300025927 Bacteria 1111
388 Ga0207687_10736153 3300025927 Unclassified 838
389 Ga0207687_11002457 3300025927 Bacteria 716
390 Ga0207700_10060431 3300025928 Bacteria 2870
391 Ga0207664_10076058 3300025929 Bacteria 2716
392 Ga0207664_10179236 3300025929 Bacteria 1818
393 Ga0207644_10046279 3300025931 Bacteria 3098
394 Ga0207644_10225390 3300025931 Bacteria 1487
395 Ga0207644_10518355 3300025931 Bacteria 985
396 Ga0207690_10191465 3300025932 Bacteria 1547
397 Ga0207690_10302324 3300025932 Bacteria 1252
398 Ga0207690_10891558 3300025932 Bacteria 737
399 Ga0207690_11040700 3300025932 Bacteria 681
400 Ga0207706_10084836 3300025933 Bacteria 2785
401 Ga0207706_11371167 3300025933 Bacteria 582
402 Ga0207686_10018292 3300025934 Bacteria 3967
403 Ga0207686_10101136 3300025934 Bacteria 1925
404 Ga0207686_10183574 3300025934 Bacteria 1485
405 Ga0207686_10851149 3300025934 Bacteria 733
406 Ga0207709_10100091 3300025935 Bacteria 1914
407 Ga0207709_10122207 3300025935 Bacteria 1760
408 Ga0207709_10289573 3300025935 Bacteria 1213
409 Ga0207670_10063700 3300025936 Bacteria 2524
410 Ga0207670_11015733 3300025936 Bacteria 698
411 Ga0207669_10087852 3300025937 Bacteria 2014
412 Ga0207669_10102179 3300025937 Bacteria 1898
413 Ga0207669_10275396 3300025937 Bacteria 1266
414 Ga0207704_10384028 3300025938 Bacteria 1103
415 Ga0207704_11062997 3300025938 Bacteria 687
416 Ga0207704_11093418 3300025938 Bacteria 677
417 Ga0207704_11882266 3300025938 Bacteria 515
418 Ga0207665_10777003 3300025939 Bacteria 756
419 Ga0207665_11031721 3300025939 Bacteria 655
420 Ga0207691_10000801 3300025940 Bacteria 31237
421 Ga0207691_10134069 3300025940 Bacteria 2186
422 Ga0207691_10234904 3300025940 Bacteria 1586
423 Ga0207711_10545730 3300025941 Bacteria 1081
424 Ga0207711_10730545 3300025941 Bacteria 923
425 Ga0207689_10033427 3300025942 Bacteria 4273
426 Ga0207689_10449473 3300025942 Bacteria 1077
427 Ga0207661_10063075 3300025944 Bacteria 3000
428 Ga0207661_10317298 3300025944 Bacteria 1400
429 Ga0207679_11426602 3300025945 Unclassified 635
430 Ga0207667_10001556 3300025949 Bacteria 28864
431 Ga0207667_10039819 3300025949 Bacteria 5005
432 Ga0207667_10068307 3300025949 Bacteria 3701
433 Ga0207667_10351016 3300025949 Bacteria 1504
434 Ga0207667_11104136 3300025949 Bacteria 776
435 Ga0207651_10078211 3300025960 Unclassified 2371
436 Ga0207651_10137565 3300025960 Bacteria 1881
437 Ga0207712_10460977 3300025961 Unclassified 1080
438 Ga0207712_10855360 3300025961 Bacteria 802
439 Ga0207668_10704887 3300025972 Unclassified 887
440 Ga0207640_10050006 3300025981 Unclassified 2710
441 Ga0207658_10379456 3300025986 Bacteria 1238
442 Ga0207658_10414554 3300025986 Bacteria 1186
443 Ga0207677_11482788 3300026023 Bacteria 626
444 Ga0207703_10093569 3300026035 Bacteria 2532
445 Ga0207703_10219463 3300026035 Bacteria 1699
446 Ga0207703_10389945 3300026035 Bacteria 1290
447 Ga0207703_11375777 3300026035 Bacteria 679
448 Ga0207703_11517988 3300026035 Bacteria 645
449 Ga0207639_10083249 3300026041 Bacteria 2539
450 Ga0207639_10165242 3300026041 Bacteria 1869
451 Ga0207639_10235068 3300026041 Bacteria 1591
452 Ga0207639_10247385 3300026041 Bacteria 1553
453 Ga0207639_10960140 3300026041 Bacteria 800
454 Ga0207639_11182347 3300026041 Unclassified 718
455 Ga0207678_10438544 3300026067 Bacteria 1134
456 Ga0207678_10668395 3300026067 Bacteria 913
457 Ga0207708_10001617 3300026075 Bacteria 16788
458 Ga0207708_10103211 3300026075 Bacteria 2208
459 Ga0207708_10173998 3300026075 Bacteria 1706
460 Ga0207702_10173661 3300026078 Bacteria 1978
461 Ga0207702_10216862 3300026078 Bacteria 1781
462 Ga0207641_10048689 3300026088 Unclassified 3579
463 Ga0207641_11809473 3300026088 Unclassified 612
464 Ga0207648_10034845 3300026089 Bacteria 4438
465 Ga0207648_10072798 3300026089 Bacteria 2995
466 Ga0207648_10138693 3300026089 Bacteria 2143
467 Ga0207648_10181841 3300026089 Bacteria 1861
468 Ga0207648_10204527 3300026089 Bacteria 1752
469 Ga0207676_10024254 3300026095 Bacteria 4487
470 Ga0207675_100096736 3300026118 Bacteria 2780
471 Ga0207675_100259832 3300026118 Bacteria 1683
472 Ga0207683_10000601 3300026121 Bacteria 33201
473 Ga0207683_10013742 3300026121 Bacteria 6902
474 Ga0207683_10211104 3300026121 Bacteria 1767
475 Ga0207698_10001147 3300026142 Bacteria 15422
476 Ga0207698_10029839 3300026142 Bacteria 3912
477 Ga0207698_10499836 3300026142 Bacteria 1183
478 Ga0207698_10978395 3300026142 Bacteria 856
479 Ga0207698_11179701 3300026142 Bacteria 779
480 Ga0209813_10315288 3300027866 Bacteria 611
481 Ga0207428_10052536 3300027907 Bacteria 3253
482 Ga0207428_10236922 3300027907 Bacteria 1364
483 Ga0207428_10563593 3300027907 Bacteria 823
484 Ga0268266_10051249 3300028379 Bacteria 3543
485 Ga0268266_10088711 3300028379 Bacteria 2707
486 Ga0268266_10109029 3300028379 Bacteria 2451
487 Ga0268266_10660917 3300028379 Bacteria 1006
488 Ga0268265_10436002 3300028380 Bacteria 1220
489 Ga0268265_10901432 3300028380 Bacteria 868
490 Ga0268265_11391437 3300028380 Unclassified 703
491 Ga0268264_10073519 3300028381 Bacteria 2902
492 Ga0268264_10511641 3300028381 Bacteria 1172
493 Ga0265318_10002900 3300028577 Bacteria 8915
494 Ga0265338_10182012 3300028800 Bacteria 1601
495 Ga0265332_10017528 3300031238 Bacteria 3160
496 Ga0265328_10317707 3300031239 Bacteria 603
497 Ga0265320_10020384 3300031240 Bacteria 3597
498 Ga0265329_10007000 3300031242 Bacteria 4405
499 Ga0265331_10002316 3300031250 Bacteria 12991
500 Ga0265331_10002755 3300031250 Bacteria 11691
501 Ga0265331_10008705 3300031250 Bacteria 5751
502 Ga0265331_10241957 3300031250 Bacteria 810
503 Ga0265327_10000650 3300031251 Bacteria 56200
504 Ga0265327_10125530 3300031251 Bacteria 1212
505 Ga0265316_10023988 3300031344 Bacteria 5122
506 Ga0307408_100204110 3300031548 Bacteria 1602
507 Ga0307408_100236730 3300031548 Bacteria 1498
508 Ga0307408_100635638 3300031548 Bacteria 952
509 Ga0265314_10001098 3300031711 Bacteria 31271
510 Ga0265314_10410203 3300031711 Bacteria 730
511 Ga0265342_10006835 3300031712 Bacteria 8431
512 Ga0307405_10258561 3300031731 Bacteria 1299
513 Ga0307405_10337447 3300031731 Bacteria 1157
514 Ga0307405_11104735 3300031731 Bacteria 682
515 Ga0307410_10578413 3300031852 Bacteria 934
516 Ga0307410_10623261 3300031852 Bacteria 902
517 Ga0307406_10594183 3300031901 Bacteria 912
518 Ga0307407_10836266 3300031903 Bacteria 703
519 Ga0307412_10255795 3300031911 Bacteria 1362
520 Ga0307412_10650333 3300031911 Bacteria 899
521 Ga0307412_11814215 3300031911 Unclassified 561
522 Ga0307409_100041830 3300031995 Bacteria 3427
523 Ga0307416_100056270 3300032002 Bacteria 3173
524 Ga0307416_100242287 3300032002 Bacteria 1748
525 Ga0307416_100361073 3300032002 Bacteria 1475
526 Ga0307416_101743441 3300032002 Bacteria 727
527 Ga0307411_10313938 3300032005 Bacteria 1263
528 Ga0373930_0013767 3300034816 Bacteria 1497
529 Ga0373926_0093456 3300035083 Bacteria 1120
530 Ga0373926_0250414 3300035083 Bacteria 687
531 Ga0373929_0013604 3300035085 Bacteria 1561
532 Ga0373939_0057785 3300035114 Bacteria 1225
533 Ga0373960_0195449 3300035121 Bacteria 713
534 Ga0373946_0065452 3300035171 Bacteria 1557
535 Ga0373931_0099463 3300035691 Bacteria 1634
536 Ga0373931_0938174 3300035691 Bacteria 583
537 Ga0373927_0022419 3300035695 Bacteria 4137
538 Ga0373947_0080093 3300035725 Bacteria 2020
539 Ga0373925_0013833 3300037068 Bacteria 5842
540 Ga0395899_0183798 3300037312 Bacteria 1466
541 Ga0395900_0053266 3300037418 Bacteria 4164
542 Ga0395905_0044191 3300037471 Bacteria 4181
543 Ga0395905_0499061 3300037471 Bacteria 1117
544 Ga0395901_0409058 3300038443 Bacteria 1393
545 Ga0436365_0915381 3300039437 Bacteria 512
546 Ga0436365_1169865 3300039437 Bacteria 582
547 Ga0436360_0294651 3300039438 Bacteria 1753
548 Ga0451789_0519556 3300041443 Bacteria 726
549 Ga0451804_1084094 3300041463 Bacteria 1021
550 Ga0451849_0084985 3300041505 Unclassified 718
551 Ga0451853_2102597 3300041512 Bacteria 1051
552 Ga0439441_001997 3300042001 Bacteria 2804
553 Ga0439441_180883 3300042001 Bacteria 507
554 Ga0450896_018747 3300042133 Bacteria 1005
555 Ga0439434_0139295 3300042435 Bacteria 799
556 Ga0451577_1932165 3300042876 Bacteria 516
557 Ga0453683_0599622 3300044673 Bacteria 718
558 Ga0466966_0024617 3300044684 Bacteria 3938
559 Ga0466966_0102923 3300044684 Bacteria 1765
560 Ga0466963_0224260 3300044694 Bacteria 1317
561 Ga0453684_0072838 3300044712 Bacteria 4334
562 Ga0453684_0820090 3300044712 Bacteria 1002
563 Ga0466971_0437374 3300044719 Bacteria 640
564 Ga0466970_0323666 3300044765 Bacteria 872
565 Ga0466957_0021062 3300044842 Bacteria 3839
566 Ga0466959_0074539 3300045049 Bacteria 2454
567 Ga0466958_0065729 3300045836 Bacteria 2213
568 Ga0495580_0324979 3300046472 Bacteria 1045
569 Ga0495580_0638294 3300046472 Bacteria 701
570 Ga0495642_0214308 3300046528 Bacteria 840
571 Ga0495598_0047453 3300046537 Bacteria 1280
572 Ga0495598_0143503 3300046537 Bacteria 828
573 Ga0495621_0390952 3300046539 Unclassified 589
574 Ga0495633_0551796 3300046558 Unclassified 519
575 Ga0495588_0662743 3300046674 Unclassified 546
576 Ga0495658_0489078 3300046683 Bacteria 787
577 Ga0495669_0125135 3300046684 Bacteria 1207
578 Ga0495674_1314142 3300047319 Unclassified 542
579 Ga0495672_0297261 3300047320 Bacteria 766
580 Ga0496102_0350075 3300048905 Bacteria 1391
581 Ga0496104_0664517 3300048907 Unclassified 951
582 Ga0496105_0173873 3300048908 Bacteria 1765
583 Ga0496106_0403156 3300048909 Bacteria 1099
584 Ga0496108_0024533 3300048911 Bacteria 4966
585 Ga0496108_0509845 3300048911 Bacteria 1050
586 Ga0496109_0074996 3300048912 Bacteria 3110
587 Ga0496110_0380497 3300048913 Bacteria 1286
588 Ga0496110_0755876 3300048913 Bacteria 875
589 Ga0496111_0427993 3300048914 Bacteria 978
590 Ga0496113_1023122 3300048916 Unclassified 650
591 Ga0496114_0630614 3300048917 Bacteria 944
592 Ga0501299_168150 3300049522 Bacteria 565
593 Ga0501033_1147942 3300049570 Bacteria 516
594 Ga0501047_0098521 3300049581 Bacteria 2802
595 Ga0501070_0823608 3300049586 Bacteria 728
596 Ga0501074_0073503 3300049590 Bacteria 2456
597 Ga0501076_1051470 3300049592 Bacteria 671
598 Ga0501243_054046 3300049675 Bacteria 731
599 Ga0501080_0271470 3300049742 Bacteria 1543
600 Ga0501044_0254006 3300049823 Bacteria 1698
601 nmdc:mga00v17_176468_c1 3300050491 Bacteria 1378
602 nmdc:mga00v17_74933_c1 3300050491 Bacteria 2103
603 nmdc:mga0k408_171015_c1 3300050493 Bacteria 1295
604 nmdc:mga0k408_32784_c1 3300050493 Bacteria 2968
605 nmdc:mga0k408_383027_c1 3300050493 Bacteria 838
606 nmdc:mga0k408_47018_c1 3300050493 Bacteria 2493
607 nmdc:mga06z11_624968_c1 3300050494 Bacteria 655
608 nmdc:mga06z11_92932_c1 3300050494 Bacteria 1641
609 nmdc:mga07m45_194394_c1 3300050496 Bacteria 1180
610 nmdc:mga07m45_881412_c1 3300050496 Bacteria 512
611 nmdc:mga05p37_531120_c1 3300050507 Bacteria 1343
612 nmdc:mga09592_1118118_c1 3300050508 Unclassified 654
613 nmdc:mga09592_478224_c1 3300050508 Bacteria 1073
614 nmdc:mga08y16_29256_c1 3300050511 Bacteria 5805
615 nmdc:mga08y16_885789_c1 3300050511 Bacteria 880
616 nmdc:mga0n895_186880_c1 3300050512 Bacteria 2103
617 nmdc:mga0rr50_1328295_c1 3300050513 Bacteria 609
618 nmdc:mga0sz30_58998_c1 3300050516 Bacteria 1637
619 Ga0500641_0021487 3300053096 Bacteria 2461
620 Ga0500628_265067 3300053129 Bacteria 507
621 Ga0466962_0341867 3300061719 Bacteria 744
622 Ga0070700_101658151
623 JGI24749J21850_1016868
624 JGI24744J21845_10030618
625 JGI24033J26618_1004675
626 JGI24034J26672_10028002
627 rootL2_10070221
628 rootH1_10071737
629 Ga0058862_11120639
630 Ga0065712_10031109
631 Ga0065712_10087502
632 Ga0065715_10009921
633 Ga0065707_10207532
634 Ga0065707_10775935
635 Ga0065707_10781392
636 Ga0070658_10000996
637 Ga0070658_10017879
638 Ga0070658_10143328
639 Ga0070658_10353121
640 Ga0070658_11385541
641 Ga0070658_11830109
642 Ga0070676_10166024
643 Ga0070683_100043668
644 Ga0070683_100073421
645 Ga0070683_100164896
646 Ga0070683_101101489
647 Ga0070690_100071667
648 Ga0070690_100397395
649 Ga0070670_100000434
650 Ga0070670_101199722
651 Ga0070677_10002889
652 Ga0070677_10089640
653 Ga0068869_101360803
654 Ga0070666_10268961
655 Ga0070666_10445276
656 Ga0070680_100097117
657 Ga0068868_100041527
658 Ga0068868_100053212
659 Ga0068868_100246206
660 Ga0070660_100065006
661 Ga0070660_100102779
662 Ga0070660_100408875
663 Ga0070660_100436599
664 Ga0070660_101068780
665 Ga0070660_101205562
666 Ga0070689_100265226
667 Ga0070691_10257284
668 Ga0070687_100067627
669 Ga0070687_100091888
670 Ga0070687_100215744
671 Ga0070687_101090129
672 Ga0070661_100078645
673 Ga0070661_100115662
674 Ga0070661_100178573
675 Ga0070661_100583209
676 Ga0070692_10202468
677 Ga0070692_10315081
678 Ga0070692_10731414
679 Ga0070668_100205164
680 Ga0070668_100795414
681 Ga0070668_100966051
682 Ga0070668_101066842
683 Ga0070669_100491816
684 Ga0070675_100062585
685 Ga0070675_101223686
686 Ga0070675_101977983
687 Ga0070671_100008414
688 Ga0070671_100053376
689 Ga0070671_100333015
690 Ga0070671_101550982
691 Ga0070674_100013635
692 Ga0070674_100031980
693 Ga0070674_100100011
694 Ga0070674_100103136
695 Ga0070673_100020329
696 Ga0070673_101779905
697 Ga0070688_100024609
698 Ga0070688_100165799
699 Ga0070659_100207800
700 Ga0070659_100230431
701 Ga0070659_100407987
702 Ga0070659_101273226
703 Ga0070667_100079388
704 Ga0070703_10262038
705 Ga0070709_10421161
706 Ga0070714_100032710
707 Ga0070714_100165478
708 Ga0070713_101012186
709 Ga0070701_10109455
710 Ga0070701_10136073
711 Ga0070705_100096768
712 Ga0070705_100136677
713 Ga0070705_100223257
714 Ga0070700_100047668
715 Ga0070700_100397949
716 Ga0070694_100332301
717 Ga0070694_100764981
718 Ga0070678_100005216
719 Ga0070678_102352091
720 Ga0070662_100157390
721 Ga0070662_100282469
722 Ga0070662_100343362
723 Ga0070681_10009835
724 Ga0070681_10038565
725 Ga0068867_100025186
726 Ga0068867_100072303
727 Ga0068867_100202060
728 Ga0068867_100322258
729 Ga0068867_100335746
730 Ga0070685_10731225
731 Ga0070706_100025181
732 Ga0070706_100707566
733 Ga0070707_100236495
734 Ga0070699_100091770
735 Ga0070699_100304902
736 Ga0070679_100171442
737 Ga0070679_100219094
738 Ga0070679_101647557
739 Ga0070684_100236293
740 Ga0070684_100673797
741 Ga0070697_100092721
742 Ga0068853_100095702
743 Ga0068853_100266250
744 Ga0068853_100322934
745 Ga0068853_100388123
746 Ga0068853_100433748
747 Ga0068853_100725417
748 Ga0070672_100009016
749 Ga0070672_100237797
750 Ga0070686_100056872
751 Ga0070695_100182536
752 Ga0070695_100349303
753 Ga0070696_100137123
754 Ga0070696_100236547
755 Ga0070696_100284306
756 Ga0070696_100955212
757 Ga0070696_101280997
758 Ga0070693_100031957
759 Ga0070693_100053377
760 Ga0070693_100191119
761 Ga0070693_100291118
762 Ga0070665_100054180
763 Ga0070665_100097141
764 Ga0070665_100538564
765 Ga0070665_100600261
766 Ga0070665_100849109
767 Ga0070704_100032360
768 Ga0070704_100177747
769 Ga0070704_100248755
770 Ga0068855_100008479
771 Ga0068855_100023449
772 Ga0068855_100032659
773 Ga0068855_100146222
774 Ga0070664_100064815
775 Ga0070664_100424984
776 Ga0068857_100170083
777 Ga0068854_100040200
778 Ga0068854_100067218
779 Ga0068854_100177675
780 Ga0068856_100069498
781 Ga0070702_100040098
782 Ga0070702_100164644
783 Ga0068852_100000984
784 Ga0068852_100003537
785 Ga0068852_100069637
786 Ga0068852_100312235
787 Ga0068859_100020714
788 Ga0068859_100049745
789 Ga0068859_102767987
790 Ga0068864_100115005
791 Ga0068864_102592964
792 Ga0068866_10038511
793 Ga0068866_10170870
794 Ga0068861_100100943
795 Ga0068851_10001924
796 Ga0068851_10071235
797 Ga0068851_10165318
798 Ga0068870_10253501
799 Ga0068870_10434340
800 Ga0068858_100011198
801 Ga0068858_100027702
802 Ga0068858_100355423
803 Ga0068858_101273529
804 Ga0068860_100236334
805 Ga0068860_101756991
806 Ga0068860_102501635
807 Ga0068862_100339804
808 Ga0068862_100506232
809 Ga0068862_100959724
810 Ga0068862_101021762
811 Ga0070717_10404274
812 Ga0070717_10719239
813 Ga0075364_10078600
814 Ga0075364_10305419
815 Ga0070715_10706341
816 Ga0070716_100134473
817 Ga0070716_101647379
818 Ga0075367_10939585
819 Ga0075369_10056131
820 Ga0075366_10086841
821 Ga0075366_10130989
822 Ga0075366_10212838
823 Ga0097621_100016430
824 Ga0097621_100023505
825 Ga0097621_100182880
826 Ga0097621_100389337
827 Ga0075370_10076102
828 Ga0075370_10502545
829 Ga0068871_100016582
830 Ga0068871_100033546
831 Ga0068871_100237385
832 Ga0068871_100315859
833 Ga0068871_101110138
834 Ga0075428_100030768
835 Ga0075434_100196178
836 Ga0075429_100503873
837 Ga0068865_100013162
838 Ga0068865_100136618
839 Ga0068865_101140877
840 Ga0097620_100020714
841 Ga0097620_100049741
842 Ga0097620_102768128
843 Ga0075435_101848594
844 Ga0099795_10183967
845 Ga0105240_10009510
846 Ga0105240_10043169
847 Ga0105240_10173828
848 Ga0105240_10995398
849 Ga0105240_12180721
850 Ga0111539_10085389
851 Ga0111539_10710065
852 Ga0111539_12544208
853 Ga0105245_10268755
854 Ga0105245_10650779
855 Ga0105245_11053920
856 Ga0105245_11423602
857 Ga0105247_10429563
858 Ga0105247_10966610
859 Ga0114129_10308540
860 Ga0105243_10048466
861 Ga0105243_10146279
862 Ga0105243_10303524
863 Ga0105243_10327789
864 Ga0105243_10601629
865 Ga0105241_10006515
866 Ga0105241_10644569
867 Ga0105242_10001891
868 Ga0105242_10035730
869 Ga0105242_10367273
870 Ga0105242_10626473
871 Ga0105242_11260448
872 Ga0105248_10268874
873 Ga0105248_10301585
874 Ga0105248_10777045
875 Ga0105248_12869673
876 Ga0105237_11140907
877 Ga0105237_12547554
878 Ga0105238_10007584
879 Ga0105238_10097501
880 Ga0105238_10225168
881 Ga0105238_10429413
882 Ga0105238_10743626
883 Ga0105238_10847587
884 Ga0105238_10909971
885 Ga0105238_11264548
886 Ga0105238_13069749
887 Ga0105249_10230693
888 Ga0105249_10549779
889 Ga0105249_10989552
890 Ga0105249_11818612
891 Ga0105239_10686912
892 Ga0105239_11256524
893 Ga0105246_10680762
894 Ga0157371_10537964
895 Ga0157371_10937928
896 Ga0157370_10013506
897 Ga0157370_11235207
898 Ga0157370_11843339
899 Ga0157369_10122088
900 Ga0157369_10268872
901 Ga0157369_10461708
902 Ga0157374_10003073
903 Ga0157374_10089651
904 Ga0157374_10090051
905 Ga0157374_11720910
906 Ga0157374_12009034
907 Ga0157378_10211987
908 Ga0157378_10359852
909 Ga0157378_11255072
910 Ga0163162_10041632
911 Ga0163162_10264569
912 Ga0163162_10299706
913 Ga0163162_11495146
914 Ga0157372_10003664
915 Ga0157372_10065846
916 Ga0157372_10551760
917 Ga0157372_10652346
918 Ga0157372_10666138
919 Ga0157372_11599267
920 Ga0157372_12060641
921 Ga0157375_10013363
922 Ga0157375_11029282
923 Ga0157375_12212152
924 Ga0157375_12212272
925 Ga0157380_10016445
926 Ga0157380_10177805
927 Ga0157380_10449637
928 Ga0157380_11577146
929 Ga0157380_11711526
930 Ga0157377_10061684
931 Ga0157379_10067248
932 Ga0157379_10077148
933 Ga0157379_10952023
934 Ga0157379_11933042
935 Ga0157376_10003696
936 Ga0157376_10152666
937 Ga0157376_10395662
938 Ga0157376_10413636
939 Ga0157376_11615421
940 Ga0157376_12919859
941 Ga0157376_12919866
942 Ga0163161_12058664
943 Ga0206356_10404390
944 Ga0213876_10059775
945 Ga0213871_10113700
946 Ga0207673_1010058
947 Ga0207697_10017597
948 Ga0207697_10128151
949 Ga0207656_10001064
950 Ga0207656_10008915
951 Ga0207682_10000259
952 Ga0207682_10147791
953 Ga0207642_10139833
954 Ga0207642_10821121
955 Ga0207710_10261762
956 Ga0207688_10006711
957 Ga0207688_10129901
958 Ga0207680_10074159
959 Ga0207680_11294507
960 Ga0207699_10234025
961 Ga0207645_10003594
962 Ga0207645_10208486
963 Ga0207645_10304405
964 Ga0207643_10206779
965 Ga0207643_10534945
966 Ga0207643_10743139
967 Ga0207705_10008282
968 Ga0207705_10015638
969 Ga0207705_10111473
970 Ga0207705_10139928
971 Ga0207684_10142938
972 Ga0207654_10052896
973 Ga0207707_10052954
974 Ga0207707_10667817
975 Ga0207695_10007753
976 Ga0207695_10028267
977 Ga0207695_10399541
978 Ga0207695_10405906
979 Ga0207671_10826677
980 Ga0207660_10326139
981 Ga0207662_10155070
982 Ga0207662_10370606
983 Ga0207657_10158779
984 Ga0207657_10264532
985 Ga0207657_10515520
986 Ga0207657_10802941
987 Ga0207649_10066954
988 Ga0207649_10413446
989 Ga0207649_10608987
990 Ga0207649_10673080
991 Ga0207649_10842905
992 Ga0207649_10853609
993 Ga0207649_10981087
994 Ga0207649_11578177
995 Ga0207652_10022111
996 Ga0207652_10344894
997 Ga0207646_10417496
998 Ga0207681_10810949
999 Ga0207694_10022303
1000 Ga0207694_10040023
1001 Ga0207694_10854526
1002 Ga0207694_11168188
1003 Ga0207650_10003468
1004 Ga0207650_10892858
1005 Ga0207659_10058270
1006 Ga0207659_10582962
1007 Ga0207687_10365439
1008 Ga0207687_10414163
1009 Ga0207687_10736153
1010 Ga0207687_11002457
1011 Ga0207700_10060431
1012 Ga0207664_10076058
1013 Ga0207664_10179236
1014 Ga0207644_10046279
1015 Ga0207644_10225390
1016 Ga0207644_10518355
1017 Ga0207690_10191465
1018 Ga0207690_10302324
1019 Ga0207690_10891558
1020 Ga0207690_11040700
1021 Ga0207706_10084836
1022 Ga0207706_11371167
1023 Ga0207686_10018292
1024 Ga0207686_10101136
1025 Ga0207686_10183574
1026 Ga0207686_10851149
1027 Ga0207709_10100091
1028 Ga0207709_10122207
1029 Ga0207709_10289573
1030 Ga0207670_10063700
1031 Ga0207670_11015733
1032 Ga0207669_10087852
1033 Ga0207669_10102179
1034 Ga0207669_10275396
1035 Ga0207704_10384028
1036 Ga0207704_11062997
1037 Ga0207704_11093418
1038 Ga0207704_11882266
1039 Ga0207665_10777003
1040 Ga0207665_11031721
1041 Ga0207691_10000801
1042 Ga0207691_10134069
1043 Ga0207691_10234904
1044 Ga0207711_10545730
1045 Ga0207711_10730545
1046 Ga0207689_10033427
1047 Ga0207689_10449473
1048 Ga0207661_10063075
1049 Ga0207661_10317298
1050 Ga0207679_11426602
1051 Ga0207667_10001556
1052 Ga0207667_10039819
1053 Ga0207667_10068307
1054 Ga0207667_10351016
1055 Ga0207667_11104136
1056 Ga0207651_10078211
1057 Ga0207651_10137565
1058 Ga0207712_10460977
1059 Ga0207712_10855360
1060 Ga0207668_10704887
1061 Ga0207640_10050006
1062 Ga0207658_10379456
1063 Ga0207658_10414554
1064 Ga0207677_11482788
1065 Ga0207703_10093569
1066 Ga0207703_10219463
1067 Ga0207703_10389945
1068 Ga0207703_11375777
1069 Ga0207703_11517988
1070 Ga0207639_10083249
1071 Ga0207639_10165242
1072 Ga0207639_10235068
1073 Ga0207639_10247385
1074 Ga0207639_10960140
1075 Ga0207639_11182347
1076 Ga0207678_10438544
1077 Ga0207678_10668395
1078 Ga0207708_10001617
1079 Ga0207708_10103211
1080 Ga0207708_10173998
1081 Ga0207702_10173661
1082 Ga0207702_10216862
1083 Ga0207641_10048689
1084 Ga0207641_11809473
1085 Ga0207648_10034845
1086 Ga0207648_10072798
1087 Ga0207648_10138693
1088 Ga0207648_10181841
1089 Ga0207648_10204527
1090 Ga0207676_10024254
1091 Ga0207675_100096736
1092 Ga0207675_100259832
1093 Ga0207683_10000601
1094 Ga0207683_10013742
1095 Ga0207683_10211104
1096 Ga0207698_10001147
1097 Ga0207698_10029839
1098 Ga0207698_10499836
1099 Ga0207698_10978395
1100 Ga0207698_11179701
1101 Ga0209813_10315288
1102 Ga0207428_10052536
1103 Ga0207428_10236922
1104 Ga0207428_10563593
1105 Ga0268266_10051249
1106 Ga0268266_10088711
1107 Ga0268266_10109029
1108 Ga0268266_10660917
1109 Ga0268265_10436002
1110 Ga0268265_10901432
1111 Ga0268265_11391437
1112 Ga0268264_10073519
1113 Ga0268264_10511641
1114 Ga0265318_10002900
1115 Ga0265338_10182012
1116 Ga0265332_10017528
1117 Ga0265328_10317707
1118 Ga0265320_10020384
1119 Ga0265329_10007000
1120 Ga0265331_10002316
1121 Ga0265331_10002755
1122 Ga0265331_10008705
1123 Ga0265331_10241957
1124 Ga0265327_10000650
1125 Ga0265327_10125530
1126 Ga0265316_10023988
1127 Ga0307408_100204110
1128 Ga0307408_100236730
1129 Ga0307408_100635638
1130 Ga0265314_10001098
1131 Ga0265314_10410203
1132 Ga0265342_10006835
1133 Ga0307405_10258561
1134 Ga0307405_10337447
1135 Ga0307405_11104735
1136 Ga0307410_10578413
1137 Ga0307410_10623261
1138 Ga0307406_10594183
1139 Ga0307407_10836266
1140 Ga0307412_10255795
1141 Ga0307412_10650333
1142 Ga0307412_11814215
1143 Ga0307409_100041830
1144 Ga0307416_100056270
1145 Ga0307416_100242287
1146 Ga0307416_100361073
1147 Ga0307416_101743441
1148 Ga0307411_10313938
1149 Ga0373930_0013767
1150 Ga0373926_0093456
1151 Ga0373926_0250414
1152 Ga0373929_0013604
1153 Ga0373939_0057785
1154 Ga0373960_0195449
1155 Ga0373946_0065452
1156 Ga0373931_0099463
1157 Ga0373931_0938174
1158 Ga0373927_0022419
1159 Ga0373947_0080093
1160 Ga0373925_0013833
1161 Ga0395899_0183798
1162 Ga0395900_0053266
1163 Ga0395905_0044191
1164 Ga0395905_0499061
1165 Ga0395901_0409058
1166 Ga0436365_0915381
1167 Ga0436365_1169865
1168 Ga0436360_0294651
1169 Ga0451789_0519556
1170 Ga0451804_1084094
1171 Ga0451849_0084985
1172 Ga0451853_2102597
1173 Ga0439441_001997
1174 Ga0439441_180883
1175 Ga0450896_018747
1176 Ga0439434_0139295
1177 Ga0451577_1932165
1178 Ga0453683_0599622
1179 Ga0466966_0024617
1180 Ga0466966_0102923
1181 Ga0466963_0224260
1182 Ga0453684_0072838
1183 Ga0453684_0820090
1184 Ga0466971_0437374
1185 Ga0466970_0323666
1186 Ga0466957_0021062
1187 Ga0466959_0074539
1188 Ga0466958_0065729
1189 Ga0495580_0324979
1190 Ga0495580_0638294
1191 Ga0495642_0214308
1192 Ga0495598_0047453
1193 Ga0495598_0143503
1194 Ga0495621_0390952
1195 Ga0495633_0551796
1196 Ga0495588_0662743
1197 Ga0495658_0489078
1198 Ga0495669_0125135
1199 Ga0495674_1314142
1200 Ga0495672_0297261
1201 Ga0496102_0350075
1202 Ga0496104_0664517
1203 Ga0496105_0173873
1204 Ga0496106_0403156
1205 Ga0496108_0024533
1206 Ga0496108_0509845
1207 Ga0496109_0074996
1208 Ga0496110_0380497
1209 Ga0496110_0755876
1210 Ga0496111_0427993
1211 Ga0496113_1023122
1212 Ga0496114_0630614
1213 Ga0501299_168150
1214 Ga0501033_1147942
1215 Ga0501047_0098521
1216 Ga0501070_0823608
1217 Ga0501074_0073503
1218 Ga0501076_1051470
1219 Ga0501243_054046
1220 Ga0501080_0271470
1221 Ga0501044_0254006
1222 nmdc:mga00v17_176468_c1
1223 nmdc:mga00v17_74933_c1
1224 nmdc:mga0k408_171015_c1
1225 nmdc:mga0k408_32784_c1
1226 nmdc:mga0k408_383027_c1
1227 nmdc:mga0k408_47018_c1
1228 nmdc:mga06z11_624968_c1
1229 nmdc:mga06z11_92932_c1
1230 nmdc:mga07m45_194394_c1
1231 nmdc:mga07m45_881412_c1
1232 nmdc:mga05p37_531120_c1
1233 nmdc:mga09592_1118118_c1
1234 nmdc:mga09592_478224_c1
1235 nmdc:mga08y16_29256_c1
1236 nmdc:mga08y16_885789_c1
1237 nmdc:mga0n895_186880_c1
1238 nmdc:mga0rr50_1328295_c1
1239 nmdc:mga0sz30_58998_c1
1240 Ga0500641_0021487
1241 Ga0500628_265067
1242 Ga0466962_0341867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05164

ZapA

Cell division protein ZapA

17

107

0.89

Map