F469968

General Info

Members Datasets Scaffolds Average Seq Length
621 341 595 136

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1015234|LJNas_10152342
Length 148
Sequence VGHDAAPSLTVMDITINNTFLPHDDPEASLAFYRDTLGFEVRLDVGAGKMRWITVGAPGQDVAIVLHPPAADPGITDDERRLIAEMMAKGTYAIITLATPDLDATFERLQARDVEVVQEPTEQPYGVRDCAVRDPAGTLIRINERREA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
5 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
6 2671180195 Frankia sp. CcI49 Isolate Nodule
7 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
8 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
9 2773857922 Frankia sp. CcI49 Isolate Nodule
10 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
11 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
12 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
13 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
14 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
15 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
16 2862574272 Streptomyces sp. AcE210 Isolate Nodule
17 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
18 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
19 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
20 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
21 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
22 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
23 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
24 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
25 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
312 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
333 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
334 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 649633069 Micromonospora sp. L5 Isolate Unclassified
341 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0.32
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0.48
Rhizoplane 10.47
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1015234 3300000546 Bacteria 819
2 JGI24740J21852_10022183 3300001979 Bacteria 2190
3 JGI24739J22299_10022390 3300001989 Bacteria 2242
4 JGI24737J22298_10008513 3300001990 Bacteria 3430
5 JGI24735J21928_10039291 3300002067 Bacteria 1384
6 JGI25406J46586_10008756 3300003203 Bacteria 4559
7 JGI25407J50210_10001088 3300003373 Bacteria 5979
8 JGI25407J50210_10028587 3300003373 Bacteria 1446
9 Ga0065714_10074977 3300005288 Bacteria 2964
10 Ga0070658_10521161 3300005327 Bacteria 1028
11 Ga0070683_100092811 3300005329 Bacteria 2835
12 Ga0070670_100937807 3300005331 Bacteria 786
13 Ga0070666_10030503 3300005335 Bacteria 3552
14 Ga0070680_100760283 3300005336 Bacteria 834
15 Ga0070682_100046502 3300005337 Bacteria 2694
16 Ga0070682_100080103 3300005337 Bacteria 2110
17 Ga0068868_100210515 3300005338 Bacteria 1625
18 Ga0070660_101778576 3300005339 Bacteria 525
19 Ga0070689_100151079 3300005340 Bacteria 1873
20 Ga0070687_100239114 3300005343 Bacteria 1122
21 Ga0070661_100110992 3300005344 Bacteria 2048
22 Ga0070668_100001181 3300005347 Bacteria 18485
23 Ga0070668_100161665 3300005347 Bacteria 1817
24 Ga0070675_100562358 3300005354 Bacteria 1032
25 Ga0070673_100444172 3300005364 Bacteria 1166
26 Ga0070688_100238071 3300005365 Bacteria 1290
27 Ga0070659_100285832 3300005366 Bacteria 1373
28 Ga0070667_100000090 3300005367 Bacteria 112981
29 Ga0070667_100008940 3300005367 Bacteria 8292
30 Ga0070667_100036825 3300005367 Bacteria 4102
31 Ga0070709_10177983 3300005434 Bacteria 1491
32 Ga0070714_100010010 3300005435 Bacteria 7478
33 Ga0070714_100031176 3300005435 Bacteria 4446
34 Ga0070713_100030439 3300005436 Bacteria 4287
35 Ga0070708_101203933 3300005445 Bacteria 708
36 Ga0070662_100797673 3300005457 Bacteria 803
37 Ga0070681_10100672 3300005458 Bacteria 2836
38 Ga0070706_100004234 3300005467 Bacteria 13925
39 Ga0070706_100508528 3300005467 Bacteria 1121
40 Ga0070706_100804318 3300005467 Bacteria 870
41 Ga0070698_100001915 3300005471 Bacteria 23191
42 Ga0070698_100208713 3300005471 Bacteria 1888
43 Ga0070698_100588663 3300005471 Bacteria 1053
44 Ga0070699_101211227 3300005518 Bacteria 693
45 Ga0070679_101174559 3300005530 Bacteria 712
46 Ga0070684_100255999 3300005535 Bacteria 1600
47 Ga0070684_100385706 3300005535 Bacteria 1291
48 Ga0070684_100689405 3300005535 Bacteria 952
49 Ga0070697_100153943 3300005536 Bacteria 1939
50 Ga0068853_100079398 3300005539 Bacteria 2869
51 Ga0068853_101153332 3300005539 Bacteria 748
52 Ga0070695_100040203 3300005545 Bacteria 2959
53 Ga0070665_100184717 3300005548 Bacteria 2086
54 Ga0068855_100168815 3300005563 Bacteria 2478
55 Ga0068857_101726123 3300005577 Bacteria 612
56 Ga0068856_100222984 3300005614 Bacteria 1901
57 Ga0070702_100568293 3300005615 Bacteria 845
58 Ga0068852_100607266 3300005616 Bacteria 1099
59 Ga0068859_100383154 3300005617 Bacteria 1501
60 Ga0068870_10156471 3300005840 Bacteria 1347
61 Ga0068858_100721459 3300005842 Bacteria 970
62 Ga0068860_102121369 3300005843 Bacteria 583
63 Ga0081538_10000836 3300005981 Bacteria 33350
64 Ga0081538_10037116 3300005981 Bacteria 3168
65 Ga0081538_10059237 3300005981 Bacteria 2213
66 Ga0081538_10072573 3300005981 Bacteria 1886
67 Ga0081538_10162545 3300005981 Bacteria 989
68 Ga0081538_10244653 3300005981 Bacteria 689
69 Ga0081538_10293091 3300005981 Bacteria 600
70 Ga0081539_10000595 3300005985 Bacteria 73899
71 Ga0081539_10004760 3300005985 Bacteria 14654
72 Ga0070717_10003502 3300006028 Bacteria 11235
73 Ga0070717_10137140 3300006028 Bacteria 2108
74 Ga0070716_100812576 3300006173 Bacteria 725
75 Ga0070712_100332323 3300006175 Bacteria 1238
76 Ga0075367_10387047 3300006178 Bacteria 884
77 Ga0075369_10197448 3300006186 Bacteria 928
78 Ga0075428_100018460 3300006844 Bacteria 7711
79 Ga0075428_100078647 3300006844 Bacteria 3600
80 Ga0075428_101097106 3300006844 Bacteria 841
81 Ga0075430_100011454 3300006846 Bacteria 7532
82 Ga0075430_100018800 3300006846 Bacteria 5879
83 Ga0075431_100027449 3300006847 Bacteria 5841
84 Ga0075431_100044564 3300006847 Bacteria 4575
85 Ga0075431_100052856 3300006847 Bacteria 4188
86 Ga0075433_11750346 3300006852 Bacteria 535
87 Ga0075429_100006279 3300006880 Bacteria 10285
88 Ga0075429_100009117 3300006880 Bacteria 8612
89 Ga0097620_100383172 3300006931 Bacteria 1501
90 Ga0097620_101902857 3300006931 Bacteria 657
91 Ga0099794_10305053 3300007265 Bacteria 825
92 Ga0114129_10039165 3300009147 Bacteria 6683
93 Ga0114129_10124987 3300009147 Bacteria 3537
94 Ga0114129_11259142 3300009147 Bacteria 919
95 Ga0114129_11272416 3300009147 Bacteria 913
96 Ga0114129_11651804 3300009147 Bacteria 783
97 Ga0105243_10039056 3300009148 Bacteria 3699
98 Ga0105243_10648766 3300009148 Bacteria 1023
99 Ga0105243_12160485 3300009148 Bacteria 593
100 Ga0105248_10006939 3300009177 Bacteria 12410
101 Ga0105248_11295847 3300009177 Bacteria 824
102 Ga0105248_12019700 3300009177 Bacteria 655
103 Ga0105237_10003281 3300009545 Bacteria 19315
104 Ga0105237_10003835 3300009545 Bacteria 17678
105 Ga0105237_11189705 3300009545 Bacteria 769
106 Ga0105237_11318084 3300009545 Bacteria 728
107 Ga0105249_10000158 3300009553 Bacteria 82194
108 Ga0105249_10747867 3300009553 Bacteria 1040
109 Ga0105249_11855577 3300009553 Bacteria 675
110 Ga0105239_10004461 3300010375 Bacteria 16729
111 Ga0105239_10032792 3300010375 Bacteria 5707
112 Ga0105239_10132325 3300010375 Bacteria 2775
113 Ga0105239_12849508 3300010375 Bacteria 564
114 Ga0105246_10320449 3300011119 Bacteria 1259
115 Ga0105246_10330478 3300011119 Bacteria 1242
116 Ga0157337_1003498 3300012483 Bacteria 954
117 Ga0157369_10028196 3300013105 Bacteria 6215
118 Ga0157369_10298699 3300013105 Bacteria 1675
119 Ga0157369_10863497 3300013105 Bacteria 929
120 Ga0157374_10952921 3300013296 Bacteria 877
121 Ga0157378_10512995 3300013297 Bacteria 1199
122 Ga0163162_11856040 3300013306 Bacteria 689
123 Ga0157372_10128996 3300013307 Bacteria 2908
124 Ga0157372_10295565 3300013307 Bacteria 1884
125 Ga0157372_10311353 3300013307 Bacteria 1833
126 Ga0157372_10881749 3300013307 Bacteria 1038
127 Ga0157372_11247580 3300013307 Bacteria 858
128 Ga0157372_11384470 3300013307 Bacteria 811
129 Ga0157375_10296944 3300013308 Bacteria 1779
130 Ga0157375_10482520 3300013308 Bacteria 1404
131 Ga0182008_10052972 3300014497 Bacteria 2010
132 Ga0213875_10100082 3300021388 Bacteria 1353
133 Ga0209025_1006137 3300025294 Bacteria 9468
134 Ga0207710_10191822 3300025900 Bacteria 1006
135 Ga0207688_10004942 3300025901 Bacteria 7257
136 Ga0207688_10330394 3300025901 Bacteria 937
137 Ga0207680_10020395 3300025903 Bacteria 3567
138 Ga0207647_10153830 3300025904 Bacteria 1343
139 Ga0207699_10583022 3300025906 Bacteria 813
140 Ga0207643_10049845 3300025908 Bacteria 2374
141 Ga0207684_10042876 3300025910 Bacteria 3836
142 Ga0207684_10850233 3300025910 Bacteria 769
143 Ga0207707_10491970 3300025912 Bacteria 1047
144 Ga0207671_10003414 3300025914 Bacteria 15879
145 Ga0207671_10048514 3300025914 Bacteria 3143
146 Ga0207671_10540459 3300025914 Bacteria 929
147 Ga0207693_10217806 3300025915 Bacteria 1500
148 Ga0207687_10129373 3300025927 Bacteria 1900
149 Ga0207700_10059205 3300025928 Bacteria 2896
150 Ga0207700_10232509 3300025928 Bacteria 1568
151 Ga0207664_10022970 3300025929 Bacteria 4667
152 Ga0207690_10306779 3300025932 Bacteria 1244
153 Ga0207690_10550831 3300025932 Bacteria 938
154 Ga0207706_10183234 3300025933 Bacteria 1839
155 Ga0207709_10255533 3300025935 Bacteria 1282
156 Ga0207670_10309447 3300025936 Bacteria 1240
157 Ga0207670_10385903 3300025936 Bacteria 1117
158 Ga0207711_10001074 3300025941 Bacteria 26086
159 Ga0207661_10202916 3300025944 Bacteria 1744
160 Ga0207667_10143838 3300025949 Bacteria 2455
161 Ga0207712_10001692 3300025961 Bacteria 14810
162 Ga0207712_10684406 3300025961 Bacteria 894
163 Ga0207668_10125165 3300025972 Bacteria 1953
164 Ga0207668_10153548 3300025972 Bacteria 1785
165 Ga0207658_10000255 3300025986 Bacteria 55438
166 Ga0207658_10000502 3300025986 Bacteria 35835
167 Ga0207658_10215693 3300025986 Bacteria 1611
168 Ga0207677_10195233 3300026023 Bacteria 1604
169 Ga0207703_10759734 3300026035 Bacteria 924
170 Ga0207639_10033037 3300026041 Bacteria 3814
171 Ga0207639_10172507 3300026041 Bacteria 1833
172 Ga0207708_10355145 3300026075 Bacteria 1203
173 Ga0207702_10553589 3300026078 Bacteria 1125
174 Ga0207641_11213008 3300026088 Bacteria 754
175 Ga0207676_10674761 3300026095 Bacteria 999
176 Ga0207674_10071819 3300026116 Bacteria 3477
177 Ga0207674_10311528 3300026116 Bacteria 1523
178 Ga0207674_10911415 3300026116 Bacteria 847
179 Ga0268266_10455291 3300028379 Bacteria 1217
180 Ga0268265_10460611 3300028380 Bacteria 1190
181 Ga0268264_11765700 3300028381 Bacteria 629
182 Ga0307515_10001767 3300028794 Bacteria 48169
183 Ga0265770_1069521 3300030878 Bacteria 669
184 Ga0307509_10184257 3300031507 Bacteria 1948
185 Ga0307408_100297797 3300031548 Bacteria 1350
186 Ga0307408_101017990 3300031548 Bacteria 764
187 Ga0307408_101678548 3300031548 Bacteria 605
188 Ga0307508_10364053 3300031616 Bacteria 1037
189 Ga0307405_10101707 3300031731 Bacteria 1929
190 Ga0307405_10421076 3300031731 Bacteria 1051
191 Ga0307410_10014926 3300031852 Bacteria 4591
192 Ga0307410_10045642 3300031852 Bacteria 2919
193 Ga0307410_10161716 3300031852 Bacteria 1678
194 Ga0307410_10527400 3300031852 Bacteria 975
195 Ga0307406_10234162 3300031901 Bacteria 1373
196 Ga0307406_10818815 3300031901 Bacteria 787
197 Ga0307407_10254702 3300031903 Bacteria 1204
198 Ga0307407_10275338 3300031903 Bacteria 1163
199 Ga0307409_100049248 3300031995 Bacteria 3211
200 Ga0307409_100207009 3300031995 Bacteria 1760
201 Ga0307409_100290361 3300031995 Bacteria 1516
202 Ga0307409_100522778 3300031995 Bacteria 1159
203 Ga0307409_100542477 3300031995 Bacteria 1140
204 Ga0307409_101058674 3300031995 Bacteria 831
205 Ga0307416_100000815 3300032002 Bacteria 16363
206 Ga0307416_100013841 3300032002 Bacteria 5499
207 Ga0307416_100113620 3300032002 Bacteria 2393
208 Ga0307416_100469501 3300032002 Bacteria 1315
209 Ga0307416_101038313 3300032002 Bacteria 923
210 Ga0307416_101937834 3300032002 Bacteria 692
211 Ga0307414_10190190 3300032004 Bacteria 1660
212 Ga0307414_10269890 3300032004 Bacteria 1424
213 Ga0307414_10565761 3300032004 Bacteria 1015
214 Ga0307414_10970690 3300032004 Bacteria 781
215 Ga0307411_10062438 3300032005 Bacteria 2485
216 Ga0307411_10115021 3300032005 Bacteria 1934
217 Ga0307411_10367087 3300032005 Bacteria 1179
218 Ga0307415_100000831 3300032126 Bacteria 14149
219 Ga0307415_100068820 3300032126 Bacteria 2479
220 Ga0307415_100070244 3300032126 Bacteria 2458
221 Ga0307415_100297999 3300032126 Bacteria 1334
222 Ga0307415_100898418 3300032126 Bacteria 816
223 Ga0307415_100993652 3300032126 Bacteria 779
224 Ga0307415_101342545 3300032126 Bacteria 679
225 Ga0316214_1021632 3300033545 Bacteria 901
226 Ga0373934_0000056 3300035086 Bacteria 38785
227 Ga0373934_0020293 3300035086 Bacteria 2553
228 Ga0373952_0046214 3300035092 Bacteria 1023
229 Ga0373936_0197239 3300035113 Bacteria 887
230 Ga0373953_0000309 3300035117 Bacteria 13086
231 Ga0373953_0006724 3300035117 Bacteria 3807
232 Ga0373954_0083814 3300035118 Bacteria 1525
233 Ga0373954_0408607 3300035118 Bacteria 671
234 Ga0373956_0003716 3300035119 Bacteria 6153
235 Ga0373956_0011202 3300035119 Bacteria 3692
236 Ga0373957_0000263 3300035120 Bacteria 13165
237 Ga0373957_0016965 3300035120 Bacteria 2529
238 Ga0373943_0096599 3300035170 Bacteria 1538
239 Ga0373943_0898040 3300035170 Bacteria 529
240 Ga0373946_0010541 3300035171 Bacteria 3422
241 Ga0373955_0000050 3300035172 Bacteria 45664
242 Ga0373962_0002136 3300035242 Bacteria 4716
243 Ga0373924_0005896 3300035410 Bacteria 4368
244 Ga0373924_0064615 3300035410 Bacteria 1536
245 Ga0373935_0019521 3300035692 Bacteria 4133
246 Ga0373927_0056271 3300035695 Bacteria 2542
247 Ga0373933_0000149 3300035724 Bacteria 45676
248 Ga0373933_0429195 3300035724 Bacteria 863
249 Ga0373947_0045315 3300035725 Bacteria 2631
250 Ga0373937_0000319 3300036401 Bacteria 45685
251 Ga0373937_0177019 3300036401 Bacteria 2002
252 Ga0373937_0957974 3300036401 Bacteria 804
253 Ga0373925_0009155 3300037068 Bacteria 7207
254 Ga0395899_0497554 3300037312 Bacteria 791
255 Ga0395899_0529993 3300037312 Bacteria 760
256 Ga0395900_0025139 3300037418 Bacteria 6096
257 Ga0395900_0060712 3300037418 Bacteria 3890
258 Ga0395900_0158265 3300037418 Bacteria 2312
259 Ga0395900_0439048 3300037418 Bacteria 1263
260 Ga0395900_0621610 3300037418 Bacteria 1019
261 Ga0395898_0038704 3300037466 Bacteria 4725
262 Ga0395898_0090231 3300037466 Bacteria 2949
263 Ga0395898_0151294 3300037466 Bacteria 2220
264 Ga0395898_0742711 3300037466 Bacteria 923
265 Ga0395898_0992973 3300037466 Bacteria 775
266 Ga0395898_1100528 3300037466 Bacteria 728
267 Ga0395898_1976439 3300037466 Bacteria 502
268 Ga0395905_0227868 3300037471 Bacteria 1743
269 Ga0395905_0412842 3300037471 Bacteria 1245
270 Ga0436364_0686104 3300037853 Bacteria 2824
271 Ga0436364_0978717 3300037853 Bacteria 704
272 Ga0395901_0085421 3300038443 Bacteria 3299
273 Ga0395901_0358880 3300038443 Bacteria 1503
274 Ga0395901_0521255 3300038443 Bacteria 1207
275 Ga0395901_0599298 3300038443 Bacteria 1111
276 Ga0436365_0188410 3300039437 Bacteria 775
277 Ga0436363_1021750 3300039450 Bacteria 529
278 Ga0436363_1124388 3300039450 Bacteria 1241
279 Ga0451789_0959797 3300041443 Bacteria 512
280 Ga0451804_0932012 3300041463 Bacteria 820
281 Ga0439441_184767 3300042001 Bacteria 503
282 Ga0439455_0168417 3300042012 Bacteria 628
283 Ga0439463_036110 3300042016 Bacteria 1252
284 Ga0450903_004758 3300042138 Bacteria 2299
285 Ga0439459_0059552 3300042438 Bacteria 859
286 Ga0439440_0048156 3300042993 Bacteria 1058
287 Ga0439440_0104903 3300042993 Bacteria 772
288 Ga0466969_0157070 3300044656 Bacteria 1046
289 Ga0466972_0298895 3300044658 Bacteria 752
290 Ga0466972_0442200 3300044658 Bacteria 611
291 Ga0466965_0038169 3300044683 Bacteria 2359
292 Ga0466966_0385720 3300044684 Bacteria 842
293 Ga0466966_0389098 3300044684 Bacteria 838
294 Ga0466961_0164309 3300044693 Bacteria 1383
295 Ga0466963_0024741 3300044694 Bacteria 3823
296 Ga0466963_0444829 3300044694 Bacteria 914
297 Ga0466963_0929390 3300044694 Bacteria 613
298 Ga0466963_0959780 3300044694 Bacteria 602
299 Ga0466964_0038943 3300044706 Bacteria 1913
300 Ga0466964_0208900 3300044706 Bacteria 942
301 Ga0466964_0436095 3300044706 Bacteria 692
302 Ga0466964_0475028 3300044706 Bacteria 667
303 Ga0466970_0245719 3300044765 Bacteria 1002
304 Ga0466970_0438580 3300044765 Bacteria 748
305 Ga0466957_0056310 3300044842 Bacteria 2404
306 Ga0466957_0057752 3300044842 Bacteria 2376
307 Ga0466957_0100783 3300044842 Bacteria 1820
308 Ga0466957_0229379 3300044842 Bacteria 1229
309 Ga0466957_1214097 3300044842 Bacteria 546
310 Ga0466960_0035699 3300044901 Bacteria 2325
311 Ga0466960_0037831 3300044901 Bacteria 2266
312 Ga0466960_0073723 3300044901 Bacteria 1704
313 Ga0466960_0189772 3300044901 Bacteria 1118
314 Ga0466960_0223251 3300044901 Bacteria 1038
315 Ga0466960_0223868 3300044901 Bacteria 1036
316 Ga0466960_0369047 3300044901 Bacteria 822
317 Ga0466959_0159917 3300045049 Bacteria 1584
318 Ga0466959_0238415 3300045049 Bacteria 1257
319 Ga0466959_0260890 3300045049 Bacteria 1193
320 Ga0466959_0654620 3300045049 Bacteria 705
321 Ga0466958_0066772 3300045836 Bacteria 2196
322 Ga0466958_0216394 3300045836 Bacteria 1222
323 Ga0466967_0001059 3300045976 Bacteria 15165
324 Ga0466967_0002981 3300045976 Bacteria 10837
325 Ga0466967_0003925 3300045976 Bacteria 9878
326 Ga0466967_0010513 3300045976 Bacteria 6949
327 Ga0466967_0030610 3300045976 Bacteria 4519
328 Ga0466967_0156048 3300045976 Bacteria 2138
329 Ga0466967_0310382 3300045976 Bacteria 1519
330 Ga0466967_0396339 3300045976 Bacteria 1342
331 Ga0466967_0492077 3300045976 Bacteria 1203
332 Ga0466967_1188609 3300045976 Bacteria 760
333 Ga0466967_1368395 3300045976 Bacteria 705
334 Ga0495617_118430 3300046452 Bacteria 854
335 Ga0495592_0000255 3300046454 Bacteria 45685
336 Ga0495603_0000550 3300046455 Bacteria 20947
337 Ga0495603_0009715 3300046455 Bacteria 5819
338 Ga0495603_0036090 3300046455 Bacteria 2968
339 Ga0495603_0707324 3300046455 Bacteria 576
340 Ga0495629_0001975 3300046459 Bacteria 15979
341 Ga0495629_0003408 3300046459 Bacteria 12027
342 Ga0495629_0508081 3300046459 Bacteria 812
343 Ga0495638_0104562 3300046460 Bacteria 1689
344 Ga0495641_0026618 3300046461 Bacteria 2819
345 Ga0495651_0000199 3300046462 Bacteria 45685
346 Ga0495653_0010908 3300046463 Bacteria 7439
347 Ga0495580_0017038 3300046472 Bacteria 5444
348 Ga0495582_0100086 3300046473 Bacteria 1622
349 Ga0495639_0039380 3300046475 Bacteria 2125
350 Ga0495662_0064845 3300046476 Bacteria 1765
351 Ga0495664_0038694 3300046477 Bacteria 2816
352 Ga0495664_0052566 3300046477 Bacteria 2421
353 Ga0495594_0001353 3300046499 Bacteria 12719
354 Ga0495594_0012361 3300046499 Bacteria 4447
355 Ga0495594_0061282 3300046499 Bacteria 2082
356 Ga0495596_0388172 3300046500 Bacteria 544
357 Ga0495607_0126401 3300046501 Bacteria 1336
358 Ga0495583_0062146 3300046506 Bacteria 1664
359 Ga0495608_0001171 3300046511 Bacteria 18587
360 Ga0495608_0093930 3300046511 Bacteria 1937
361 Ga0495618_0137865 3300046514 Bacteria 1560
362 Ga0495628_0000282 3300046516 Bacteria 45645
363 Ga0495630_0411024 3300046517 Bacteria 1037
364 Ga0495630_0429988 3300046517 Bacteria 1011
365 Ga0495631_0209531 3300046518 Bacteria 833
366 Ga0495643_0344285 3300046522 Bacteria 669
367 Ga0495648_0002385 3300046524 Bacteria 17443
368 Ga0495642_0241457 3300046528 Bacteria 789
369 Ga0495652_0002623 3300046529 Bacteria 18356
370 Ga0495652_0272412 3300046529 Bacteria 1243
371 Ga0495654_0154269 3300046530 Bacteria 1013
372 Ga0495665_0016094 3300046531 Bacteria 4029
373 Ga0495665_0200947 3300046531 Bacteria 1033
374 Ga0495665_0245957 3300046531 Bacteria 921
375 Ga0495587_0000189 3300046536 Bacteria 45681
376 Ga0495645_0072661 3300046543 Bacteria 2478
377 Ga0495645_0177067 3300046543 Bacteria 1464
378 Ga0495633_0071662 3300046558 Bacteria 1616
379 Ga0495667_0000136 3300046559 Bacteria 50731
380 Ga0495667_0031636 3300046559 Bacteria 3549
381 Ga0495668_0014484 3300046616 Bacteria 4623
382 Ga0495634_0196880 3300046642 Bacteria 1253
383 Ga0495635_0159568 3300046663 Bacteria 1534
384 Ga0495659_0310752 3300046664 Bacteria 668
385 Ga0495659_0500420 3300046664 Bacteria 533
386 Ga0495659_0555931 3300046664 Bacteria 506
387 Ga0495661_0196239 3300046665 Bacteria 1060
388 Ga0495588_0015689 3300046674 Bacteria 3651
389 Ga0495588_0125537 3300046674 Bacteria 1353
390 Ga0495588_0172842 3300046674 Bacteria 1142
391 Ga0495657_0000290 3300046675 Bacteria 45685
392 Ga0495599_0000676 3300046678 Bacteria 19312
393 Ga0495599_0121476 3300046678 Bacteria 1623
394 Ga0495623_0002482 3300046679 Bacteria 12231
395 Ga0495623_0047070 3300046679 Bacteria 2737
396 Ga0495646_0024101 3300046680 Bacteria 3832
397 Ga0495646_0028819 3300046680 Bacteria 3473
398 Ga0495658_0057220 3300046683 Bacteria 2226
399 Ga0495669_0002865 3300046684 Bacteria 7075
400 Ga0495613_0130140 3300046689 Bacteria 1802
401 Ga0495624_0045742 3300046690 Bacteria 2785
402 Ga0495670_0002672 3300046691 Bacteria 8801
403 Ga0495670_0026483 3300046691 Bacteria 2870
404 Ga0495671_0100396 3300046692 Bacteria 1415
405 Ga0495589_0096022 3300046794 Bacteria 1437
406 Ga0495589_0122363 3300046794 Bacteria 1252
407 Ga0495589_0174270 3300046794 Bacteria 1022
408 Ga0495600_0004743 3300046809 Bacteria 8156
409 Ga0495600_0053994 3300046809 Bacteria 2624
410 Ga0495581_0006043 3300047315 Bacteria 7017
411 Ga0495581_0101454 3300047315 Bacteria 1672
412 Ga0495604_0000280 3300047317 Bacteria 45685
413 Ga0495604_0141334 3300047317 Bacteria 1719
414 Ga0495636_0282957 3300047318 Bacteria 773
415 Ga0495636_0335831 3300047318 Bacteria 711
416 Ga0495674_0145394 3300047319 Bacteria 1990
417 Ga0495672_0004058 3300047320 Bacteria 12221
418 Ga0495672_0008155 3300047320 Bacteria 7772
419 Ga0495676_0004019 3300047321 Bacteria 13389
420 Ga0495676_0005888 3300047321 Bacteria 11254
421 Ga0495676_0009607 3300047321 Bacteria 8805
422 Ga0495676_0394140 3300047321 Bacteria 920
423 Ga0495676_0427719 3300047321 Bacteria 876
424 Ga0495680_0000430 3300047322 Bacteria 47076
425 Ga0495683_0045770 3300047323 Bacteria 2198
426 Ga0495675_0000347 3300047444 Bacteria 32584
427 Ga0495675_0021589 3300047444 Bacteria 4101
428 Ga0495677_0430329 3300047445 Bacteria 523
429 Ga0495685_042549 3300047447 Bacteria 1550
430 Ga0495673_0002967 3300047469 Bacteria 11433
431 Ga0495684_0120685 3300047471 Bacteria 1974
432 Ga0495686_0001693 3300047472 Bacteria 22821
433 Ga0495593_0202494 3300047673 Bacteria 997
434 Ga0495602_0000297 3300048088 Bacteria 45689
435 Ga0495602_0050303 3300048088 Bacteria 3724
436 Ga0495614_0002695 3300048089 Bacteria 7888
437 Ga0496100_0000067 3300048903 Bacteria 58703
438 Ga0496100_0002909 3300048903 Bacteria 8789
439 Ga0496100_0046449 3300048903 Bacteria 2792
440 Ga0496100_0177743 3300048903 Bacteria 1537
441 Ga0496101_0000019 3300048904 Bacteria 220382
442 Ga0496101_0000099 3300048904 Bacteria 90235
443 Ga0496101_0008278 3300048904 Bacteria 6793
444 Ga0496102_0000007 3300048905 Bacteria 417224
445 Ga0496102_0006394 3300048905 Bacteria 10042
446 Ga0496102_0006622 3300048905 Bacteria 9899
447 Ga0496102_0117849 3300048905 Bacteria 2478
448 Ga0496102_0145474 3300048905 Bacteria 2224
449 Ga0496102_0192889 3300048905 Bacteria 1920
450 Ga0496102_0202042 3300048905 Bacteria 1873
451 Ga0496103_0000013 3300048906 Bacteria 297928
452 Ga0496103_0001890 3300048906 Bacteria 13618
453 Ga0496103_0041337 3300048906 Bacteria 2834
454 Ga0496103_0090849 3300048906 Bacteria 1926
455 Ga0496103_0246162 3300048906 Bacteria 1150
456 Ga0496104_0162218 3300048907 Bacteria 2144
457 Ga0496104_0342200 3300048907 Bacteria 1409
458 Ga0496105_0274069 3300048908 Bacteria 1362
459 Ga0496105_0531857 3300048908 Bacteria 920
460 Ga0496105_0646913 3300048908 Bacteria 816
461 Ga0496105_0764609 3300048908 Bacteria 737
462 Ga0496106_0003289 3300048909 Bacteria 12074
463 Ga0496106_0028565 3300048909 Bacteria 4155
464 Ga0496106_0092809 3300048909 Bacteria 2332
465 Ga0496106_0190484 3300048909 Bacteria 1630
466 Ga0496107_0004793 3300048910 Bacteria 9187
467 Ga0496107_0018178 3300048910 Bacteria 4947
468 Ga0496107_0121731 3300048910 Bacteria 1922
469 Ga0496107_0246474 3300048910 Bacteria 1329
470 Ga0496108_0004506 3300048911 Bacteria 11223
471 Ga0496108_0027387 3300048911 Bacteria 4706
472 Ga0496108_0663719 3300048911 Bacteria 906
473 Ga0496108_0868713 3300048911 Bacteria 775
474 Ga0496108_1133390 3300048911 Bacteria 663
475 Ga0496109_0000159 3300048912 Bacteria 66124
476 Ga0496109_0000667 3300048912 Bacteria 28438
477 Ga0496109_0015932 3300048912 Bacteria 6566
478 Ga0496109_0516785 3300048912 Bacteria 1127
479 Ga0496110_0068018 3300048913 Bacteria 3152
480 Ga0496110_0072941 3300048913 Bacteria 3046
481 Ga0496110_0380277 3300048913 Bacteria 1287
482 Ga0496110_0479442 3300048913 Bacteria 1133
483 Ga0496110_0723779 3300048913 Bacteria 897
484 Ga0496111_0026328 3300048914 Bacteria 4106
485 Ga0496111_0123849 3300048914 Bacteria 1910
486 Ga0496111_0127288 3300048914 Bacteria 1883
487 Ga0496112_0297157 3300048915 Bacteria 1561
488 Ga0496112_0339660 3300048915 Bacteria 1445
489 Ga0496112_1352863 3300048915 Bacteria 627
490 Ga0496113_0162263 3300048916 Bacteria 1767
491 Ga0496113_0166959 3300048916 Bacteria 1742
492 Ga0496113_0228606 3300048916 Bacteria 1483
493 Ga0496114_0002664 3300048917 Bacteria 13626
494 Ga0496114_0107386 3300048917 Bacteria 2389
495 Ga0496114_0130811 3300048917 Bacteria 2167
496 Ga0496114_0275916 3300048917 Bacteria 1482
497 Ga0496114_0287177 3300048917 Bacteria 1451
498 Ga0496114_0784164 3300048917 Bacteria 831
499 Ga0496115_0618562 3300048918 Bacteria 859
500 Ga0496116_0000033 3300048919 Bacteria 418191
501 Ga0496116_0002510 3300048919 Bacteria 19213
502 Ga0496117_0000025 3300048920 Bacteria 418106
503 Ga0496117_0000738 3300048920 Bacteria 51389
504 Ga0496117_0031052 3300048920 Bacteria 4086
505 Ga0496118_0000023 3300048921 Bacteria 418106
506 Ga0496118_0000222 3300048921 Bacteria 99509
507 Ga0496118_0002673 3300048921 Bacteria 23562
508 Ga0496118_0028057 3300048921 Bacteria 4749
509 Ga0496118_0052738 3300048921 Bacteria 3099
510 Ga0496119_0000512 3300048922 Bacteria 52761
511 Ga0496119_0001355 3300048922 Bacteria 29948
512 Ga0496119_0035065 3300048922 Bacteria 3293
513 Ga0496119_0158389 3300048922 Bacteria 1206
514 Ga0496120_0000382 3300048923 Bacteria 71535
515 Ga0496120_0037251 3300048923 Bacteria 2888
516 Ga0496121_0000016 3300048924 Bacteria 562911
517 Ga0496121_0000039 3300048924 Bacteria 351444
518 Ga0496122_0000126 3300048925 Bacteria 178362
519 Ga0496122_0000284 3300048925 Bacteria 113244
520 Ga0496123_0002656 3300048926 Bacteria 21612
521 Ga0496123_0021516 3300048926 Bacteria 5009
522 Ga0496124_0000015 3300048927 Bacteria 460700
523 Ga0496125_0000021 3300048928 Bacteria 460688
524 Ga0496126_0000015 3300048929 Bacteria 663212
525 Ga0496126_0002371 3300048929 Bacteria 25680
526 Ga0496126_0005034 3300048929 Bacteria 15369
527 Ga0496126_0200594 3300048929 Bacteria 1685
528 Ga0496126_0226032 3300048929 Bacteria 1570
529 Ga0501033_0036710 3300049570 Bacteria 3671
530 Ga0501033_0388939 3300049570 Bacteria 974
531 Ga0501036_0702000 3300049572 Bacteria 836
532 Ga0501036_1198961 3300049572 Bacteria 619
533 Ga0501038_0404148 3300049574 Bacteria 1056
534 Ga0501038_0747576 3300049574 Bacteria 730
535 Ga0501039_0312370 3300049575 Bacteria 1236
536 Ga0501039_0354897 3300049575 Bacteria 1152
537 Ga0501040_0323804 3300049576 Bacteria 1103
538 Ga0501040_1382564 3300049576 Bacteria 511
539 Ga0501041_0038998 3300049577 Bacteria 2882
540 Ga0501042_0161009 3300049578 Bacteria 1619
541 Ga0501042_0656242 3300049578 Bacteria 763
542 Ga0501047_0022525 3300049581 Bacteria 6050
543 Ga0501047_0123709 3300049581 Bacteria 2467
544 Ga0501048_0194631 3300049582 Bacteria 1437
545 Ga0501048_0538296 3300049582 Bacteria 838
546 Ga0501067_0017474 3300049583 Bacteria 3967
547 Ga0501067_0033673 3300049583 Bacteria 2842
548 Ga0501068_0077444 3300049584 Bacteria 2036
549 Ga0501068_0149607 3300049584 Bacteria 1467
550 Ga0501069_0112835 3300049585 Bacteria 1549
551 Ga0501069_0165879 3300049585 Bacteria 1273
552 Ga0501070_0435513 3300049586 Bacteria 1058
553 Ga0501071_0229096 3300049587 Bacteria 1400
554 Ga0501072_0061383 3300049588 Bacteria 2965
555 Ga0501072_0666156 3300049588 Bacteria 819
556 Ga0501072_1131878 3300049588 Bacteria 609
557 Ga0501074_0073126 3300049590 Bacteria 2463
558 Ga0501221_176816 3300049704 Bacteria 581
559 Ga0501234_102737 3300049707 Bacteria 521
560 Ga0501079_0632779 3300049741 Bacteria 842
561 Ga0501080_0009244 3300049742 Bacteria 8984
562 Ga0501083_1095695 3300049744 Bacteria 518
563 Ga0501035_0412620 3300049822 Bacteria 1122
564 Ga0501044_0066437 3300049823 Bacteria 3677
565 Ga0501045_0454466 3300049824 Bacteria 952
566 Ga0501045_0984617 3300049824 Bacteria 618
567 nmdc:mga06z11_199538_c1 3300050494 Bacteria 1161
568 nmdc:mga05p37_1161515_c1 3300050507 Bacteria 802
569 nmdc:mga05p37_24150_c1 3300050507 Bacteria 7385
570 nmdc:mga05p37_81702_c1 3300050507 Bacteria 3981
571 nmdc:mga09592_1296365_c1 3300050508 Bacteria 599
572 nmdc:mga09592_22160_c1 3300050508 Bacteria 5242
573 nmdc:mga0qj67_17465_c1 3300050509 Bacteria 5455
574 nmdc:mga0qj67_4976_c1 3300050509 Bacteria 9657
575 nmdc:mga06r32_37973_c1 3300050510 Bacteria 4559
576 nmdc:mga06r32_6314_c1 3300050510 Bacteria 10644
577 nmdc:mga08y16_1177672_c1 3300050511 Bacteria 738
578 nmdc:mga0n895_556797_c1 3300050512 Bacteria 1152
579 nmdc:mga0sz30_115007_c1 3300050516 Bacteria 1180
580 Ga0495601_0034611 3300053077 Bacteria 3152
581 Ga0495601_0303231 3300053077 Bacteria 1040
582 Ga0495612_0005080 3300053078 Bacteria 5449
583 Ga0495619_0207222 3300053085 Bacteria 1357
584 Ga0495619_0604320 3300053085 Bacteria 750
585 Ga0500643_001928 3300053087 Bacteria 11259
586 Ga0500644_0049411 3300053088 Bacteria 1435
587 Ga0500556_0000251 3300053104 Bacteria 43573
588 Ga0500597_015966 3300053120 Bacteria 2851
589 Ga0500577_0186471 3300053142 Bacteria 891
590 Ga0500616_0403194 3300053153 Bacteria 546
591 Ga0501084_0635002 3300054114 Bacteria 902
592 Ga0501084_0929631 3300054114 Bacteria 731
593 Ga0587073_0123235 3300059492 Bacteria 702
594 Ga0501082_0799174 3300060353 Bacteria 825
595 Ga0530510_0146492 3300061734 Bacteria 1742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10183234 Ga0207706_101832342 105
2 3300050508 nmdc:mga09592_1296365_c1 nmdc:mga09592_1296365_c1_200_556 117
3 3300046531 Ga0495665_0200947 Ga0495665_0200947_323_733 126
4 3300048905 Ga0496102_0117849 Ga0496102_0117849_55_441 127
5 3300048906 Ga0496103_0246162 Ga0496103_0246162_428_814 127
6 3300048921 Ga0496118_0000222 Ga0496118_0000222_89334_89720 127
7 3300053153 Ga0500616_0403194 Ga0500616_0403194_86_496 127
8 3300032126 Ga0307415_100898418 Ga0307415_1008984182 129
9 iso_pu_bacteria 2558860112 2558908087 131
10 iso_pu_bacteria 2585428094 2587861856 131
11 iso_pu_bacteria 2643221961 2645719661 131
12 iso_pu_bacteria 2643221962 2645726553 131
13 iso_pu_bacteria 2744054611 2744954416 131
14 iso_pu_bacteria 2751185734 2753073454 131
15 iso_pu_bacteria 2775506925 2776372609 131
16 iso_pu_bacteria 2818991463 2819697185 131
17 iso_pu_bacteria 2837268691 2837272870 131
18 iso_pu_bacteria 2839986021 2839988532 131
19 iso_pu_bacteria 2852646457 2852647210 131
20 iso_pu_bacteria 2856858025 2856862890 131
21 iso_pu_bacteria 2862574272 2862581501 131
22 iso_pu_bacteria 2863067949 2863073910 131
23 iso_pu_bacteria 2867302475 2867306256 131
24 iso_pu_bacteria 2870721527 2870721737 131
25 iso_pu_bacteria 2884994152 2884995951 131
26 iso_pu_bacteria 2899359706 2899364937 131
27 iso_pu_bacteria 2902792274 2902797768 131
28 iso_pu_bacteria 2945968032 2945971671 131
29 iso_pu_bacteria 2990088156 2990088864 131
30 iso_pu_bacteria 649633069 649815334 131
31 3300005335 Ga0070666_10030503 Ga0070666_100305034 134
32 3300005367 Ga0070667_100008940 Ga0070667_1000089409 134
33 3300005842 Ga0068858_100721459 Ga0068858_1007214592 134
34 3300009553 Ga0105249_11855577 Ga0105249_118555772 134
35 3300025903 Ga0207680_10020395 Ga0207680_100203954 134
36 3300025986 Ga0207658_10000502 Ga0207658_100005028 134
37 3300026035 Ga0207703_10759734 Ga0207703_107597342 134
38 3300031852 Ga0307410_10161716 Ga0307410_101617162 134
39 3300031901 Ga0307406_10234162 Ga0307406_102341622 134
40 3300031903 Ga0307407_10275338 Ga0307407_102753382 134
41 3300031995 Ga0307409_100290361 Ga0307409_1002903612 134
42 3300032126 Ga0307415_100070244 Ga0307415_1000702441 134
43 3300035242 Ga0373962_0002136 Ga0373962_0002136_996_1403 134
44 3300044658 Ga0466972_0298895 Ga0466972_0298895_66_473 134
45 3300044765 Ga0466970_0438580 Ga0466970_0438580_84_491 134
46 3300044901 Ga0466960_0037831 Ga0466960_0037831_1825_2232 134
47 3300045976 Ga0466967_0310382 Ga0466967_0310382_122_529 134
48 3300048903 Ga0496100_0000067 Ga0496100_0000067_2375_2782 134
49 3300048904 Ga0496101_0000099 Ga0496101_0000099_67005_67412 134
50 3300048905 Ga0496102_0006622 Ga0496102_0006622_3987_4394 134
51 3300048906 Ga0496103_0001890 Ga0496103_0001890_7505_7912 134
52 3300048907 Ga0496104_0342200 Ga0496104_0342200_182_589 134
53 3300048908 Ga0496105_0764609 Ga0496105_0764609_310_717 134
54 3300048909 Ga0496106_0003289 Ga0496106_0003289_3032_3439 134
55 3300048910 Ga0496107_0004793 Ga0496107_0004793_1933_2340 134
56 3300048911 Ga0496108_0004506 Ga0496108_0004506_9229_9636 134
57 3300048912 Ga0496109_0000159 Ga0496109_0000159_56320_56727 134
58 3300048913 Ga0496110_0068018 Ga0496110_0068018_298_705 134
59 3300048914 Ga0496111_0026328 Ga0496111_0026328_1593_2000 134
60 3300048917 Ga0496114_0002664 Ga0496114_0002664_1269_1676 134
61 3300048919 Ga0496116_0002510 Ga0496116_0002510_690_1097 134
62 3300048920 Ga0496117_0031052 Ga0496117_0031052_516_923 134
63 3300048921 Ga0496118_0028057 Ga0496118_0028057_1179_1586 134
64 3300048922 Ga0496119_0035065 Ga0496119_0035065_1003_1410 134
65 3300048923 Ga0496120_0037251 Ga0496120_0037251_475_882 134
66 3300048924 Ga0496121_0000016 Ga0496121_0000016_310968_311375 134
67 3300048925 Ga0496122_0000284 Ga0496122_0000284_24887_25294 134
68 3300048926 Ga0496123_0021516 Ga0496123_0021516_1768_2175 134
69 3300048927 Ga0496124_0000015 Ga0496124_0000015_67015_67422 134
70 3300048928 Ga0496125_0000021 Ga0496125_0000021_393279_393686 134
71 3300048929 Ga0496126_0000015 Ga0496126_0000015_393279_393686 134
72 3300053088 Ga0500644_0049411 Ga0500644_0049411_372_779 134
73 3300053104 Ga0500556_0000251 Ga0500556_0000251_4434_4844 134
74 iso_pu_bacteria 2501939600 2501942030 134
75 iso_pu_bacteria 2671180195 2671832551 134
76 iso_pu_bacteria 2773857922 2774850707 134
77 3300001979 JGI24740J21852_10022183 JGI24740J21852_100221832 135
78 3300001989 JGI24739J22299_10022390 JGI24739J22299_100223905 135
79 3300001990 JGI24737J22298_10008513 JGI24737J22298_100085132 135
80 3300002067 JGI24735J21928_10039291 JGI24735J21928_100392912 135
81 3300005329 Ga0070683_100092811 Ga0070683_1000928114 135
82 3300005331 Ga0070670_100937807 Ga0070670_1009378072 135
83 3300005337 Ga0070682_100046502 Ga0070682_1000465023 135
84 3300005337 Ga0070682_100080103 Ga0070682_1000801031 135
85 3300005338 Ga0068868_100210515 Ga0068868_1002105151 135
86 3300005339 Ga0070660_101778576 Ga0070660_1017785761 135
87 3300005340 Ga0070689_100151079 Ga0070689_1001510791 135
88 3300005343 Ga0070687_100239114 Ga0070687_1002391142 135
89 3300005344 Ga0070661_100110992 Ga0070661_1001109923 135
90 3300005347 Ga0070668_100161665 Ga0070668_1001616652 135
91 3300005354 Ga0070675_100562358 Ga0070675_1005623582 135
92 3300005364 Ga0070673_100444172 Ga0070673_1004441722 135
93 3300005365 Ga0070688_100238071 Ga0070688_1002380712 135
94 3300005367 Ga0070667_100000090 Ga0070667_10000009082 135
95 3300005367 Ga0070667_100036825 Ga0070667_1000368254 135
96 3300005434 Ga0070709_10177983 Ga0070709_101779832 135
97 3300005435 Ga0070714_100010010 Ga0070714_1000100106 135
98 3300005435 Ga0070714_100031176 Ga0070714_1000311763 135
99 3300005436 Ga0070713_100030439 Ga0070713_1000304394 135
100 3300005445 Ga0070708_101203933 Ga0070708_1012039331 135
101 3300005457 Ga0070662_100797673 Ga0070662_1007976732 135
102 3300005467 Ga0070706_100004234 Ga0070706_10000423415 135
103 3300005467 Ga0070706_100804318 Ga0070706_1008043182 135
104 3300005471 Ga0070698_100001915 Ga0070698_10000191518 135
105 3300005471 Ga0070698_100208713 Ga0070698_1002087132 135
106 3300005539 Ga0068853_100079398 Ga0068853_1000793983 135
107 3300005539 Ga0068853_101153332 Ga0068853_1011533322 135
108 3300005548 Ga0070665_100184717 Ga0070665_1001847173 135
109 3300005563 Ga0068855_100168815 Ga0068855_1001688152 135
110 3300005615 Ga0070702_100568293 Ga0070702_1005682932 135
111 3300005617 Ga0068859_100383154 Ga0068859_1003831542 135
112 3300005840 Ga0068870_10156471 Ga0068870_101564712 135
113 3300005843 Ga0068860_102121369 Ga0068860_1021213692 135
114 3300005981 Ga0081538_10059237 Ga0081538_100592372 135
115 3300005981 Ga0081538_10293091 Ga0081538_102930911 135
116 3300005985 Ga0081539_10000595 Ga0081539_1000059512 135
117 3300006028 Ga0070717_10003502 Ga0070717_100035024 135
118 3300006028 Ga0070717_10137140 Ga0070717_101371402 135
119 3300006173 Ga0070716_100812576 Ga0070716_1008125762 135
120 3300006175 Ga0070712_100332323 Ga0070712_1003323232 135
121 3300006178 Ga0075367_10387047 Ga0075367_103870472 135
122 3300006186 Ga0075369_10197448 Ga0075369_101974482 135
123 3300006844 Ga0075428_100018460 Ga0075428_1000184606 135
124 3300006844 Ga0075428_100078647 Ga0075428_1000786472 135
125 3300006844 Ga0075428_101097106 Ga0075428_1010971062 135
126 3300006846 Ga0075430_100011454 Ga0075430_1000114546 135
127 3300006846 Ga0075430_100018800 Ga0075430_1000188007 135
128 3300006847 Ga0075431_100027449 Ga0075431_1000274492 135
129 3300006847 Ga0075431_100044564 Ga0075431_1000445645 135
130 3300006847 Ga0075431_100052856 Ga0075431_1000528566 135
131 3300006880 Ga0075429_100006279 Ga0075429_1000062798 135
132 3300006880 Ga0075429_100009117 Ga0075429_1000091173 135
133 3300006931 Ga0097620_100383172 Ga0097620_1003831722 135
134 3300006931 Ga0097620_101902857 Ga0097620_1019028571 135
135 3300007265 Ga0099794_10305053 Ga0099794_103050532 135
136 3300009147 Ga0114129_10039165 Ga0114129_100391654 135
137 3300009147 Ga0114129_10124987 Ga0114129_101249873 135
138 3300009147 Ga0114129_11259142 Ga0114129_112591421 135
139 3300009147 Ga0114129_11651804 Ga0114129_116518042 135
140 3300009148 Ga0105243_10039056 Ga0105243_100390564 135
141 3300009148 Ga0105243_10648766 Ga0105243_106487662 135
142 3300009148 Ga0105243_12160485 Ga0105243_121604851 135
143 3300009177 Ga0105248_10006939 Ga0105248_100069396 135
144 3300009177 Ga0105248_11295847 Ga0105248_112958471 135
145 3300009177 Ga0105248_12019700 Ga0105248_120197002 135
146 3300009545 Ga0105237_10003281 Ga0105237_100032815 135
147 3300009545 Ga0105237_10003835 Ga0105237_100038355 135
148 3300009545 Ga0105237_11189705 Ga0105237_111897052 135
149 3300009545 Ga0105237_11318084 Ga0105237_113180842 135
150 3300009553 Ga0105249_10000158 Ga0105249_1000015810 135
151 3300009553 Ga0105249_10747867 Ga0105249_107478672 135
152 3300010375 Ga0105239_10004461 Ga0105239_1000446115 135
153 3300010375 Ga0105239_10032792 Ga0105239_100327926 135
154 3300010375 Ga0105239_10132325 Ga0105239_101323251 135
155 3300010375 Ga0105239_12849508 Ga0105239_128495081 135
156 3300011119 Ga0105246_10320449 Ga0105246_103204492 135
157 3300011119 Ga0105246_10330478 Ga0105246_103304782 135
158 3300012483 Ga0157337_1003498 Ga0157337_10034981 135
159 3300013105 Ga0157369_10028196 Ga0157369_100281964 135
160 3300013105 Ga0157369_10863497 Ga0157369_108634972 135
161 3300013296 Ga0157374_10952921 Ga0157374_109529211 135
162 3300013297 Ga0157378_10512995 Ga0157378_105129953 135
163 3300013306 Ga0163162_11856040 Ga0163162_118560401 135
164 3300013307 Ga0157372_10128996 Ga0157372_101289961 135
165 3300013307 Ga0157372_10295565 Ga0157372_102955652 135
166 3300013307 Ga0157372_11247580 Ga0157372_112475801 135
167 3300013307 Ga0157372_11384470 Ga0157372_113844702 135
168 3300013308 Ga0157375_10482520 Ga0157375_104825202 135
169 3300014497 Ga0182008_10052972 Ga0182008_100529722 135
170 3300021388 Ga0213875_10100082 Ga0213875_101000822 135
171 3300025294 Ga0209025_1006137 Ga0209025_10061379 135
172 3300025900 Ga0207710_10191822 Ga0207710_101918222 135
173 3300025901 Ga0207688_10004942 Ga0207688_100049429 135
174 3300025901 Ga0207688_10330394 Ga0207688_103303942 135
175 3300025904 Ga0207647_10153830 Ga0207647_101538302 135
176 3300025906 Ga0207699_10583022 Ga0207699_105830222 135
177 3300025908 Ga0207643_10049845 Ga0207643_100498453 135
178 3300025910 Ga0207684_10850233 Ga0207684_108502331 135
179 3300025914 Ga0207671_10003414 Ga0207671_100034143 135
180 3300025914 Ga0207671_10048514 Ga0207671_100485142 135
181 3300025914 Ga0207671_10540459 Ga0207671_105404592 135
182 3300025915 Ga0207693_10217806 Ga0207693_102178062 135
183 3300025927 Ga0207687_10129373 Ga0207687_101293733 135
184 3300025928 Ga0207700_10059205 Ga0207700_100592052 135
185 3300025929 Ga0207664_10022970 Ga0207664_100229702 135
186 3300025932 Ga0207690_10550831 Ga0207690_105508312 135
187 3300025935 Ga0207709_10255533 Ga0207709_102555332 135
188 3300025936 Ga0207670_10309447 Ga0207670_103094472 135
189 3300025936 Ga0207670_10385903 Ga0207670_103859031 135
190 3300025941 Ga0207711_10001074 Ga0207711_1000107412 135
191 3300025949 Ga0207667_10143838 Ga0207667_101438382 135
192 3300025961 Ga0207712_10001692 Ga0207712_1000169211 135
193 3300025961 Ga0207712_10684406 Ga0207712_106844062 135
194 3300025972 Ga0207668_10125165 Ga0207668_101251652 135
195 3300025986 Ga0207658_10000255 Ga0207658_1000025538 135
196 3300025986 Ga0207658_10215693 Ga0207658_102156932 135
197 3300026023 Ga0207677_10195233 Ga0207677_101952333 135
198 3300026041 Ga0207639_10033037 Ga0207639_100330375 135
199 3300026041 Ga0207639_10172507 Ga0207639_101725073 135
200 3300026075 Ga0207708_10355145 Ga0207708_103551452 135
201 3300026116 Ga0207674_10071819 Ga0207674_100718193 135
202 3300028379 Ga0268266_10455291 Ga0268266_104552912 135
203 3300028380 Ga0268265_10460611 Ga0268265_104606113 135
204 3300028381 Ga0268264_11765700 Ga0268264_117657002 135
205 3300028794 Ga0307515_10001767 Ga0307515_1000176727 135
206 3300030878 Ga0265770_1069521 Ga0265770_10695212 135
207 3300031507 Ga0307509_10184257 Ga0307509_101842573 135
208 3300031548 Ga0307408_100297797 Ga0307408_1002977972 135
209 3300031548 Ga0307408_101017990 Ga0307408_1010179902 135
210 3300031548 Ga0307408_101678548 Ga0307408_1016785481 135
211 3300031616 Ga0307508_10364053 Ga0307508_103640532 135
212 3300031731 Ga0307405_10101707 Ga0307405_101017072 135
213 3300031731 Ga0307405_10421076 Ga0307405_104210762 135
214 3300031852 Ga0307410_10014926 Ga0307410_100149262 135
215 3300031852 Ga0307410_10045642 Ga0307410_100456422 135
216 3300031903 Ga0307407_10254702 Ga0307407_102547022 135
217 3300031995 Ga0307409_100049248 Ga0307409_1000492483 135
218 3300031995 Ga0307409_100207009 Ga0307409_1002070093 135
219 3300031995 Ga0307409_100522778 Ga0307409_1005227782 135
220 3300031995 Ga0307409_100542477 Ga0307409_1005424772 135
221 3300032002 Ga0307416_100000815 Ga0307416_10000081510 135
222 3300032002 Ga0307416_100013841 Ga0307416_1000138417 135
223 3300032002 Ga0307416_100113620 Ga0307416_1001136202 135
224 3300032002 Ga0307416_101038313 Ga0307416_1010383132 135
225 3300032002 Ga0307416_101937834 Ga0307416_1019378342 135
226 3300032004 Ga0307414_10190190 Ga0307414_101901902 135
227 3300032004 Ga0307414_10269890 Ga0307414_102698902 135
228 3300032004 Ga0307414_10970690 Ga0307414_109706901 135
229 3300032005 Ga0307411_10062438 Ga0307411_100624384 135
230 3300032005 Ga0307411_10115021 Ga0307411_101150214 135
231 3300032126 Ga0307415_100000831 Ga0307415_1000008315 135
232 3300032126 Ga0307415_100068820 Ga0307415_1000688203 135
233 3300032126 Ga0307415_100297999 Ga0307415_1002979992 135
234 3300033545 Ga0316214_1021632 Ga0316214_10216322 135
235 3300035086 Ga0373934_0000056 Ga0373934_0000056_27291_27701 135
236 3300035086 Ga0373934_0020293 Ga0373934_0020293_1544_1954 135
237 3300035092 Ga0373952_0046214 Ga0373952_0046214_474_884 135
238 3300035113 Ga0373936_0197239 Ga0373936_0197239_328_738 135
239 3300035117 Ga0373953_0000309 Ga0373953_0000309_1610_2020 135
240 3300035117 Ga0373953_0006724 Ga0373953_0006724_2124_2534 135
241 3300035118 Ga0373954_0083814 Ga0373954_0083814_380_790 135
242 3300035118 Ga0373954_0408607 Ga0373954_0408607_224_634 135
243 3300035119 Ga0373956_0003716 Ga0373956_0003716_1649_2059 135
244 3300035119 Ga0373956_0011202 Ga0373956_0011202_1442_1852 135
245 3300035120 Ga0373957_0000263 Ga0373957_0000263_1724_2134 135
246 3300035120 Ga0373957_0016965 Ga0373957_0016965_1443_1853 135
247 3300035170 Ga0373943_0096599 Ga0373943_0096599_903_1313 135
248 3300035170 Ga0373943_0898040 Ga0373943_0898040_100_510 135
249 3300035171 Ga0373946_0010541 Ga0373946_0010541_2336_2746 135
250 3300035172 Ga0373955_0000050 Ga0373955_0000050_39238_39648 135
251 3300035410 Ga0373924_0005896 Ga0373924_0005896_1920_2330 135
252 3300035410 Ga0373924_0064615 Ga0373924_0064615_1088_1498 135
253 3300035692 Ga0373935_0019521 Ga0373935_0019521_2092_2502 135
254 3300035695 Ga0373927_0056271 Ga0373927_0056271_1695_2105 135
255 3300035724 Ga0373933_0000149 Ga0373933_0000149_6038_6448 135
256 3300035724 Ga0373933_0429195 Ga0373933_0429195_439_849 135
257 3300035725 Ga0373947_0045315 Ga0373947_0045315_711_1121 135
258 3300036401 Ga0373937_0000319 Ga0373937_0000319_39238_39648 135
259 3300036401 Ga0373937_0177019 Ga0373937_0177019_546_956 135
260 3300036401 Ga0373937_0957974 Ga0373937_0957974_345_755 135
261 3300037068 Ga0373925_0009155 Ga0373925_0009155_5812_6222 135
262 3300037418 Ga0395900_0158265 Ga0395900_0158265_1786_2196 135
263 3300037418 Ga0395900_0439048 Ga0395900_0439048_593_1003 135
264 3300037418 Ga0395900_0621610 Ga0395900_0621610_582_992 135
265 3300037466 Ga0395898_0038704 Ga0395898_0038704_651_1061 135
266 3300037466 Ga0395898_0151294 Ga0395898_0151294_113_523 135
267 3300037466 Ga0395898_0742711 Ga0395898_0742711_185_595 135
268 3300037466 Ga0395898_0992973 Ga0395898_0992973_118_528 135
269 3300037466 Ga0395898_1100528 Ga0395898_1100528_223_633 135
270 3300037471 Ga0395905_0227868 Ga0395905_0227868_331_741 135
271 3300037853 Ga0436364_0686104 Ga0436364_0686104_1076_1486 135
272 3300037853 Ga0436364_0978717 Ga0436364_0978717_43_453 135
273 3300038443 Ga0395901_0085421 Ga0395901_0085421_2574_2984 135
274 3300038443 Ga0395901_0599298 Ga0395901_0599298_40_450 135
275 3300039437 Ga0436365_0188410 Ga0436365_0188410_256_666 135
276 3300039450 Ga0436363_1124388 Ga0436363_1124388_450_860 135
277 3300041443 Ga0451789_0959797 Ga0451789_0959797_26_436 135
278 3300041463 Ga0451804_0932012 Ga0451804_0932012_120_530 135
279 3300042001 Ga0439441_184767 Ga0439441_184767_38_448 135
280 3300042012 Ga0439455_0168417 Ga0439455_0168417_184_597 135
281 3300042016 Ga0439463_036110 Ga0439463_036110_53_466 135
282 3300042138 Ga0450903_004758 Ga0450903_004758_1844_2254 135
283 3300042438 Ga0439459_0059552 Ga0439459_0059552_138_548 135
284 3300042993 Ga0439440_0104903 Ga0439440_0104903_293_706 135
285 3300044656 Ga0466969_0157070 Ga0466969_0157070_385_795 135
286 3300044658 Ga0466972_0442200 Ga0466972_0442200_174_584 135
287 3300044683 Ga0466965_0038169 Ga0466965_0038169_1452_1862 135
288 3300044684 Ga0466966_0385720 Ga0466966_0385720_132_542 135
289 3300044684 Ga0466966_0389098 Ga0466966_0389098_157_567 135
290 3300044693 Ga0466961_0164309 Ga0466961_0164309_895_1305 135
291 3300044694 Ga0466963_0024741 Ga0466963_0024741_1257_1667 135
292 3300044694 Ga0466963_0444829 Ga0466963_0444829_462_872 135
293 3300044694 Ga0466963_0959780 Ga0466963_0959780_138_551 135
294 3300044706 Ga0466964_0038943 Ga0466964_0038943_1263_1673 135
295 3300044706 Ga0466964_0208900 Ga0466964_0208900_468_878 135
296 3300044706 Ga0466964_0436095 Ga0466964_0436095_200_610 135
297 3300044765 Ga0466970_0245719 Ga0466970_0245719_89_499 135
298 3300044842 Ga0466957_0056310 Ga0466957_0056310_638_1048 135
299 3300044842 Ga0466957_0057752 Ga0466957_0057752_468_878 135
300 3300044842 Ga0466957_0100783 Ga0466957_0100783_844_1254 135
301 3300044842 Ga0466957_0229379 Ga0466957_0229379_365_775 135
302 3300044842 Ga0466957_1214097 Ga0466957_1214097_92_502 135
303 3300044901 Ga0466960_0035699 Ga0466960_0035699_872_1282 135
304 3300044901 Ga0466960_0073723 Ga0466960_0073723_1007_1417 135
305 3300044901 Ga0466960_0189772 Ga0466960_0189772_210_620 135
306 3300044901 Ga0466960_0223251 Ga0466960_0223251_236_646 135
307 3300044901 Ga0466960_0223868 Ga0466960_0223868_541_951 135
308 3300044901 Ga0466960_0369047 Ga0466960_0369047_350_760 135
309 3300045049 Ga0466959_0159917 Ga0466959_0159917_918_1328 135
310 3300045049 Ga0466959_0238415 Ga0466959_0238415_527_937 135
311 3300045049 Ga0466959_0654620 Ga0466959_0654620_255_665 135
312 3300045836 Ga0466958_0066772 Ga0466958_0066772_1555_1965 135
313 3300045836 Ga0466958_0216394 Ga0466958_0216394_635_1045 135
314 3300045976 Ga0466967_0002981 Ga0466967_0002981_6204_6614 135
315 3300045976 Ga0466967_0010513 Ga0466967_0010513_3755_4168 135
316 3300045976 Ga0466967_0030610 Ga0466967_0030610_712_1122 135
317 3300045976 Ga0466967_0156048 Ga0466967_0156048_328_738 135
318 3300045976 Ga0466967_0396339 Ga0466967_0396339_171_581 135
319 3300045976 Ga0466967_0492077 Ga0466967_0492077_479_889 135
320 3300045976 Ga0466967_1188609 Ga0466967_1188609_240_650 135
321 3300046452 Ga0495617_118430 Ga0495617_118430_183_593 135
322 3300046454 Ga0495592_0000255 Ga0495592_0000255_39238_39648 135
323 3300046455 Ga0495603_0000550 Ga0495603_0000550_11891_12301 135
324 3300046455 Ga0495603_0009715 Ga0495603_0009715_70_480 135
325 3300046455 Ga0495603_0036090 Ga0495603_0036090_624_1034 135
326 3300046455 Ga0495603_0707324 Ga0495603_0707324_79_489 135
327 3300046459 Ga0495629_0001975 Ga0495629_0001975_7988_8398 135
328 3300046459 Ga0495629_0003408 Ga0495629_0003408_654_1064 135
329 3300046459 Ga0495629_0508081 Ga0495629_0508081_190_600 135
330 3300046460 Ga0495638_0104562 Ga0495638_0104562_1057_1467 135
331 3300046461 Ga0495641_0026618 Ga0495641_0026618_677_1087 135
332 3300046462 Ga0495651_0000199 Ga0495651_0000199_6038_6448 135
333 3300046463 Ga0495653_0010908 Ga0495653_0010908_5988_6398 135
334 3300046472 Ga0495580_0017038 Ga0495580_0017038_3144_3554 135
335 3300046473 Ga0495582_0100086 Ga0495582_0100086_902_1312 135
336 3300046475 Ga0495639_0039380 Ga0495639_0039380_165_575 135
337 3300046476 Ga0495662_0064845 Ga0495662_0064845_918_1328 135
338 3300046477 Ga0495664_0038694 Ga0495664_0038694_1885_2295 135
339 3300046477 Ga0495664_0052566 Ga0495664_0052566_569_979 135
340 3300046499 Ga0495594_0001353 Ga0495594_0001353_9866_10276 135
341 3300046499 Ga0495594_0012361 Ga0495594_0012361_1833_2243 135
342 3300046499 Ga0495594_0061282 Ga0495594_0061282_551_961 135
343 3300046501 Ga0495607_0126401 Ga0495607_0126401_36_446 135
344 3300046506 Ga0495583_0062146 Ga0495583_0062146_940_1350 135
345 3300046511 Ga0495608_0001171 Ga0495608_0001171_5989_6399 135
346 3300046511 Ga0495608_0093930 Ga0495608_0093930_1018_1428 135
347 3300046514 Ga0495618_0137865 Ga0495618_0137865_1112_1522 135
348 3300046516 Ga0495628_0000282 Ga0495628_0000282_5998_6408 135
349 3300046517 Ga0495630_0429988 Ga0495630_0429988_274_684 135
350 3300046518 Ga0495631_0209531 Ga0495631_0209531_258_668 135
351 3300046522 Ga0495643_0344285 Ga0495643_0344285_132_542 135
352 3300046524 Ga0495648_0002385 Ga0495648_0002385_13030_13440 135
353 3300046528 Ga0495642_0241457 Ga0495642_0241457_128_538 135
354 3300046529 Ga0495652_0002623 Ga0495652_0002623_6037_6447 135
355 3300046529 Ga0495652_0272412 Ga0495652_0272412_510_920 135
356 3300046530 Ga0495654_0154269 Ga0495654_0154269_275_685 135
357 3300046531 Ga0495665_0016094 Ga0495665_0016094_1790_2200 135
358 3300046531 Ga0495665_0245957 Ga0495665_0245957_81_491 135
359 3300046536 Ga0495587_0000189 Ga0495587_0000189_6038_6448 135
360 3300046543 Ga0495645_0072661 Ga0495645_0072661_1115_1525 135
361 3300046543 Ga0495645_0177067 Ga0495645_0177067_267_677 135
362 3300046558 Ga0495633_0071662 Ga0495633_0071662_953_1363 135
363 3300046559 Ga0495667_0000136 Ga0495667_0000136_11084_11494 135
364 3300046559 Ga0495667_0031636 Ga0495667_0031636_598_1008 135
365 3300046616 Ga0495668_0014484 Ga0495668_0014484_2193_2603 135
366 3300046642 Ga0495634_0196880 Ga0495634_0196880_644_1054 135
367 3300046663 Ga0495635_0159568 Ga0495635_0159568_1086_1496 135
368 3300046664 Ga0495659_0310752 Ga0495659_0310752_17_427 135
369 3300046664 Ga0495659_0500420 Ga0495659_0500420_107_517 135
370 3300046664 Ga0495659_0555931 Ga0495659_0555931_73_483 135
371 3300046665 Ga0495661_0196239 Ga0495661_0196239_377_787 135
372 3300046674 Ga0495588_0125537 Ga0495588_0125537_710_1120 135
373 3300046675 Ga0495657_0000290 Ga0495657_0000290_6038_6448 135
374 3300046678 Ga0495599_0000676 Ga0495599_0000676_7822_8232 135
375 3300046678 Ga0495599_0121476 Ga0495599_0121476_439_849 135
376 3300046679 Ga0495623_0002482 Ga0495623_0002482_5808_6218 135
377 3300046679 Ga0495623_0047070 Ga0495623_0047070_1877_2287 135
378 3300046680 Ga0495646_0024101 Ga0495646_0024101_1207_1617 135
379 3300046680 Ga0495646_0028819 Ga0495646_0028819_1963_2373 135
380 3300046683 Ga0495658_0057220 Ga0495658_0057220_1732_2142 135
381 3300046684 Ga0495669_0002865 Ga0495669_0002865_1367_1777 135
382 3300046689 Ga0495613_0130140 Ga0495613_0130140_439_849 135
383 3300046690 Ga0495624_0045742 Ga0495624_0045742_1524_1934 135
384 3300046691 Ga0495670_0002672 Ga0495670_0002672_8119_8529 135
385 3300046692 Ga0495671_0100396 Ga0495671_0100396_187_597 135
386 3300046794 Ga0495589_0096022 Ga0495589_0096022_641_1051 135
387 3300046794 Ga0495589_0122363 Ga0495589_0122363_111_521 135
388 3300046809 Ga0495600_0004743 Ga0495600_0004743_322_732 135
389 3300046809 Ga0495600_0053994 Ga0495600_0053994_324_734 135
390 3300047315 Ga0495581_0006043 Ga0495581_0006043_6080_6490 135
391 3300047315 Ga0495581_0101454 Ga0495581_0101454_1098_1508 135
392 3300047317 Ga0495604_0000280 Ga0495604_0000280_6038_6448 135
393 3300047317 Ga0495604_0141334 Ga0495604_0141334_535_945 135
394 3300047318 Ga0495636_0335831 Ga0495636_0335831_264_674 135
395 3300047319 Ga0495674_0145394 Ga0495674_0145394_903_1313 135
396 3300047320 Ga0495672_0004058 Ga0495672_0004058_3074_3484 135
397 3300047320 Ga0495672_0008155 Ga0495672_0008155_2830_3240 135
398 3300047321 Ga0495676_0004019 Ga0495676_0004019_6715_7125 135
399 3300047321 Ga0495676_0005888 Ga0495676_0005888_772_1182 135
400 3300047321 Ga0495676_0009607 Ga0495676_0009607_5347_5757 135
401 3300047321 Ga0495676_0394140 Ga0495676_0394140_223_633 135
402 3300047321 Ga0495676_0427719 Ga0495676_0427719_55_465 135
403 3300047322 Ga0495680_0000430 Ga0495680_0000430_7425_7835 135
404 3300047323 Ga0495683_0045770 Ga0495683_0045770_1099_1509 135
405 3300047444 Ga0495675_0000347 Ga0495675_0000347_21208_21618 135
406 3300047444 Ga0495675_0021589 Ga0495675_0021589_3454_3864 135
407 3300047445 Ga0495677_0430329 Ga0495677_0430329_62_472 135
408 3300047447 Ga0495685_042549 Ga0495685_042549_1018_1428 135
409 3300047469 Ga0495673_0002967 Ga0495673_0002967_1582_1992 135
410 3300047471 Ga0495684_0120685 Ga0495684_0120685_328_738 135
411 3300047472 Ga0495686_0001693 Ga0495686_0001693_15510_15920 135
412 3300047673 Ga0495593_0202494 Ga0495593_0202494_565_975 135
413 3300048088 Ga0495602_0000297 Ga0495602_0000297_6038_6448 135
414 3300048088 Ga0495602_0050303 Ga0495602_0050303_510_920 135
415 3300048089 Ga0495614_0002695 Ga0495614_0002695_3177_3587 135
416 3300048903 Ga0496100_0002909 Ga0496100_0002909_4801_5211 135
417 3300048903 Ga0496100_0046449 Ga0496100_0046449_2115_2525 135
418 3300048904 Ga0496101_0000019 Ga0496101_0000019_92263_92673 135
419 3300048905 Ga0496102_0000007 Ga0496102_0000007_240497_240907 135
420 3300048905 Ga0496102_0006394 Ga0496102_0006394_7868_8278 135
421 3300048905 Ga0496102_0192889 Ga0496102_0192889_1321_1731 135
422 3300048906 Ga0496103_0000013 Ga0496103_0000013_121354_121764 135
423 3300048906 Ga0496103_0041337 Ga0496103_0041337_557_967 135
424 3300048907 Ga0496104_0162218 Ga0496104_0162218_1015_1425 135
425 3300048908 Ga0496105_0274069 Ga0496105_0274069_787_1197 135
426 3300048908 Ga0496105_0531857 Ga0496105_0531857_68_478 135
427 3300048908 Ga0496105_0646913 Ga0496105_0646913_152_562 135
428 3300048909 Ga0496106_0028565 Ga0496106_0028565_153_563 135
429 3300048909 Ga0496106_0092809 Ga0496106_0092809_497_907 135
430 3300048910 Ga0496107_0121731 Ga0496107_0121731_783_1193 135
431 3300048910 Ga0496107_0246474 Ga0496107_0246474_758_1168 135
432 3300048911 Ga0496108_0663719 Ga0496108_0663719_371_781 135
433 3300048911 Ga0496108_0868713 Ga0496108_0868713_94_504 135
434 3300048911 Ga0496108_1133390 Ga0496108_1133390_23_433 135
435 3300048912 Ga0496109_0000667 Ga0496109_0000667_26245_26658 135
436 3300048912 Ga0496109_0516785 Ga0496109_0516785_263_673 135
437 3300048913 Ga0496110_0072941 Ga0496110_0072941_2352_2762 135
438 3300048913 Ga0496110_0380277 Ga0496110_0380277_767_1177 135
439 3300048913 Ga0496110_0479442 Ga0496110_0479442_298_708 135
440 3300048914 Ga0496111_0123849 Ga0496111_0123849_1349_1759 135
441 3300048915 Ga0496112_0297157 Ga0496112_0297157_1025_1435 135
442 3300048915 Ga0496112_0339660 Ga0496112_0339660_745_1155 135
443 3300048916 Ga0496113_0162263 Ga0496113_0162263_227_637 135
444 3300048917 Ga0496114_0130811 Ga0496114_0130811_1285_1695 135
445 3300048917 Ga0496114_0275916 Ga0496114_0275916_270_680 135
446 3300048917 Ga0496114_0287177 Ga0496114_0287177_696_1106 135
447 3300048917 Ga0496114_0784164 Ga0496114_0784164_109_519 135
448 3300048918 Ga0496115_0618562 Ga0496115_0618562_294_704 135
449 3300048919 Ga0496116_0000033 Ga0496116_0000033_177264_177674 135
450 3300048920 Ga0496117_0000025 Ga0496117_0000025_177194_177604 135
451 3300048920 Ga0496117_0000738 Ga0496117_0000738_17172_17585 135
452 3300048921 Ga0496118_0000023 Ga0496118_0000023_240503_240913 135
453 3300048921 Ga0496118_0002673 Ga0496118_0002673_9302_9715 135
454 3300048921 Ga0496118_0052738 Ga0496118_0052738_712_1122 135
455 3300048922 Ga0496119_0000512 Ga0496119_0000512_37448_37858 135
456 3300048922 Ga0496119_0001355 Ga0496119_0001355_19063_19476 135
457 3300048922 Ga0496119_0158389 Ga0496119_0158389_112_522 135
458 3300048923 Ga0496120_0000382 Ga0496120_0000382_37576_37986 135
459 3300048924 Ga0496121_0000039 Ga0496121_0000039_75206_75616 135
460 3300048925 Ga0496122_0000126 Ga0496122_0000126_159176_159586 135
461 3300048926 Ga0496123_0002656 Ga0496123_0002656_6993_7403 135
462 3300048929 Ga0496126_0002371 Ga0496126_0002371_12758_13168 135
463 3300048929 Ga0496126_0005034 Ga0496126_0005034_14003_14416 135
464 3300048929 Ga0496126_0200594 Ga0496126_0200594_117_527 135
465 3300048929 Ga0496126_0226032 Ga0496126_0226032_212_622 135
466 3300049570 Ga0501033_0036710 Ga0501033_0036710_2737_3147 135
467 3300049570 Ga0501033_0388939 Ga0501033_0388939_428_838 135
468 3300049572 Ga0501036_0702000 Ga0501036_0702000_21_431 135
469 3300049572 Ga0501036_1198961 Ga0501036_1198961_175_585 135
470 3300049574 Ga0501038_0404148 Ga0501038_0404148_147_557 135
471 3300049574 Ga0501038_0747576 Ga0501038_0747576_271_681 135
472 3300049575 Ga0501039_0312370 Ga0501039_0312370_569_979 135
473 3300049575 Ga0501039_0354897 Ga0501039_0354897_33_443 135
474 3300049576 Ga0501040_0323804 Ga0501040_0323804_432_842 135
475 3300049576 Ga0501040_1382564 Ga0501040_1382564_33_443 135
476 3300049578 Ga0501042_0161009 Ga0501042_0161009_535_945 135
477 3300049578 Ga0501042_0656242 Ga0501042_0656242_289_699 135
478 3300049581 Ga0501047_0123709 Ga0501047_0123709_203_613 135
479 3300049582 Ga0501048_0194631 Ga0501048_0194631_653_1063 135
480 3300049583 Ga0501067_0017474 Ga0501067_0017474_2907_3317 135
481 3300049583 Ga0501067_0033673 Ga0501067_0033673_1857_2267 135
482 3300049584 Ga0501068_0077444 Ga0501068_0077444_453_863 135
483 3300049585 Ga0501069_0112835 Ga0501069_0112835_133_543 135
484 3300049585 Ga0501069_0165879 Ga0501069_0165879_46_456 135
485 3300049586 Ga0501070_0435513 Ga0501070_0435513_430_840 135
486 3300049587 Ga0501071_0229096 Ga0501071_0229096_391_801 135
487 3300049588 Ga0501072_0061383 Ga0501072_0061383_2535_2945 135
488 3300049588 Ga0501072_0666156 Ga0501072_0666156_10_420 135
489 3300049588 Ga0501072_1131878 Ga0501072_1131878_27_437 135
490 3300049704 Ga0501221_176816 Ga0501221_176816_159_569 135
491 3300049707 Ga0501234_102737 Ga0501234_102737_19_429 135
492 3300049744 Ga0501083_1095695 Ga0501083_1095695_12_422 135
493 3300049822 Ga0501035_0412620 Ga0501035_0412620_571_981 135
494 3300049823 Ga0501044_0066437 Ga0501044_0066437_74_484 135
495 3300049824 Ga0501045_0454466 Ga0501045_0454466_195_605 135
496 3300049824 Ga0501045_0984617 Ga0501045_0984617_102_512 135
497 3300050494 nmdc:mga06z11_199538_c1 nmdc:mga06z11_199538_c1_607_1017 135
498 3300050507 nmdc:mga05p37_1161515_c1 nmdc:mga05p37_1161515_c1_359_769 135
499 3300050507 nmdc:mga05p37_24150_c1 nmdc:mga05p37_24150_c1_4465_4875 135
500 3300050507 nmdc:mga05p37_81702_c1 nmdc:mga05p37_81702_c1_436_846 135
501 3300050508 nmdc:mga09592_22160_c1 nmdc:mga09592_22160_c1_2232_2642 135
502 3300050509 nmdc:mga0qj67_4976_c1 nmdc:mga0qj67_4976_c1_6756_7166 135
503 3300050510 nmdc:mga06r32_37973_c1 nmdc:mga06r32_37973_c1_3225_3635 135
504 3300050511 nmdc:mga08y16_1177672_c1 nmdc:mga08y16_1177672_c1_21_431 135
505 3300050512 nmdc:mga0n895_556797_c1 nmdc:mga0n895_556797_c1_191_601 135
506 3300050516 nmdc:mga0sz30_115007_c1 nmdc:mga0sz30_115007_c1_88_498 135
507 3300053077 Ga0495601_0034611 Ga0495601_0034611_2694_3104 135
508 3300053077 Ga0495601_0303231 Ga0495601_0303231_204_614 135
509 3300053078 Ga0495612_0005080 Ga0495612_0005080_10_420 135
510 3300053085 Ga0495619_0207222 Ga0495619_0207222_536_946 135
511 3300053085 Ga0495619_0604320 Ga0495619_0604320_301_711 135
512 3300053087 Ga0500643_001928 Ga0500643_001928_10495_10905 135
513 3300053120 Ga0500597_015966 Ga0500597_015966_2197_2607 135
514 3300054114 Ga0501084_0635002 Ga0501084_0635002_25_435 135
515 3300054114 Ga0501084_0929631 Ga0501084_0929631_244_654 135
516 3300060353 Ga0501082_0799174 Ga0501082_0799174_147_557 135
517 3300061734 Ga0530510_0146492 Ga0530510_0146492_267_677 135
518 3300005467 Ga0070706_100508528 Ga0070706_1005085281 136
519 3300005471 Ga0070698_100588663 Ga0070698_1005886632 136
520 3300006852 Ga0075433_11750346 Ga0075433_117503461 136
521 3300009147 Ga0114129_11272416 Ga0114129_112724162 136
522 3300025910 Ga0207684_10042876 Ga0207684_100428762 136
523 3300026088 Ga0207641_11213008 Ga0207641_112130082 136
524 3300026095 Ga0207676_10674761 Ga0207676_106747612 136
525 3300048912 Ga0496109_0015932 Ga0496109_0015932_1132_1545 136
526 3300048913 Ga0496110_0723779 Ga0496110_0723779_197_610 136
527 3300048915 Ga0496112_1352863 Ga0496112_1352863_201_614 136
528 3300048916 Ga0496113_0166959 Ga0496113_0166959_997_1410 136
529 3300049581 Ga0501047_0022525 Ga0501047_0022525_4750_5163 136
530 3300003373 JGI25407J50210_10001088 JGI25407J50210_100010884 137
531 3300003373 JGI25407J50210_10028587 JGI25407J50210_100285873 137
532 3300005981 Ga0081538_10037116 Ga0081538_100371161 137
533 3300005981 Ga0081538_10244653 Ga0081538_102446531 137
534 3300013307 Ga0157372_10881749 Ga0157372_108817492 137
535 3300031901 Ga0307406_10818815 Ga0307406_108188152 137
536 3300037312 Ga0395899_0497554 Ga0395899_0497554_107_526 137
537 3300037418 Ga0395900_0060712 Ga0395900_0060712_2000_2419 137
538 3300037466 Ga0395898_1976439 Ga0395898_1976439_72_488 137
539 3300037471 Ga0395905_0412842 Ga0395905_0412842_795_1214 137
540 3300038443 Ga0395901_0358880 Ga0395901_0358880_855_1271 137
541 3300038443 Ga0395901_0521255 Ga0395901_0521255_181_600 137
542 3300042993 Ga0439440_0048156 Ga0439440_0048156_495_911 137
543 3300046500 Ga0495596_0388172 Ga0495596_0388172_44_463 137
544 3300049584 Ga0501068_0149607 Ga0501068_0149607_364_780 137
545 3300049590 Ga0501074_0073126 Ga0501074_0073126_1422_1838 137
546 3300049742 Ga0501080_0009244 Ga0501080_0009244_1237_1653 137
547 3300053142 Ga0500577_0186471 Ga0500577_0186471_44_460 137
548 3300003203 JGI25406J46586_10008756 JGI25406J46586_100087562 138
549 3300005288 Ga0065714_10074977 Ga0065714_100749773 138
550 3300005327 Ga0070658_10521161 Ga0070658_105211611 138
551 3300005336 Ga0070680_100760283 Ga0070680_1007602831 138
552 3300005347 Ga0070668_100001181 Ga0070668_1000011814 138
553 3300005366 Ga0070659_100285832 Ga0070659_1002858322 138
554 3300005458 Ga0070681_10100672 Ga0070681_101006722 138
555 3300005518 Ga0070699_101211227 Ga0070699_1012112272 138
556 3300005530 Ga0070679_101174559 Ga0070679_1011745591 138
557 3300005535 Ga0070684_100255999 Ga0070684_1002559992 138
558 3300005535 Ga0070684_100385706 Ga0070684_1003857062 138
559 3300005536 Ga0070697_100153943 Ga0070697_1001539433 138
560 3300005545 Ga0070695_100040203 Ga0070695_1000402032 138
561 3300005614 Ga0068856_100222984 Ga0068856_1002229844 138
562 3300005616 Ga0068852_100607266 Ga0068852_1006072663 138
563 3300005981 Ga0081538_10000836 Ga0081538_1000083633 138
564 3300005981 Ga0081538_10072573 Ga0081538_100725733 138
565 3300005981 Ga0081538_10162545 Ga0081538_101625452 138
566 3300005985 Ga0081539_10004760 Ga0081539_100047604 138
567 3300013105 Ga0157369_10298699 Ga0157369_102986994 138
568 3300013307 Ga0157372_10311353 Ga0157372_103113532 138
569 3300013308 Ga0157375_10296944 Ga0157375_102969442 138
570 3300025912 Ga0207707_10491970 Ga0207707_104919702 138
571 3300025928 Ga0207700_10232509 Ga0207700_102325093 138
572 3300025932 Ga0207690_10306779 Ga0207690_103067793 138
573 3300025944 Ga0207661_10202916 Ga0207661_102029163 138
574 3300025972 Ga0207668_10153548 Ga0207668_101535482 138
575 3300026078 Ga0207702_10553589 Ga0207702_105535892 138
576 3300026116 Ga0207674_10311528 Ga0207674_103115282 138
577 3300026116 Ga0207674_10911415 Ga0207674_109114152 138
578 3300031852 Ga0307410_10527400 Ga0307410_105274002 138
579 3300031995 Ga0307409_101058674 Ga0307409_1010586742 138
580 3300032002 Ga0307416_100469501 Ga0307416_1004695012 138
581 3300032004 Ga0307414_10565761 Ga0307414_105657612 138
582 3300032005 Ga0307411_10367087 Ga0307411_103670872 138
583 3300032126 Ga0307415_100993652 Ga0307415_1009936522 138
584 3300032126 Ga0307415_101342545 Ga0307415_1013425452 138
585 3300037312 Ga0395899_0529993 Ga0395899_0529993_229_648 138
586 3300037418 Ga0395900_0025139 Ga0395900_0025139_2751_3170 138
587 3300037466 Ga0395898_0090231 Ga0395898_0090231_485_904 138
588 3300039450 Ga0436363_1021750 Ga0436363_1021750_92_511 138
589 3300044706 Ga0466964_0475028 Ga0466964_0475028_158_577 138
590 3300045976 Ga0466967_0003925 Ga0466967_0003925_8372_8791 138
591 3300045976 Ga0466967_1368395 Ga0466967_1368395_47_466 138
592 3300046517 Ga0495630_0411024 Ga0495630_0411024_299_718 138
593 3300046674 Ga0495588_0015689 Ga0495588_0015689_2979_3398 138
594 3300046674 Ga0495588_0172842 Ga0495588_0172842_181_600 138
595 3300046691 Ga0495670_0026483 Ga0495670_0026483_1089_1508 138
596 3300046794 Ga0495589_0174270 Ga0495589_0174270_588_1007 138
597 3300047318 Ga0495636_0282957 Ga0495636_0282957_15_434 138
598 3300048903 Ga0496100_0177743 Ga0496100_0177743_470_889 138
599 3300048904 Ga0496101_0008278 Ga0496101_0008278_2192_2611 138
600 3300048905 Ga0496102_0145474 Ga0496102_0145474_622_1041 138
601 3300048905 Ga0496102_0202042 Ga0496102_0202042_1112_1531 138
602 3300048906 Ga0496103_0090849 Ga0496103_0090849_580_999 138
603 3300048909 Ga0496106_0190484 Ga0496106_0190484_927_1346 138
604 3300048910 Ga0496107_0018178 Ga0496107_0018178_3602_4021 138
605 3300048911 Ga0496108_0027387 Ga0496108_0027387_3293_3712 138
606 3300048914 Ga0496111_0127288 Ga0496111_0127288_202_621 138
607 3300048916 Ga0496113_0228606 Ga0496113_0228606_311_730 138
608 3300048917 Ga0496114_0107386 Ga0496114_0107386_546_965 138
609 3300049577 Ga0501041_0038998 Ga0501041_0038998_2225_2644 138
610 3300049582 Ga0501048_0538296 Ga0501048_0538296_362_781 138
611 3300059492 Ga0587073_0123235 Ga0587073_0123235_32_451 138
612 3300005535 Ga0070684_100689405 Ga0070684_1006894052 139
613 3300005577 Ga0068857_101726123 Ga0068857_1017261231 139
614 3300044694 Ga0466963_0929390 Ga0466963_0929390_65_490 140
615 3300045049 Ga0466959_0260890 Ga0466959_0260890_249_674 140
616 3300045976 Ga0466967_0001059 Ga0466967_0001059_6079_6504 140
617 3300049741 Ga0501079_0632779 Ga0501079_0632779_44_532 142
618 3300050509 nmdc:mga0qj67_17465_c1 nmdc:mga0qj67_17465_c1_3870_4319 142
619 3300050510 nmdc:mga06r32_6314_c1 nmdc:mga06r32_6314_c1_4559_5008 142
620 iso_pu_bacteria 8056060235 8056064001 146
621 3300000546 LJNas_1015234 LJNas_10152342 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

142

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8731 12 145
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8667 12 145
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8666 14 146
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8546 12 145
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8492 12 145
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9505 93 142 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9458 93 144 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8792 93 142 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8665 93 144 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8618 94 148 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7V9NV14-F1-model_v4 VOC family protein 0.9969 12 146
AF-A0A0M8YYP4-F1-model_v4 Glyoxalase 0.9957 12 146
AF-A0A1A1XR19-F1-model_v4 deleted 0.9943 12 146
AF-A0A4V2YPG6-F1-model_v4 VOC family protein 0.9941 13 146
AF-A0A1A3D5H7-F1-model_v4 Glyoxalase 0.9937 12 146

Feature Viewer

pLDDT pTM Quality
93.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map