F469976

General Info

Members Datasets Scaffolds Average Seq Length
621 468 371 223

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100176620|Ga0070680_1001766202
Length 213
Sequence MQPLELLAAARAPDGEELRLMRRGGDFMIVLDRNELMNSRMSGSEEALARMACVRLHGRSAPHLLIGGYGMGFTLRAALAALGPQAKLTVAELVPEIIAWARLDDPRVTVAMVDVADLIARARDDYDAILLDVDNGPDGLVRAANDRLYTPAGLAAAGAALKPGGVLAVWSAAKDPAFARRLAKAGFAVDEVTVRARSNGKGARHTIWFAVPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
15 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
16 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
17 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
18 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
19 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
20 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
21 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
22 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
25 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
27 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
28 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
29 2791355260 Rhizobium sp. L9 Isolate Nodule
30 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
31 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
32 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
33 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
34 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
35 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
36 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
37 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
38 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
39 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
40 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
41 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
42 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
43 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
44 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
45 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
46 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
47 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
48 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
49 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
50 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
51 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
52 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
53 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
54 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
55 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
56 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
57 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
58 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
59 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
60 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
61 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
62 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
63 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
64 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
65 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
66 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
67 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
68 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
69 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
70 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
71 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
72 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
73 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
74 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
75 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
76 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
77 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
78 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
79 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
80 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
81 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
82 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
83 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
84 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
85 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
86 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
87 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
88 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
89 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
90 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
91 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
92 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
93 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
94 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
95 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
96 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
97 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
98 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
99 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
100 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
101 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
102 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
103 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
104 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
105 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
106 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
107 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
108 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
109 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
110 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
111 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
112 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
113 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
114 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
115 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
116 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
117 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
118 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
119 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
120 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
121 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
122 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
123 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
124 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
125 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
126 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
127 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
128 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
129 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
130 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
131 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
132 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
133 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
134 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
135 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
136 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
137 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
138 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
139 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
140 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
141 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
142 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
143 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
144 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
145 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
146 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
147 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
148 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
149 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
150 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
151 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
152 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
153 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
154 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
155 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
156 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
157 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
158 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
159 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
160 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
161 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
162 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
163 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
164 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
165 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
166 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
167 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
168 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
169 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
170 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
171 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
172 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
173 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
174 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
175 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
176 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
177 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
178 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
179 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
180 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
181 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
182 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
183 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
184 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
185 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
186 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
187 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
188 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
189 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
190 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
191 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
192 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
193 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
194 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
195 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
196 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
197 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
198 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
199 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
200 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
201 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
202 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
203 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
204 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
205 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
206 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
207 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
208 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
209 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
210 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
211 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
212 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
213 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
214 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
215 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
216 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
217 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
218 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
219 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
220 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
221 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
222 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
223 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
224 3004167301 Mesorhizobium loti 582 Isolate Unclassified
225 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
226 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
227 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
228 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
229 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
230 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
231 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
232 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
233 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
234 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
235 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
236 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
237 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
238 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
239 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
240 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
241 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
242 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
243 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
244 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
245 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
246 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
247 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
248 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
249 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
250 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
251 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
252 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
253 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
254 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
255 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
256 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
257 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
258 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
259 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
260 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
261 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
262 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
263 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
264 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
265 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
266 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
267 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
268 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
269 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
270 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
271 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
272 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
273 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
274 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
275 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
276 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
277 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
278 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
279 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
280 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
281 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
282 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
283 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
284 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
285 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
286 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
287 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
288 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
289 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
290 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
291 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
292 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
293 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
294 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
295 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
296 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
299 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
300 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
301 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
302 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
303 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
304 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
305 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
306 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
307 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
308 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
310 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
311 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
316 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
317 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
318 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
321 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
355 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
359 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
362 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
363 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
364 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
365 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
366 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
367 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
368 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
369 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
374 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
375 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
376 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
377 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
378 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
379 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
382 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
389 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
394 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
395 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
396 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
424 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
425 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
426 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
427 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
431 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
432 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
439 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
442 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
443 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
444 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
445 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
446 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
447 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
448 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
451 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
452 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
453 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
454 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
455 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
456 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
457 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
458 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
459 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
460 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
461 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
462 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
463 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
464 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
465 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
466 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
467 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
468 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.74
Metatranscriptomes 0
Isolates 40.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 14.49
Nodule 33.82
Rhizoplane 2.25
Rhizosphere 40.42
Stem 0
Stem Tuber 0.16
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3259824 2162886007 Bacteria 1462
2 JGI24741J21665_1000024 3300001915 Bacteria 36239
3 JGI24740J21852_10002687 3300001979 Bacteria 7979
4 JGI24740J21852_10028611 3300001979 Bacteria 1840
5 JGI24735J21928_10002769 3300002067 Bacteria 6051
6 JGI24738J21930_10003130 3300002075 Bacteria 4232
7 JGI24749J21850_1000101 3300002076 Bacteria 14836
8 JGI24751J29686_10000169 3300002459 Bacteria 30266
9 JGI25165J46597_1000065 3300003214 Bacteria 199761
10 JGI25165J46597_1000097 3300003214 Bacteria 161115
11 JGI25153J46596_10000027 3300003215 Bacteria 210760
12 Ga0055524_1000154 3300003775 Bacteria 80540
13 Ga0055536_1009436 3300003781 Bacteria 4034
14 Ga0055528_1023276 3300003790 Bacteria 1896
15 Ga0055530_10023688 3300003791 Bacteria 1758
16 Ga0055530_10029684 3300003791 Bacteria 1459
17 Ga0055530_10036069 3300003791 Bacteria 1247
18 Ga0055540_1008732 3300003792 Bacteria 3605
19 Ga0055531_10003354 3300003794 Bacteria 10235
20 Ga0055531_10044356 3300003794 Bacteria 1247
21 Ga0055531_10048036 3300003794 Bacteria 1155
22 Ga0065165_1001318 3300005262 Bacteria 27669
23 Ga0065704_10000570 3300005289 Bacteria 19339
24 Ga0065707_10089315 3300005295 Bacteria 4404
25 Ga0070658_10038430 3300005327 Bacteria 3860
26 Ga0070658_10117009 3300005327 Bacteria 2213
27 Ga0070658_10191300 3300005327 Bacteria 1724
28 Ga0070658_10370045 3300005327 Bacteria 1228
29 Ga0070683_100190241 3300005329 Bacteria 1949
30 Ga0070683_100312241 3300005329 Bacteria 1496
31 Ga0070670_100000003 3300005331 Bacteria 529510
32 Ga0070670_100035678 3300005331 Bacteria 4281
33 Ga0070666_10000500 3300005335 Bacteria 23605
34 Ga0070680_100176620 3300005336 Bacteria 1798
35 Ga0070660_100001575 3300005339 Bacteria 15678
36 Ga0070660_100002948 3300005339 Bacteria 11709
37 Ga0070660_100068440 3300005339 Bacteria 2767
38 Ga0070668_100000096 3300005347 Bacteria 54447
39 Ga0070668_100215443 3300005347 Bacteria 1581
40 Ga0070668_100359527 3300005347 Bacteria 1234
41 Ga0070669_100000018 3300005353 Bacteria 195789
42 Ga0070669_100000044 3300005353 Bacteria 121087
43 Ga0070669_100196260 3300005353 Bacteria 1586
44 Ga0070671_100000493 3300005355 Bacteria 27606
45 Ga0070659_100228475 3300005366 Bacteria 1537
46 Ga0070667_100002353 3300005367 Bacteria 16553
47 Ga0070667_100058375 3300005367 Bacteria 3262
48 Ga0070708_100035021 3300005445 Bacteria 4372
49 Ga0070663_100002638 3300005455 Bacteria 10142
50 Ga0070663_100179097 3300005455 Bacteria 1643
51 Ga0070679_100044538 3300005530 Bacteria 4420
52 Ga0070665_100038607 3300005548 Bacteria 4800
53 Ga0070665_100119702 3300005548 Bacteria 2635
54 Ga0070665_100272664 3300005548 Bacteria 1694
55 Ga0068855_100478537 3300005563 Bacteria 1356
56 Ga0068855_100895020 3300005563 Bacteria 938
57 Ga0068857_100190321 3300005577 Bacteria 1869
58 Ga0068857_100249638 3300005577 Bacteria 1626
59 Ga0068854_100110126 3300005578 Bacteria 2076
60 Ga0068856_100022237 3300005614 Bacteria 6165
61 Ga0068856_100233901 3300005614 Bacteria 1853
62 Ga0068859_100032940 3300005617 Bacteria 5205
63 Ga0068864_100000148 3300005618 Bacteria 66302
64 Ga0068864_100000173 3300005618 Bacteria 59516
65 Ga0068866_10119974 3300005718 Bacteria 1480
66 Ga0068861_100013965 3300005719 Bacteria 5630
67 Ga0068863_100000012 3300005841 Bacteria 229774
68 Ga0068863_100002395 3300005841 Bacteria 18650
69 Ga0068858_100000913 3300005842 Bacteria 30617
70 Ga0068860_100003011 3300005843 Bacteria 17409
71 Ga0068860_100150572 3300005843 Bacteria 2240
72 Ga0068860_100411674 3300005843 Bacteria 1339
73 Ga0068862_100000001 3300005844 Bacteria 523031
74 Ga0068862_100014843 3300005844 Bacteria 6471
75 Ga0075365_10038806 3300006038 Bacteria 3098
76 Ga0075365_10090483 3300006038 Bacteria 2084
77 Ga0075365_10168372 3300006038 Bacteria 1529
78 Ga0075363_100050782 3300006048 Bacteria 2210
79 Ga0075364_10103978 3300006051 Bacteria 1892
80 Ga0075367_10000218 3300006178 Bacteria 19148
81 Ga0075367_10006480 3300006178 Bacteria 5918
82 Ga0075367_10010563 3300006178 Bacteria 4853
83 Ga0075369_10092616 3300006186 Bacteria 1350
84 Ga0075370_10042827 3300006353 Bacteria 2558
85 Ga0075370_10100338 3300006353 Bacteria 1675
86 Ga0097620_100032939 3300006931 Bacteria 5205
87 Ga0105240_10184882 3300009093 Bacteria 2455
88 Ga0105240_10298517 3300009093 Bacteria 1843
89 Ga0105240_10417900 3300009093 Bacteria 1507
90 Ga0105240_10999451 3300009093 Bacteria 895
91 Ga0105240_11029636 3300009093 Bacteria 879
92 Ga0105247_10000542 3300009101 Bacteria 30686
93 Ga0105243_10460981 3300009148 Bacteria 1195
94 Ga0105241_10175967 3300009174 Bacteria 1771
95 Ga0105248_10006642 3300009177 Bacteria 12687
96 Ga0105248_10331418 3300009177 Bacteria 1714
97 Ga0105237_10013669 3300009545 Bacteria 8502
98 Ga0105237_10061299 3300009545 Bacteria 3761
99 Ga0105237_10316980 3300009545 Bacteria 1562
100 Ga0105238_10061642 3300009551 Bacteria 3752
101 Ga0105238_10194856 3300009551 Bacteria 2002
102 Ga0105249_10143475 3300009553 Bacteria 2292
103 Ga0105249_10311571 3300009553 Bacteria 1582
104 Ga0105239_10071947 3300010375 Bacteria 3800
105 Ga0105239_10090941 3300010375 Bacteria 3367
106 Ga0105239_10133975 3300010375 Bacteria 2758
107 Ga0105239_10151493 3300010375 Bacteria 2588
108 Ga0105239_10173392 3300010375 Bacteria 2412
109 Ga0157373_10354778 3300013100 Bacteria 1046
110 Ga0157370_10035140 3300013104 Bacteria 4874
111 Ga0157370_10177475 3300013104 Bacteria 1980
112 Ga0157370_10593953 3300013104 Bacteria 1014
113 Ga0157369_10115097 3300013105 Bacteria 2856
114 Ga0157369_10226648 3300013105 Bacteria 1955
115 Ga0163162_10005580 3300013306 Bacteria 12174
116 Ga0163162_10917884 3300013306 Bacteria 988
117 Ga0157372_10528847 3300013307 Bacteria 1374
118 Ga0157380_10000199 3300014326 Bacteria 35164
119 Ga0157380_10012403 3300014326 Bacteria 6184
120 Ga0182008_10020298 3300014497 Bacteria 3423
121 Ga0157379_10000867 3300014968 Bacteria 24465
122 Ga0182006_1058721 3300015261 Bacteria 1458
123 Ga0182007_10030955 3300015262 Bacteria 1826
124 Ga0163161_10312609 3300017792 Bacteria 1240
125 Ga0207425_1000005 3300025245 Bacteria 900502
126 Ga0209148_1000069 3300025254 Bacteria 334444
127 Ga0209129_1001771 3300025258 Bacteria 11523
128 Ga0209233_1000030 3300025261 Bacteria 636702
129 Ga0209233_1000107 3300025261 Bacteria 267399
130 Ga0209233_1008024 3300025261 Bacteria 3299
131 Ga0209565_1000007 3300025263 Bacteria 784361
132 Ga0209565_1000231 3300025263 Bacteria 61384
133 Ga0209455_1000161 3300025272 Bacteria 117353
134 Ga0209673_1002047 3300025273 Bacteria 15276
135 Ga0209673_1021083 3300025273 Bacteria 2289
136 Ga0209676_1006151 3300025292 Bacteria 6017
137 Ga0209676_1020244 3300025292 Bacteria 2266
138 Ga0209025_1000515 3300025294 Bacteria 73801
139 Ga0209564_1000619 3300025295 Bacteria 54397
140 Ga0209758_1000002 3300025297 Bacteria 1400310
141 Ga0209758_1021487 3300025297 Bacteria 3006
142 Ga0209050_1000001 3300025298 Bacteria 3563507
143 Ga0209050_1000483 3300025298 Bacteria 69796
144 Ga0209050_1010766 3300025298 Bacteria 4453
145 Ga0209256_1000008 3300025299 Bacteria 975723
146 Ga0207426_1009112 3300025302 Bacteria 3947
147 Ga0209051_1000817 3300025303 Bacteria 32251
148 Ga0209257_1003512 3300025304 Bacteria 13341
149 Ga0209257_1004551 3300025304 Bacteria 10618
150 Ga0209257_1004735 3300025304 Bacteria 10173
151 Ga0207656_10012550 3300025321 Bacteria 3224
152 Ga0207642_10160492 3300025899 Bacteria 1207
153 Ga0207710_10015426 3300025900 Bacteria 3228
154 Ga0207680_10000027 3300025903 Bacteria 79852
155 Ga0207647_10105911 3300025904 Bacteria 1665
156 Ga0207705_10000672 3300025909 Bacteria 28444
157 Ga0207705_10000740 3300025909 Bacteria 26919
158 Ga0207705_10027267 3300025909 Bacteria 4074
159 Ga0207705_10447229 3300025909 Bacteria 1002
160 Ga0207654_10331865 3300025911 Bacteria 1043
161 Ga0207695_10340019 3300025913 Bacteria 1389
162 Ga0207695_10750850 3300025913 Bacteria 856
163 Ga0207671_10057970 3300025914 Bacteria 2871
164 Ga0207671_10127162 3300025914 Bacteria 1953
165 Ga0207657_10002663 3300025919 Bacteria 19275
166 Ga0207657_10008478 3300025919 Bacteria 10427
167 Ga0207657_10009160 3300025919 Bacteria 9987
168 Ga0207652_10052289 3300025921 Bacteria 3505
169 Ga0207681_10000008 3300025923 Bacteria 414329
170 Ga0207681_10000041 3300025923 Bacteria 140201
171 Ga0207681_10172682 3300025923 Bacteria 1640
172 Ga0207681_10255946 3300025923 Bacteria 1369
173 Ga0207694_10049376 3300025924 Bacteria 3257
174 Ga0207694_10083431 3300025924 Bacteria 2513
175 Ga0207694_10151065 3300025924 Bacteria 1871
176 Ga0207650_10000004 3300025925 Bacteria 743372
177 Ga0207650_10010246 3300025925 Bacteria 6424
178 Ga0207644_10000006 3300025931 Bacteria 408793
179 Ga0207644_10000070 3300025931 Bacteria 74994
180 Ga0207690_10132001 3300025932 Bacteria 1829
181 Ga0207711_10000658 3300025941 Bacteria 34432
182 Ga0207711_10639004 3300025941 Bacteria 993
183 Ga0207679_10170042 3300025945 Bacteria 1793
184 Ga0207667_10009555 3300025949 Bacteria 11414
185 Ga0207712_10013045 3300025961 Bacteria 5323
186 Ga0207712_10439715 3300025961 Bacteria 1104
187 Ga0207668_10000061 3300025972 Bacteria 89620
188 Ga0207668_10008964 3300025972 Bacteria 5983
189 Ga0207668_10708073 3300025972 Bacteria 885
190 Ga0207640_10079380 3300025981 Bacteria 2237
191 Ga0207640_10257794 3300025981 Bacteria 1357
192 Ga0207658_10019683 3300025986 Bacteria 4668
193 Ga0207703_10091387 3300026035 Bacteria 2560
194 Ga0207639_10001682 3300026041 Bacteria 14921
195 Ga0207639_10005435 3300026041 Bacteria 8604
196 Ga0207639_10065920 3300026041 Bacteria 2812
197 Ga0207678_10002324 3300026067 Bacteria 17232
198 Ga0207641_10000024 3300026088 Bacteria 250751
199 Ga0207641_10002527 3300026088 Bacteria 16854
200 Ga0207676_10000006 3300026095 Bacteria 681936
201 Ga0207676_10002062 3300026095 Bacteria 14589
202 Ga0207674_10055958 3300026116 Bacteria 4007
203 Ga0207674_10127617 3300026116 Bacteria 2508
204 Ga0207675_100000767 3300026118 Bacteria 31990
205 Ga0207698_10034184 3300026142 Bacteria 3703
206 Ga0207698_10142208 3300026142 Bacteria 2069
207 Ga0207698_10189050 3300026142 Bacteria 1832
208 Ga0209813_10000010 3300027866 Bacteria 97592
209 Ga0268266_10086571 3300028379 Bacteria 2740
210 Ga0268266_10166375 3300028379 Bacteria 1998
211 Ga0268265_10000001 3300028380 Bacteria 1230727
212 Ga0268265_10000064 3300028380 Bacteria 144164
213 Ga0268265_11192885 3300028380 Bacteria 758
214 Ga0268264_10000010 3300028381 Bacteria 596543
215 Ga0268264_10004569 3300028381 Bacteria 11786
216 Ga0307408_100000948 3300031548 Bacteria 22509
217 Ga0307408_100045256 3300031548 Bacteria 3142
218 Ga0307408_100081802 3300031548 Bacteria 2415
219 Ga0307508_10001326 3300031616 Bacteria 28003
220 Ga0307405_10019727 3300031731 Bacteria 3752
221 Ga0307405_10124275 3300031731 Bacteria 1771
222 Ga0307405_10132554 3300031731 Bacteria 1724
223 Ga0307405_10365265 3300031731 Bacteria 1118
224 Ga0307413_10178487 3300031824 Bacteria 1511
225 Ga0307410_10038777 3300031852 Bacteria 3123
226 Ga0307406_10074014 3300031901 Bacteria 2241
227 Ga0307406_10296284 3300031901 Bacteria 1240
228 Ga0307412_10003776 3300031911 Bacteria 8418
229 Ga0307412_10033401 3300031911 Bacteria 3270
230 Ga0307412_10709616 3300031911 Bacteria 864
231 Ga0307409_100177298 3300031995 Bacteria 1883
232 Ga0307416_100308980 3300032002 Bacteria 1576
233 Ga0307416_100331046 3300032002 Bacteria 1530
234 Ga0307414_10000105 3300032004 Bacteria 59546
235 Ga0307414_10110597 3300032004 Bacteria 2090
236 Ga0307414_10534410 3300032004 Bacteria 1042
237 Ga0307411_10024942 3300032005 Bacteria 3573
238 Ga0307411_10162083 3300032005 Bacteria 1676
239 Ga0307415_100075336 3300032126 Bacteria 2388
240 Ga0307415_100494721 3300032126 Bacteria 1067
241 Ga0307510_10019674 3300033180 Bacteria 7911
242 Ga0395905_0056747 3300037471 Bacteria 3663
243 Ga0395901_0096573 3300038443 Bacteria 3097
244 Ga0237819_00640 3300038705 Bacteria 11384
245 Ga0439465_0031465 3300041413 Bacteria 1690
246 Ga0439465_0039454 3300041413 Bacteria 1525
247 Ga0439431_0008914 3300041997 Bacteria 2260
248 Ga0439445_0125448 3300042004 Bacteria 738
249 Ga0466972_0155163 3300044658 Bacteria 1075
250 Ga0466968_0010430 3300044735 Bacteria 3602
251 Ga0451576_0371101 3300045051 Bacteria 1499
252 Ga0495638_0000051 3300046460 Bacteria 206003
253 Ga0495638_0034546 3300046460 Bacteria 3228
254 Ga0495638_0044443 3300046460 Bacteria 2798
255 Ga0495638_0188928 3300046460 Bacteria 1170
256 Ga0495664_0085442 3300046477 Bacteria 1894
257 Ga0495583_0000247 3300046506 Bacteria 89254
258 Ga0495583_0000422 3300046506 Bacteria 64011
259 Ga0495583_0006119 3300046506 Bacteria 7939
260 Ga0495616_0000010 3300046513 Bacteria 224378
261 Ga0495632_0001785 3300046519 Bacteria 17349
262 Ga0495648_0000032 3300046524 Bacteria 205970
263 Ga0495645_0021256 3300046543 Bacteria 4689
264 Ga0495622_0090040 3300046557 Bacteria 1410
265 Ga0495633_0010072 3300046558 Bacteria 5181
266 Ga0495668_0003821 3300046616 Bacteria 11027
267 Ga0495625_0101393 3300046660 Bacteria 1977
268 Ga0495625_0222489 3300046660 Bacteria 1236
269 Ga0495661_0030548 3300046665 Bacteria 3430
270 Ga0495661_0254480 3300046665 Bacteria 895
271 Ga0495670_0009593 3300046691 Bacteria 4755
272 Ga0495671_0000020 3300046692 Bacteria 268306
273 Ga0495671_0044743 3300046692 Bacteria 2218
274 Ga0495671_0168517 3300046692 Bacteria 1065
275 Ga0495660_0187040 3300046810 Bacteria 998
276 Ga0495687_034522 3300047443 Bacteria 2285
277 Ga0495677_0010369 3300047445 Bacteria 3424
278 Ga0495673_0000076 3300047469 Bacteria 205985
279 Ga0495686_0021154 3300047472 Bacteria 4326
280 Ga0496102_0128447 3300048905 Bacteria 2371
281 Ga0496102_0212949 3300048905 Bacteria 1822
282 Ga0496102_0604654 3300048905 Bacteria 1019
283 Ga0496106_0000102 3300048909 Bacteria 65345
284 Ga0496108_0003561 3300048911 Bacteria 12489
285 Ga0496109_0377115 3300048912 Bacteria 1340
286 Ga0496109_0948106 3300048912 Bacteria 798
287 Ga0496110_0688493 3300048913 Bacteria 923
288 Ga0496112_0029566 3300048915 Bacteria 5299
289 Ga0496113_0105427 3300048916 Bacteria 2189
290 Ga0496114_0033027 3300048917 Bacteria 4263
291 Ga0496115_0203357 3300048918 Bacteria 1636
292 Ga0496116_0036345 3300048919 Bacteria 3448
293 Ga0496119_0014983 3300048922 Bacteria 6016
294 Ga0496119_0023356 3300048922 Bacteria 4390
295 Ga0496120_0012040 3300048923 Bacteria 5908
296 Ga0496121_0001234 3300048924 Bacteria 44361
297 Ga0496122_0002568 3300048925 Bacteria 25503
298 Ga0496122_0003174 3300048925 Bacteria 21930
299 Ga0496123_0000212 3300048926 Bacteria 118628
300 Ga0496123_0007995 3300048926 Bacteria 9798
301 Ga0496123_0060089 3300048926 Bacteria 2452
302 Ga0496123_0099173 3300048926 Bacteria 1701
303 Ga0496123_0156777 3300048926 Bacteria 1219
304 Ga0496124_0001132 3300048927 Bacteria 41905
305 Ga0496124_0009163 3300048927 Bacteria 10225
306 Ga0496124_0010519 3300048927 Bacteria 9360
307 Ga0496124_0152695 3300048927 Bacteria 1809
308 Ga0496124_0268597 3300048927 Bacteria 1250
309 Ga0496125_0072636 3300048928 Bacteria 2679
310 Ga0496126_0008030 3300048929 Bacteria 11450
311 Ga0496126_0092003 3300048929 Bacteria 2666
312 Ga0496126_0097218 3300048929 Bacteria 2581
313 Ga0496126_0128339 3300048929 Bacteria 2193
314 Ga0496126_0398998 3300048929 Bacteria 1116
315 Ga0495682_0018020 3300049460 Bacteria 2660
316 Ga0501032_0170077 3300049569 Bacteria 1429
317 Ga0501033_0042254 3300049570 Bacteria 3399
318 Ga0501034_0020876 3300049571 Bacteria 6685
319 Ga0501034_0095581 3300049571 Bacteria 2968
320 Ga0501043_0106929 3300049579 Bacteria 2197
321 Ga0501047_0306261 3300049581 Bacteria 1430
322 Ga0501223_004040 3300049663 Bacteria 3158
323 Ga0501224_000234 3300049664 Bacteria 6284
324 Ga0501233_000094 3300049668 Bacteria 11822
325 Ga0501225_0003161 3300049705 Bacteria 5030
326 Ga0501234_003340 3300049707 Bacteria 2522
327 Ga0501035_0004286 3300049822 Bacteria 13543
328 Ga0501035_0317311 3300049822 Bacteria 1310
329 Ga0501044_0135305 3300049823 Bacteria 2456
330 Ga0501044_0629862 3300049823 Bacteria 963
331 Ga0501226_003023 3300049853 Bacteria 2012
332 nmdc:mga03683_100810_c1 3300050489 Bacteria 1269
333 nmdc:mga03n38_13405_c1 3300050490 Bacteria 3113
334 nmdc:mga00v17_66825_c1 3300050491 Bacteria 2220
335 nmdc:mga0yw44_102809_c1 3300050492 Bacteria 1822
336 nmdc:mga0yw44_127845_c1 3300050492 Bacteria 1642
337 nmdc:mga0yw44_135242_c1 3300050492 Bacteria 1599
338 nmdc:mga0yw44_8204_c1 3300050492 Bacteria 5189
339 nmdc:mga0yw44_99840_c1 3300050492 Bacteria 1847
340 nmdc:mga06z11_113491_c1 3300050494 Bacteria 1503
341 nmdc:mga06z11_38371_c1 3300050494 Bacteria 2378
342 nmdc:mga06z11_46_c1 3300050494 Bacteria 51464
343 nmdc:mga04h51_244056_c1 3300050495 Bacteria 718
344 nmdc:mga04h51_35_c1 3300050495 Bacteria 46344
345 nmdc:mga07m45_200875_c1 3300050496 Bacteria 1160
346 nmdc:mga07m45_29058_c1 3300050496 Bacteria 3054
347 nmdc:mga07m45_93894_c1 3300050496 Bacteria 1720
348 nmdc:mga0sz30_54110_c1 3300050516 Bacteria 1706
349 Ga0495601_0028688 3300053077 Bacteria 3448
350 Ga0495612_0019276 3300053078 Bacteria 2733
351 Ga0500610_0090260 3300053079 Bacteria 1592
352 Ga0500643_000379 3300053087 Bacteria 34719
353 Ga0500643_004423 3300053087 Bacteria 6359
354 Ga0500643_006012 3300053087 Bacteria 5136
355 Ga0500643_006128 3300053087 Bacteria 5074
356 Ga0500641_0004908 3300053096 Bacteria 4736
357 Ga0500555_008525 3300053103 Bacteria 2924
358 Ga0500594_0057604 3300053118 Bacteria 1111
359 Ga0500595_000319 3300053119 Bacteria 31631
360 Ga0500595_043697 3300053119 Bacteria 1425
361 Ga0500658_0012086 3300053134 Bacteria 3182
362 Ga0500658_0047183 3300053134 Bacteria 1747
363 Ga0500559_0001014 3300053136 Bacteria 17265
364 Ga0500568_0102073 3300053139 Bacteria 1075
365 Ga0500588_0025297 3300053146 Bacteria 1649
366 Ga0500604_0001130 3300053151 Bacteria 7405
367 Ga0500604_0027293 3300053151 Bacteria 1651
368 Ga0500616_0013697 3300053153 Bacteria 4694
369 Ga0500620_000291 3300053155 Bacteria 9633
370 Ga0500627_0024602 3300053158 Bacteria 2466
371 Ga0500627_0058893 3300053158 Bacteria 1686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2874109183 2874111134 194
2 iso_pu_bacteria 2885318864 2885321663 194
3 iso_pu_bacteria 2979742915 2979745287 194
4 iso_pu_bacteria 2958172287 2958176882 197
5 iso_pu_bacteria 2885409591 2885415665 198
6 iso_pu_bacteria 2968138860 2968146223 199
7 iso_pu_bacteria 3004334049 3004336228 204
8 3300050492 nmdc:mga0yw44_99840_c1 nmdc:mga0yw44_99840_c1_1062_1703 211
9 3300053158 Ga0500627_0024602 Ga0500627_0024602_407_1045 211
10 3300005336 Ga0070680_100176620 Ga0070680_1001766202 213
11 3300005844 Ga0068862_100014843 Ga0068862_1000148432 213
12 3300048918 Ga0496115_0203357 Ga0496115_0203357_621_1280 217
13 iso_pu_bacteria 2513237351 2514587152 217
14 iso_pu_bacteria 2643221622 2644127792 217
15 iso_pu_bacteria 2643221623 2644134014 217
16 iso_pu_bacteria 2996310559 2996315700 217
17 iso_pu_bacteria 3004167301 3004174341 217
18 3300009101 Ga0105247_10000542 Ga0105247_1000054220 218
19 3300009553 Ga0105249_10143475 Ga0105249_101434753 218
20 iso_pu_bacteria 2503198000 2503199580 218
21 iso_pu_bacteria 2508501123 2509115228 218
22 iso_pu_bacteria 2509276018 2509371022 218
23 iso_pu_bacteria 2509276022 2509394506 218
24 iso_pu_bacteria 2510065019 2510136570 218
25 iso_pu_bacteria 2510065059 2510319135 218
26 iso_pu_bacteria 2512875016 2512933016 218
27 iso_pu_bacteria 2512875024 2512961039 218
28 iso_pu_bacteria 2513237090 2513611228 218
29 iso_pu_bacteria 2513237146 2513928823 218
30 iso_pu_bacteria 2513237305 2514417217 218
31 iso_pu_bacteria 2517093000 2517098551 218
32 iso_pu_bacteria 2588253730 2588519069 218
33 iso_pu_bacteria 2599185170 2599414840 218
34 iso_pu_bacteria 2599185301 2599939087 218
35 iso_pu_bacteria 2599185359 2600225773 218
36 iso_pu_bacteria 2643221595 2643986107 218
37 iso_pu_bacteria 2643221627 2644153672 218
38 iso_pu_bacteria 2687453392 2688596830 218
39 iso_pu_bacteria 2693429784 2694637989 218
40 iso_pu_bacteria 2721755686 2723573950 218
41 iso_pu_bacteria 2756170246 2756677363 218
42 iso_pu_bacteria 2791355123 2792748419 218
43 iso_pu_bacteria 2791355260 2793323964 218
44 iso_pu_bacteria 2818991466 2819716425 218
45 iso_pu_bacteria 2837678835 2837680527 218
46 iso_pu_bacteria 2838035591 2838039441 218
47 iso_pu_bacteria 2838661181 2838667615 218
48 iso_pu_bacteria 2841734538 2841737317 218
49 iso_pu_bacteria 2844002411 2844009146 218
50 iso_pu_bacteria 2856320880 2856322660 218
51 iso_pu_bacteria 2856328259 2856328869 218
52 iso_pu_bacteria 2856334872 2856334947 218
53 iso_pu_bacteria 2856342000 2856348018 218
54 iso_pu_bacteria 2856364286 2856366696 218
55 iso_pu_bacteria 2857349434 2857356619 218
56 iso_pu_bacteria 2857367948 2857371449 218
57 iso_pu_bacteria 2869162929 2869165134 218
58 iso_pu_bacteria 2869169390 2869173577 218
59 iso_pu_bacteria 2869234852 2869240129 218
60 iso_pu_bacteria 2869242130 2869244657 218
61 iso_pu_bacteria 2869249662 2869250568 218
62 iso_pu_bacteria 2869256925 2869258960 218
63 iso_pu_bacteria 2869264136 2869265293 218
64 iso_pu_bacteria 2869271264 2869274842 218
65 iso_pu_bacteria 2869278585 2869285822 218
66 iso_pu_bacteria 2869285874 2869287893 218
67 iso_pu_bacteria 2871429161 2871435841 218
68 iso_pu_bacteria 2871451962 2871455863 218
69 iso_pu_bacteria 2871459585 2871463882 218
70 iso_pu_bacteria 2871466892 2871472533 218
71 iso_pu_bacteria 2871474448 2871479378 218
72 iso_pu_bacteria 2871481445 2871487787 218
73 iso_pu_bacteria 2871488783 2871489886 218
74 iso_pu_bacteria 2874116593 2874117376 218
75 iso_pu_bacteria 2874131515 2874133707 218
76 iso_pu_bacteria 2874146452 2874151526 218
77 iso_pu_bacteria 2874155637 2874159158 218
78 iso_pu_bacteria 2874162495 2874167585 218
79 iso_pu_bacteria 2874168670 2874175709 218
80 iso_pu_bacteria 2876363079 2876364736 218
81 iso_pu_bacteria 2876386047 2876386682 218
82 iso_pu_bacteria 2876392853 2876396208 218
83 iso_pu_bacteria 2876399893 2876405905 218
84 iso_pu_bacteria 2876406927 2876410488 218
85 iso_pu_bacteria 2876413966 2876417577 218
86 iso_pu_bacteria 2876420981 2876424150 218
87 iso_pu_bacteria 2878738818 2878739397 218
88 iso_pu_bacteria 2878745973 2878749404 218
89 iso_pu_bacteria 2878753008 2878754416 218
90 iso_pu_bacteria 2878760144 2878762222 218
91 iso_pu_bacteria 2878767105 2878769189 218
92 iso_pu_bacteria 2878774303 2878777203 218
93 iso_pu_bacteria 2878781027 2878787463 218
94 iso_pu_bacteria 2881147464 2881149401 218
95 iso_pu_bacteria 2881161766 2881166303 218
96 iso_pu_bacteria 2881845957 2881848357 218
97 iso_pu_bacteria 2881861095 2881861636 218
98 iso_pu_bacteria 2882632389 2882634074 218
99 iso_pu_bacteria 2882912400 2882919350 218
100 iso_pu_bacteria 2885305155 2885307731 218
101 iso_pu_bacteria 2885312484 2885313273 218
102 iso_pu_bacteria 2885326080 2885330195 218
103 iso_pu_bacteria 2885334103 2885337896 218
104 iso_pu_bacteria 2885350715 2885354158 218
105 iso_pu_bacteria 2888343758 2888345248 218
106 iso_pu_bacteria 2888350351 2888354540 218
107 iso_pu_bacteria 2889010040 2889016144 218
108 iso_pu_bacteria 2889016732 2889018816 218
109 iso_pu_bacteria 2903448605 2903449278 218
110 iso_pu_bacteria 2903492973 2903493635 218
111 iso_pu_bacteria 2903492973 2903497621 218
112 iso_pu_bacteria 2903521522 2903522528 218
113 iso_pu_bacteria 2903528002 2903528907 218
114 iso_pu_bacteria 2903540706 2903542798 218
115 iso_pu_bacteria 2904659560 2904662984 218
116 iso_pu_bacteria 2906308376 2906310442 218
117 iso_pu_bacteria 2906321335 2906324507 218
118 iso_pu_bacteria 2906354277 2906355240 218
119 iso_pu_bacteria 2906363423 2906364321 218
120 iso_pu_bacteria 2906378014 2906385262 218
121 iso_pu_bacteria 2906386501 2906390820 218
122 iso_pu_bacteria 2906393657 2906396859 218
123 iso_pu_bacteria 2906401398 2906405638 218
124 iso_pu_bacteria 2906408224 2906413437 218
125 iso_pu_bacteria 2922151315 2922154824 218
126 iso_pu_bacteria 2922172374 2922173306 218
127 iso_pu_bacteria 2922178524 2922184244 218
128 iso_pu_bacteria 2924710171 2924714559 218
129 iso_pu_bacteria 2924718760 2924726355 218
130 iso_pu_bacteria 2924733363 2924736336 218
131 iso_pu_bacteria 2924741084 2924741313 218
132 iso_pu_bacteria 2924748358 2924748790 218
133 iso_pu_bacteria 2924754689 2924757032 218
134 iso_pu_bacteria 2924776078 2924776918 218
135 iso_pu_bacteria 2924784321 2924790196 218
136 iso_pu_bacteria 2928526807 2928528766 218
137 iso_pu_bacteria 2928968154 2928970320 218
138 iso_pu_bacteria 2937813078 2937817270 218
139 iso_pu_bacteria 2937822353 2937828377 218
140 iso_pu_bacteria 2937836603 2937837551 218
141 iso_pu_bacteria 2937848649 2937855456 218
142 iso_pu_bacteria 2937861824 2937865532 218
143 iso_pu_bacteria 2937868953 2937875720 218
144 iso_pu_bacteria 2937877337 2937883482 218
145 iso_pu_bacteria 2937972304 2937973539 218
146 iso_pu_bacteria 2937980651 2937984643 218
147 iso_pu_bacteria 2937994558 2937996649 218
148 iso_pu_bacteria 2958034702 2958041838 218
149 iso_pu_bacteria 2958041894 2958046682 218
150 iso_pu_bacteria 2958041894 2958050369 218
151 iso_pu_bacteria 2958064165 2958070093 218
152 iso_pu_bacteria 2958071322 2958073616 218
153 iso_pu_bacteria 2958084443 2958090649 218
154 iso_pu_bacteria 2958100919 2958108057 218
155 iso_pu_bacteria 2958108152 2958112167 218
156 iso_pu_bacteria 2958122699 2958125908 218
157 iso_pu_bacteria 2958130278 2958132297 218
158 iso_pu_bacteria 2958137437 2958139967 218
159 iso_pu_bacteria 2958144490 2958148653 218
160 iso_pu_bacteria 2958158011 2958161137 218
161 iso_pu_bacteria 2958165035 2958167120 218
162 iso_pu_bacteria 2958179912 2958182111 218
163 iso_pu_bacteria 2961077736 2961079955 218
164 iso_pu_bacteria 2961114664 2961118010 218
165 iso_pu_bacteria 2961127735 2961133778 218
166 iso_pu_bacteria 2961136820 2961143518 218
167 iso_pu_bacteria 2961163497 2961165589 218
168 iso_pu_bacteria 2961170736 2961171846 218
169 iso_pu_bacteria 2961183825 2961185098 218
170 iso_pu_bacteria 2963644680 2963646192 218
171 iso_pu_bacteria 2965018300 2965020412 218
172 iso_pu_bacteria 2965025482 2965025657 218
173 iso_pu_bacteria 2965032056 2965035782 218
174 iso_pu_bacteria 2965040258 2965047209 218
175 iso_pu_bacteria 2965047637 2965052196 218
176 iso_pu_bacteria 2965089291 2965092234 218
177 iso_pu_bacteria 2965102966 2965104422 218
178 iso_pu_bacteria 2965110997 2965118482 218
179 iso_pu_bacteria 2965119406 2965122180 218
180 iso_pu_bacteria 2967996073 2967996953 218
181 iso_pu_bacteria 2968003550 2968005014 218
182 iso_pu_bacteria 2968016561 2968016665 218
183 iso_pu_bacteria 2968083720 2968085341 218
184 iso_pu_bacteria 2968110612 2968114071 218
185 iso_pu_bacteria 2968117919 2968123262 218
186 iso_pu_bacteria 2968171901 2968173991 218
187 iso_pu_bacteria 2970469710 2970470007 218
188 iso_pu_bacteria 2970489779 2970492615 218
189 iso_pu_bacteria 2970503327 2970504444 218
190 iso_pu_bacteria 2970510686 2970515199 218
191 iso_pu_bacteria 2970524798 2970526962 218
192 iso_pu_bacteria 2970532167 2970536249 218
193 iso_pu_bacteria 2970547951 2970554831 218
194 iso_pu_bacteria 2970554993 2970557077 218
195 iso_pu_bacteria 2970593180 2970600439 218
196 iso_pu_bacteria 2970619444 2970627041 218
197 iso_pu_bacteria 2970627176 2970633222 218
198 iso_pu_bacteria 2977821940 2977823633 218
199 iso_pu_bacteria 2977828996 2977831501 218
200 iso_pu_bacteria 2977843712 2977847559 218
201 iso_pu_bacteria 2977851361 2977857619 218
202 iso_pu_bacteria 2977864932 2977871038 218
203 iso_pu_bacteria 2977872689 2977876899 218
204 iso_pu_bacteria 2977898635 2977906327 218
205 iso_pu_bacteria 2977907340 2977911210 218
206 iso_pu_bacteria 2977922695 2977928836 218
207 iso_pu_bacteria 2977935797 2977940504 218
208 iso_pu_bacteria 2977950692 2977952221 218
209 iso_pu_bacteria 2977957713 2977965055 218
210 iso_pu_bacteria 2977971508 2977972902 218
211 iso_pu_bacteria 2977986579 2977991815 218
212 iso_pu_bacteria 2979710463 2979714673 218
213 iso_pu_bacteria 2979764755 2979771916 218
214 iso_pu_bacteria 2979772303 2979772618 218
215 iso_pu_bacteria 2979793036 2979799671 218
216 iso_pu_bacteria 2979808191 2979809081 218
217 iso_pu_bacteria 2987636660 2987643899 218
218 iso_pu_bacteria 2987645492 2987648916 218
219 iso_pu_bacteria 2987652177 2987657329 218
220 iso_pu_bacteria 2987659509 2987661597 218
221 iso_pu_bacteria 2987673487 2987677757 218
222 iso_pu_bacteria 2996348954 2996353064 218
223 iso_pu_bacteria 2996386984 2996389682 218
224 iso_pu_bacteria 3000135777 3000141348 218
225 iso_pu_bacteria 3004188549 3004190646 218
226 iso_pu_bacteria 3004195979 3004201228 218
227 iso_pu_bacteria 3004203850 3004208048 218
228 iso_pu_bacteria 3004211236 3004211481 218
229 iso_pu_bacteria 3004218560 3004224970 218
230 iso_pu_bacteria 3004248173 3004254869 218
231 iso_pu_bacteria 3004268573 3004270600 218
232 iso_pu_bacteria 3004275668 3004279746 218
233 iso_pu_bacteria 3004289098 3004295237 218
234 iso_pu_bacteria 637000159 637076097 218
235 iso_pu_bacteria 649633066 649871389 218
236 iso_pu_bacteria 8004300914 8004301339 218
237 iso_pu_bacteria 8004312739 8004315102 218
238 iso_pu_bacteria 8004361976 8004367893 218
239 iso_pu_bacteria 8004374579 8004375992 218
240 iso_pu_bacteria 8004387939 8004389681 218
241 iso_pu_bacteria 8004395343 8004402895 218
242 iso_pu_bacteria 8004633249 8004637973 218
243 iso_pu_bacteria 8004640170 8004645533 218
244 iso_pu_bacteria 8004695233 8004703332 218
245 iso_pu_bacteria 8004714634 8004718078 218
246 iso_pu_bacteria 8004727605 8004732936 218
247 iso_pu_bacteria 8055617313 8055618811 218
248 iso_pu_bacteria 2775507255 2778126544 219
249 iso_pu_bacteria 2808606401 2809064658 219
250 iso_pu_bacteria 2808606404 2809080673 219
251 iso_pu_bacteria 2808606405 2809085038 219
252 iso_pu_bacteria 2880518877 2880519550 219
253 iso_pu_bacteria 2885427238 2885427535 219
254 iso_pu_bacteria 2919709256 2919710064 219
255 iso_pu_bacteria 2928027323 2928027783 219
256 iso_pu_bacteria 2984564862 2984567711 219
257 3300003775 Ga0055524_1000154 Ga0055524_100015463 221
258 3300003790 Ga0055528_1023276 Ga0055528_10232762 221
259 3300003791 Ga0055530_10029684 Ga0055530_100296842 221
260 3300003794 Ga0055531_10003354 Ga0055531_100033543 221
261 3300005262 Ga0065165_1001318 Ga0065165_100131814 221
262 3300005327 Ga0070658_10038430 Ga0070658_100384302 221
263 3300005339 Ga0070660_100001575 Ga0070660_1000015759 221
264 3300005530 Ga0070679_100044538 Ga0070679_1000445382 221
265 3300025263 Ga0209565_1000007 Ga0209565_1000007592 221
266 3300025273 Ga0209673_1002047 Ga0209673_10020478 221
267 3300025297 Ga0209758_1021487 Ga0209758_10214874 221
268 3300025298 Ga0209050_1010766 Ga0209050_10107664 221
269 3300025299 Ga0209256_1000008 Ga0209256_1000008434 221
270 3300025304 Ga0209257_1003512 Ga0209257_10035122 221
271 3300025909 Ga0207705_10000740 Ga0207705_100007404 221
272 3300025919 Ga0207657_10002663 Ga0207657_1000266316 221
273 3300025921 Ga0207652_10052289 Ga0207652_100522892 221
274 3300025924 Ga0207694_10083431 Ga0207694_100834312 221
275 3300025949 Ga0207667_10009555 Ga0207667_1000955511 221
276 3300037471 Ga0395905_0056747 Ga0395905_0056747_67_735 221
277 3300038443 Ga0395901_0096573 Ga0395901_0096573_484_1152 221
278 3300041413 Ga0439465_0031465 Ga0439465_0031465_473_1141 221
279 3300041997 Ga0439431_0008914 Ga0439431_0008914_1444_2112 221
280 3300042004 Ga0439445_0125448 Ga0439445_0125448_24_692 221
281 3300046665 Ga0495661_0254480 Ga0495661_0254480_184_852 221
282 3300049569 Ga0501032_0170077 Ga0501032_0170077_189_863 221
283 3300049570 Ga0501033_0042254 Ga0501033_0042254_1606_2280 221
284 3300049571 Ga0501034_0095581 Ga0501034_0095581_403_1077 221
285 3300049579 Ga0501043_0106929 Ga0501043_0106929_215_889 221
286 3300049822 Ga0501035_0004286 Ga0501035_0004286_12029_12703 221
287 3300049823 Ga0501044_0135305 Ga0501044_0135305_313_987 221
288 3300053087 Ga0500643_004423 Ga0500643_004423_3613_4281 221
289 3300053134 Ga0500658_0047183 Ga0500658_0047183_980_1648 221
290 3300001915 JGI24741J21665_1000024 JGI24741J21665_100002436 222
291 3300001979 JGI24740J21852_10002687 JGI24740J21852_100026878 222
292 3300001979 JGI24740J21852_10028611 JGI24740J21852_100286112 222
293 3300002067 JGI24735J21928_10002769 JGI24735J21928_100027697 222
294 3300002075 JGI24738J21930_10003130 JGI24738J21930_100031306 222
295 3300003214 JGI25165J46597_1000065 JGI25165J46597_1000065107 222
296 3300003214 JGI25165J46597_1000097 JGI25165J46597_1000097121 222
297 3300003215 JGI25153J46596_10000027 JGI25153J46596_10000027175 222
298 3300003781 Ga0055536_1009436 Ga0055536_10094361 222
299 3300003791 Ga0055530_10023688 Ga0055530_100236882 222
300 3300003791 Ga0055530_10036069 Ga0055530_100360691 222
301 3300003792 Ga0055540_1008732 Ga0055540_10087322 222
302 3300003794 Ga0055531_10044356 Ga0055531_100443561 222
303 3300003794 Ga0055531_10048036 Ga0055531_100480361 222
304 3300005327 Ga0070658_10117009 Ga0070658_101170092 222
305 3300005327 Ga0070658_10191300 Ga0070658_101913001 222
306 3300005329 Ga0070683_100312241 Ga0070683_1003122413 222
307 3300005339 Ga0070660_100068440 Ga0070660_1000684401 222
308 3300005366 Ga0070659_100228475 Ga0070659_1002284752 222
309 3300005455 Ga0070663_100002638 Ga0070663_1000026388 222
310 3300005548 Ga0070665_100038607 Ga0070665_1000386072 222
311 3300005548 Ga0070665_100272664 Ga0070665_1002726642 222
312 3300005563 Ga0068855_100478537 Ga0068855_1004785372 222
313 3300005577 Ga0068857_100249638 Ga0068857_1002496382 222
314 3300005578 Ga0068854_100110126 Ga0068854_1001101262 222
315 3300005614 Ga0068856_100022237 Ga0068856_1000222373 222
316 3300005614 Ga0068856_100233901 Ga0068856_1002339011 222
317 3300005718 Ga0068866_10119974 Ga0068866_101199742 222
318 3300006038 Ga0075365_10038806 Ga0075365_100388064 222
319 3300006038 Ga0075365_10090483 Ga0075365_100904833 222
320 3300006038 Ga0075365_10168372 Ga0075365_101683722 222
321 3300006051 Ga0075364_10103978 Ga0075364_101039784 222
322 3300006178 Ga0075367_10006480 Ga0075367_100064802 222
323 3300006178 Ga0075367_10010563 Ga0075367_100105631 222
324 3300006186 Ga0075369_10092616 Ga0075369_100926163 222
325 3300006353 Ga0075370_10100338 Ga0075370_101003383 222
326 3300009093 Ga0105240_10184882 Ga0105240_101848823 222
327 3300009093 Ga0105240_10298517 Ga0105240_102985171 222
328 3300009093 Ga0105240_10417900 Ga0105240_104179002 222
329 3300009093 Ga0105240_10999451 Ga0105240_109994512 222
330 3300009093 Ga0105240_11029636 Ga0105240_110296361 222
331 3300009148 Ga0105243_10460981 Ga0105243_104609811 222
332 3300009174 Ga0105241_10175967 Ga0105241_101759671 222
333 3300009177 Ga0105248_10331418 Ga0105248_103314181 222
334 3300009545 Ga0105237_10013669 Ga0105237_100136698 222
335 3300009545 Ga0105237_10061299 Ga0105237_100612992 222
336 3300009545 Ga0105237_10316980 Ga0105237_103169802 222
337 3300009551 Ga0105238_10061642 Ga0105238_100616422 222
338 3300009551 Ga0105238_10194856 Ga0105238_101948563 222
339 3300010375 Ga0105239_10071947 Ga0105239_100719474 222
340 3300010375 Ga0105239_10090941 Ga0105239_100909412 222
341 3300010375 Ga0105239_10133975 Ga0105239_101339753 222
342 3300010375 Ga0105239_10151493 Ga0105239_101514934 222
343 3300010375 Ga0105239_10173392 Ga0105239_101733923 222
344 3300013100 Ga0157373_10354778 Ga0157373_103547781 222
345 3300013104 Ga0157370_10035140 Ga0157370_100351405 222
346 3300013104 Ga0157370_10177475 Ga0157370_101774752 222
347 3300013105 Ga0157369_10115097 Ga0157369_101150973 222
348 3300013105 Ga0157369_10226648 Ga0157369_102266484 222
349 3300013307 Ga0157372_10528847 Ga0157372_105288472 222
350 3300014326 Ga0157380_10012403 Ga0157380_100124033 222
351 3300014497 Ga0182008_10020298 Ga0182008_100202984 222
352 3300015261 Ga0182006_1058721 Ga0182006_10587212 222
353 3300015262 Ga0182007_10030955 Ga0182007_100309551 222
354 3300025245 Ga0207425_1000005 Ga0207425_1000005229 222
355 3300025254 Ga0209148_1000069 Ga0209148_1000069307 222
356 3300025258 Ga0209129_1001771 Ga0209129_10017715 222
357 3300025261 Ga0209233_1000030 Ga0209233_1000030526 222
358 3300025261 Ga0209233_1000107 Ga0209233_1000107102 222
359 3300025261 Ga0209233_1008024 Ga0209233_10080242 222
360 3300025263 Ga0209565_1000231 Ga0209565_100023147 222
361 3300025272 Ga0209455_1000161 Ga0209455_100016161 222
362 3300025273 Ga0209673_1021083 Ga0209673_10210832 222
363 3300025292 Ga0209676_1006151 Ga0209676_10061514 222
364 3300025292 Ga0209676_1020244 Ga0209676_10202441 222
365 3300025294 Ga0209025_1000515 Ga0209025_100051528 222
366 3300025295 Ga0209564_1000619 Ga0209564_100061949 222
367 3300025297 Ga0209758_1000002 Ga0209758_10000021115 222
368 3300025298 Ga0209050_1000001 Ga0209050_10000011103 222
369 3300025298 Ga0209050_1000483 Ga0209050_100048320 222
370 3300025302 Ga0207426_1009112 Ga0207426_10091122 222
371 3300025303 Ga0209051_1000817 Ga0209051_10008172 222
372 3300025304 Ga0209257_1004551 Ga0209257_10045516 222
373 3300025304 Ga0209257_1004735 Ga0209257_10047356 222
374 3300025321 Ga0207656_10012550 Ga0207656_100125502 222
375 3300025899 Ga0207642_10160492 Ga0207642_101604922 222
376 3300025904 Ga0207647_10105911 Ga0207647_101059113 222
377 3300025909 Ga0207705_10447229 Ga0207705_104472292 222
378 3300025911 Ga0207654_10331865 Ga0207654_103318651 222
379 3300025913 Ga0207695_10340019 Ga0207695_103400192 222
380 3300025913 Ga0207695_10750850 Ga0207695_107508501 222
381 3300025914 Ga0207671_10057970 Ga0207671_100579702 222
382 3300025914 Ga0207671_10127162 Ga0207671_101271623 222
383 3300025919 Ga0207657_10008478 Ga0207657_1000847810 222
384 3300025924 Ga0207694_10049376 Ga0207694_100493764 222
385 3300025924 Ga0207694_10151065 Ga0207694_101510652 222
386 3300025932 Ga0207690_10132001 Ga0207690_101320013 222
387 3300025941 Ga0207711_10639004 Ga0207711_106390042 222
388 3300025945 Ga0207679_10170042 Ga0207679_101700423 222
389 3300025981 Ga0207640_10079380 Ga0207640_100793802 222
390 3300025981 Ga0207640_10257794 Ga0207640_102577942 222
391 3300026041 Ga0207639_10005435 Ga0207639_100054357 222
392 3300026041 Ga0207639_10065920 Ga0207639_100659201 222
393 3300026067 Ga0207678_10002324 Ga0207678_100023244 222
394 3300026116 Ga0207674_10127617 Ga0207674_101276173 222
395 3300026142 Ga0207698_10034184 Ga0207698_100341844 222
396 3300026142 Ga0207698_10142208 Ga0207698_101422082 222
397 3300028379 Ga0268266_10086571 Ga0268266_100865712 222
398 3300028379 Ga0268266_10166375 Ga0268266_101663753 222
399 3300031548 Ga0307408_100000948 Ga0307408_10000094818 222
400 3300031616 Ga0307508_10001326 Ga0307508_1000132618 222
401 3300031731 Ga0307405_10019727 Ga0307405_100197275 222
402 3300031824 Ga0307413_10178487 Ga0307413_101784872 222
403 3300031901 Ga0307406_10296284 Ga0307406_102962842 222
404 3300032002 Ga0307416_100331046 Ga0307416_1003310461 222
405 3300032005 Ga0307411_10162083 Ga0307411_101620832 222
406 3300041413 Ga0439465_0039454 Ga0439465_0039454_552_1226 222
407 3300044658 Ga0466972_0155163 Ga0466972_0155163_303_977 222
408 3300046460 Ga0495638_0034546 Ga0495638_0034546_171_851 222
409 3300046477 Ga0495664_0085442 Ga0495664_0085442_902_1663 222
410 3300046543 Ga0495645_0021256 Ga0495645_0021256_2712_3473 222
411 3300046660 Ga0495625_0222489 Ga0495625_0222489_493_1173 222
412 3300046810 Ga0495660_0187040 Ga0495660_0187040_68_742 222
413 3300047443 Ga0495687_034522 Ga0495687_034522_1006_1683 222
414 3300048905 Ga0496102_0128447 Ga0496102_0128447_891_1571 222
415 3300048905 Ga0496102_0212949 Ga0496102_0212949_846_1520 222
416 3300048905 Ga0496102_0604654 Ga0496102_0604654_153_824 222
417 3300048909 Ga0496106_0000102 Ga0496106_0000102_26060_26740 222
418 3300048912 Ga0496109_0377115 Ga0496109_0377115_437_1117 222
419 3300048912 Ga0496109_0948106 Ga0496109_0948106_19_693 222
420 3300048915 Ga0496112_0029566 Ga0496112_0029566_732_1406 222
421 3300048916 Ga0496113_0105427 Ga0496113_0105427_695_1369 222
422 3300048922 Ga0496119_0014983 Ga0496119_0014983_1497_2171 222
423 3300048922 Ga0496119_0023356 Ga0496119_0023356_175_870 222
424 3300048923 Ga0496120_0012040 Ga0496120_0012040_2631_3305 222
425 3300048925 Ga0496122_0003174 Ga0496122_0003174_14239_14934 222
426 3300048926 Ga0496123_0007995 Ga0496123_0007995_1982_2677 222
427 3300048926 Ga0496123_0060089 Ga0496123_0060089_308_976 222
428 3300048926 Ga0496123_0099173 Ga0496123_0099173_164_832 222
429 3300048926 Ga0496123_0156777 Ga0496123_0156777_423_1091 222
430 3300048927 Ga0496124_0001132 Ga0496124_0001132_26614_27282 222
431 3300048927 Ga0496124_0009163 Ga0496124_0009163_7157_7825 222
432 3300048927 Ga0496124_0010519 Ga0496124_0010519_6817_7485 222
433 3300048927 Ga0496124_0152695 Ga0496124_0152695_538_1218 222
434 3300048929 Ga0496126_0398998 Ga0496126_0398998_204_884 222
435 3300050489 nmdc:mga03683_100810_c1 nmdc:mga03683_100810_c1_92_763 222
436 3300050491 nmdc:mga00v17_66825_c1 nmdc:mga00v17_66825_c1_92_766 222
437 3300050492 nmdc:mga0yw44_102809_c1 nmdc:mga0yw44_102809_c1_808_1482 222
438 3300050492 nmdc:mga0yw44_127845_c1 nmdc:mga0yw44_127845_c1_408_1088 222
439 3300050492 nmdc:mga0yw44_135242_c1 nmdc:mga0yw44_135242_c1_104_775 222
440 3300050492 nmdc:mga0yw44_8204_c1 nmdc:mga0yw44_8204_c1_136_810 222
441 3300050494 nmdc:mga06z11_113491_c1 nmdc:mga06z11_113491_c1_55_729 222
442 3300050494 nmdc:mga06z11_38371_c1 nmdc:mga06z11_38371_c1_1694_2368 222
443 3300050495 nmdc:mga04h51_244056_c1 nmdc:mga04h51_244056_c1_13_684 222
444 3300050496 nmdc:mga07m45_200875_c1 nmdc:mga07m45_200875_c1_310_981 222
445 3300050496 nmdc:mga07m45_93894_c1 nmdc:mga07m45_93894_c1_423_1097 222
446 3300050516 nmdc:mga0sz30_54110_c1 nmdc:mga0sz30_54110_c1_260_931 222
447 3300053077 Ga0495601_0028688 Ga0495601_0028688_2445_3206 222
448 3300053078 Ga0495612_0019276 Ga0495612_0019276_294_1055 222
449 3300053079 Ga0500610_0090260 Ga0500610_0090260_384_1058 222
450 3300053096 Ga0500641_0004908 Ga0500641_0004908_3901_4572 222
451 3300053119 Ga0500595_000319 Ga0500595_000319_15689_16357 222
452 3300053119 Ga0500595_043697 Ga0500595_043697_194_874 222
453 3300053134 Ga0500658_0012086 Ga0500658_0012086_877_1557 222
454 3300053151 Ga0500604_0027293 Ga0500604_0027293_477_1154 222
455 3300053153 Ga0500616_0013697 Ga0500616_0013697_2754_3452 222
456 3300053155 Ga0500620_000291 Ga0500620_000291_2379_3050 222
457 3300053158 Ga0500627_0058893 Ga0500627_0058893_639_1316 222
458 iso_pu_bacteria 3004239961 3004241032 222
459 2162886007 SwRhRL2b_contig_3259824 SwRhRL2b_0692.00004600 223
460 3300002076 JGI24749J21850_1000101 JGI24749J21850_10001014 223
461 3300002459 JGI24751J29686_10000169 JGI24751J29686_1000016915 223
462 3300005289 Ga0065704_10000570 Ga0065704_100005702 223
463 3300005295 Ga0065707_10089315 Ga0065707_100893155 223
464 3300005327 Ga0070658_10370045 Ga0070658_103700452 223
465 3300005329 Ga0070683_100190241 Ga0070683_1001902412 223
466 3300005331 Ga0070670_100000003 Ga0070670_10000000343 223
467 3300005331 Ga0070670_100035678 Ga0070670_1000356782 223
468 3300005335 Ga0070666_10000500 Ga0070666_1000050025 223
469 3300005339 Ga0070660_100002948 Ga0070660_1000029487 223
470 3300005347 Ga0070668_100000096 Ga0070668_10000009613 223
471 3300005347 Ga0070668_100215443 Ga0070668_1002154432 223
472 3300005347 Ga0070668_100359527 Ga0070668_1003595271 223
473 3300005353 Ga0070669_100000018 Ga0070669_100000018158 223
474 3300005353 Ga0070669_100000044 Ga0070669_10000004471 223
475 3300005353 Ga0070669_100196260 Ga0070669_1001962601 223
476 3300005355 Ga0070671_100000493 Ga0070671_10000049334 223
477 3300005367 Ga0070667_100002353 Ga0070667_1000023534 223
478 3300005367 Ga0070667_100058375 Ga0070667_1000583754 223
479 3300005445 Ga0070708_100035021 Ga0070708_1000350214 223
480 3300005455 Ga0070663_100179097 Ga0070663_1001790972 223
481 3300005548 Ga0070665_100119702 Ga0070665_1001197022 223
482 3300005563 Ga0068855_100895020 Ga0068855_1008950202 223
483 3300005577 Ga0068857_100190321 Ga0068857_1001903212 223
484 3300005617 Ga0068859_100032940 Ga0068859_1000329404 223
485 3300005618 Ga0068864_100000148 Ga0068864_10000014818 223
486 3300005618 Ga0068864_100000173 Ga0068864_10000017341 223
487 3300005719 Ga0068861_100013965 Ga0068861_1000139657 223
488 3300005841 Ga0068863_100000012 Ga0068863_100000012112 223
489 3300005841 Ga0068863_100002395 Ga0068863_10000239516 223
490 3300005842 Ga0068858_100000913 Ga0068858_10000091331 223
491 3300005843 Ga0068860_100003011 Ga0068860_10000301118 223
492 3300005843 Ga0068860_100150572 Ga0068860_1001505725 223
493 3300005843 Ga0068860_100411674 Ga0068860_1004116742 223
494 3300005844 Ga0068862_100000001 Ga0068862_100000001496 223
495 3300006048 Ga0075363_100050782 Ga0075363_1000507824 223
496 3300006178 Ga0075367_10000218 Ga0075367_1000021825 223
497 3300006353 Ga0075370_10042827 Ga0075370_100428274 223
498 3300006931 Ga0097620_100032939 Ga0097620_1000329394 223
499 3300009177 Ga0105248_10006642 Ga0105248_100066424 223
500 3300009553 Ga0105249_10311571 Ga0105249_103115712 223
501 3300013104 Ga0157370_10593953 Ga0157370_105939532 223
502 3300013306 Ga0163162_10005580 Ga0163162_100055804 223
503 3300013306 Ga0163162_10917884 Ga0163162_109178842 223
504 3300014326 Ga0157380_10000199 Ga0157380_100001998 223
505 3300014968 Ga0157379_10000867 Ga0157379_1000086717 223
506 3300017792 Ga0163161_10312609 Ga0163161_103126092 223
507 3300025900 Ga0207710_10015426 Ga0207710_100154264 223
508 3300025903 Ga0207680_10000027 Ga0207680_1000002760 223
509 3300025909 Ga0207705_10000672 Ga0207705_1000067224 223
510 3300025909 Ga0207705_10027267 Ga0207705_100272675 223
511 3300025919 Ga0207657_10009160 Ga0207657_100091604 223
512 3300025923 Ga0207681_10000008 Ga0207681_10000008381 223
513 3300025923 Ga0207681_10000041 Ga0207681_1000004160 223
514 3300025923 Ga0207681_10172682 Ga0207681_101726822 223
515 3300025923 Ga0207681_10255946 Ga0207681_102559462 223
516 3300025925 Ga0207650_10000004 Ga0207650_1000000441 223
517 3300025925 Ga0207650_10010246 Ga0207650_100102464 223
518 3300025931 Ga0207644_10000006 Ga0207644_10000006372 223
519 3300025931 Ga0207644_10000070 Ga0207644_1000007068 223
520 3300025941 Ga0207711_10000658 Ga0207711_100006584 223
521 3300025961 Ga0207712_10013045 Ga0207712_100130452 223
522 3300025961 Ga0207712_10439715 Ga0207712_104397152 223
523 3300025972 Ga0207668_10000061 Ga0207668_100000617 223
524 3300025972 Ga0207668_10008964 Ga0207668_100089642 223
525 3300025972 Ga0207668_10708073 Ga0207668_107080731 223
526 3300025986 Ga0207658_10019683 Ga0207658_100196833 223
527 3300026035 Ga0207703_10091387 Ga0207703_100913873 223
528 3300026041 Ga0207639_10001682 Ga0207639_100016824 223
529 3300026088 Ga0207641_10000024 Ga0207641_10000024131 223
530 3300026088 Ga0207641_10002527 Ga0207641_1000252711 223
531 3300026095 Ga0207676_10000006 Ga0207676_10000006671 223
532 3300026095 Ga0207676_10002062 Ga0207676_1000206210 223
533 3300026116 Ga0207674_10055958 Ga0207674_100559583 223
534 3300026118 Ga0207675_100000767 Ga0207675_10000076714 223
535 3300026142 Ga0207698_10189050 Ga0207698_101890502 223
536 3300027866 Ga0209813_10000010 Ga0209813_1000001023 223
537 3300028380 Ga0268265_10000001 Ga0268265_10000001541 223
538 3300028380 Ga0268265_10000064 Ga0268265_1000006437 223
539 3300028380 Ga0268265_11192885 Ga0268265_111928851 223
540 3300028381 Ga0268264_10000010 Ga0268264_10000010165 223
541 3300028381 Ga0268264_10004569 Ga0268264_100045696 223
542 3300031548 Ga0307408_100045256 Ga0307408_1000452562 223
543 3300031548 Ga0307408_100081802 Ga0307408_1000818022 223
544 3300031731 Ga0307405_10124275 Ga0307405_101242752 223
545 3300031731 Ga0307405_10132554 Ga0307405_101325543 223
546 3300031731 Ga0307405_10365265 Ga0307405_103652652 223
547 3300031852 Ga0307410_10038777 Ga0307410_100387772 223
548 3300031901 Ga0307406_10074014 Ga0307406_100740142 223
549 3300031911 Ga0307412_10003776 Ga0307412_100037762 223
550 3300031911 Ga0307412_10033401 Ga0307412_100334011 223
551 3300031911 Ga0307412_10709616 Ga0307412_107096161 223
552 3300031995 Ga0307409_100177298 Ga0307409_1001772982 223
553 3300032002 Ga0307416_100308980 Ga0307416_1003089802 223
554 3300032004 Ga0307414_10000105 Ga0307414_1000010552 223
555 3300032004 Ga0307414_10110597 Ga0307414_101105972 223
556 3300032004 Ga0307414_10534410 Ga0307414_105344102 223
557 3300032005 Ga0307411_10024942 Ga0307411_100249422 223
558 3300032126 Ga0307415_100075336 Ga0307415_1000753362 223
559 3300032126 Ga0307415_100494721 Ga0307415_1004947211 223
560 3300033180 Ga0307510_10019674 Ga0307510_100196749 223
561 3300038705 Ga0237819_00640 Ga0237819_00640_10590_11372 223
562 3300044735 Ga0466968_0010430 Ga0466968_0010430_373_1044 223
563 3300045051 Ga0451576_0371101 Ga0451576_0371101_561_1232 223
564 3300046460 Ga0495638_0000051 Ga0495638_0000051_62940_63611 223
565 3300046460 Ga0495638_0044443 Ga0495638_0044443_1264_1935 223
566 3300046460 Ga0495638_0188928 Ga0495638_0188928_281_952 223
567 3300046506 Ga0495583_0000247 Ga0495583_0000247_33093_33764 223
568 3300046506 Ga0495583_0000422 Ga0495583_0000422_5353_6024 223
569 3300046506 Ga0495583_0006119 Ga0495583_0006119_1589_2260 223
570 3300046513 Ga0495616_0000010 Ga0495616_0000010_76768_77439 223
571 3300046519 Ga0495632_0001785 Ga0495632_0001785_5478_6149 223
572 3300046524 Ga0495648_0000032 Ga0495648_0000032_142373_143044 223
573 3300046557 Ga0495622_0090040 Ga0495622_0090040_522_1193 223
574 3300046558 Ga0495633_0010072 Ga0495633_0010072_3405_4076 223
575 3300046616 Ga0495668_0003821 Ga0495668_0003821_7815_8486 223
576 3300046660 Ga0495625_0101393 Ga0495625_0101393_923_1594 223
577 3300046665 Ga0495661_0030548 Ga0495661_0030548_1142_1813 223
578 3300046691 Ga0495670_0009593 Ga0495670_0009593_3541_4212 223
579 3300046692 Ga0495671_0000020 Ga0495671_0000020_62735_63406 223
580 3300046692 Ga0495671_0044743 Ga0495671_0044743_992_1663 223
581 3300046692 Ga0495671_0168517 Ga0495671_0168517_256_927 223
582 3300047445 Ga0495677_0010369 Ga0495677_0010369_1245_1916 223
583 3300047469 Ga0495673_0000076 Ga0495673_0000076_142067_142738 223
584 3300047472 Ga0495686_0021154 Ga0495686_0021154_937_1608 223
585 3300048911 Ga0496108_0003561 Ga0496108_0003561_10290_10961 223
586 3300048913 Ga0496110_0688493 Ga0496110_0688493_222_893 223
587 3300048917 Ga0496114_0033027 Ga0496114_0033027_2568_3239 223
588 3300048919 Ga0496116_0036345 Ga0496116_0036345_2670_3341 223
589 3300048924 Ga0496121_0001234 Ga0496121_0001234_33526_34197 223
590 3300048925 Ga0496122_0002568 Ga0496122_0002568_4368_5045 223
591 3300048926 Ga0496123_0000212 Ga0496123_0000212_96385_97062 223
592 3300048927 Ga0496124_0268597 Ga0496124_0268597_562_1233 223
593 3300048928 Ga0496125_0072636 Ga0496125_0072636_1065_1736 223
594 3300048929 Ga0496126_0008030 Ga0496126_0008030_2311_2982 223
595 3300048929 Ga0496126_0092003 Ga0496126_0092003_627_1364 223
596 3300048929 Ga0496126_0097218 Ga0496126_0097218_106_783 223
597 3300048929 Ga0496126_0128339 Ga0496126_0128339_28_705 223
598 3300049460 Ga0495682_0018020 Ga0495682_0018020_928_1599 223
599 3300049571 Ga0501034_0020876 Ga0501034_0020876_2237_2911 223
600 3300049581 Ga0501047_0306261 Ga0501047_0306261_471_1142 223
601 3300049663 Ga0501223_004040 Ga0501223_004040_152_826 223
602 3300049664 Ga0501224_000234 Ga0501224_000234_3277_3951 223
603 3300049668 Ga0501233_000094 Ga0501233_000094_1112_1786 223
604 3300049705 Ga0501225_0003161 Ga0501225_0003161_2283_2957 223
605 3300049707 Ga0501234_003340 Ga0501234_003340_1697_2371 223
606 3300049822 Ga0501035_0317311 Ga0501035_0317311_415_1086 223
607 3300049823 Ga0501044_0629862 Ga0501044_0629862_154_825 223
608 3300049853 Ga0501226_003023 Ga0501226_003023_152_826 223
609 3300050490 nmdc:mga03n38_13405_c1 nmdc:mga03n38_13405_c1_2256_2930 223
610 3300050494 nmdc:mga06z11_46_c1 nmdc:mga06z11_46_c1_32573_33247 223
611 3300050495 nmdc:mga04h51_35_c1 nmdc:mga04h51_35_c1_27453_28127 223
612 3300050496 nmdc:mga07m45_29058_c1 nmdc:mga07m45_29058_c1_1581_2255 223
613 3300053087 Ga0500643_000379 Ga0500643_000379_37_711 223
614 3300053087 Ga0500643_006012 Ga0500643_006012_922_1596 223
615 3300053087 Ga0500643_006128 Ga0500643_006128_2375_3049 223
616 3300053103 Ga0500555_008525 Ga0500555_008525_366_1037 223
617 3300053118 Ga0500594_0057604 Ga0500594_0057604_418_1089 223
618 3300053136 Ga0500559_0001014 Ga0500559_0001014_8536_9210 223
619 3300053139 Ga0500568_0102073 Ga0500568_0102073_241_921 223
620 3300053146 Ga0500588_0025297 Ga0500588_0025297_114_788 223
621 3300053151 Ga0500604_0001130 Ga0500604_0001130_3462_4133 223

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qmm-assembly1.cif.gz_A crystal structure of synecochoccus spermidine synthase in complex with putrescine, spermidine and mta 0.8182 4 223
6o63-assembly2.cif.gz_D crystal structure of arabidopsis thaliana spermidine synthase isoform 1 (atspds1) 0.8178 5 223
4yv0-assembly2.cif.gz_D crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2-carboxamid 0.8098 6 222
6o64-assembly3.cif.gz_E crystal structure of arabidopsis thaliana spermidine synthase isoform 2 (atspds2) 0.8052 5 223
4yv2-assembly1.cif.gz_B crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one 0.8038 5 223
ID Description Score Start End Superfamily
af_I1JZX5_64_282_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8365 42 223 3.40.50.150
af_Q4CXJ6_69_296_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8199 41 222 3.40.50.150
1inlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.81 39 223 3.40.50.150
af_Q57761_62_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8051 44 223 3.40.50.150
3adnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7961 44 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W8HNZ8-F1-model_v4 Spermidine synthase 0.9632 1 222 GO:0006596
AF-A0A2W6YDL8-F1-model_v4 Spermidine synthase 0.9592 1 223 GO:0006596
AF-G6EBW6-F1-model_v4 Spermidine synthase 0.9586 4 222 GO:0006596
AF-A0A4V3H0M6-F1-model_v4 Spermidine synthase 0.958 1 222 GO:0006596
AF-Q07MA5-F1-model_v4 Spermidine synthase 0.9577 2 223 GO:0006596

Feature Viewer

pLDDT pTM Quality
90.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map