F469968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 621 | 341 | 595 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300000546|LJNas_1015234|LJNas_10152342 |
| Length | 148 |
| Sequence | VGHDAAPSLTVMDITINNTFLPHDDPEASLAFYRDTLGFEVRLDVGAGKMRWITVGAPGQDVAIVLHPPAADPGITDDERRLIAEMMAKGTYAIITLATPDLDATFERLQARDVEVVQEPTEQPYGVRDCAVRDPAGTLIRINERREA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 5 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 6 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 7 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 8 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 9 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 10 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 11 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 12 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 13 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 14 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 15 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 16 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 17 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 18 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 19 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 20 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 21 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 22 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 23 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 24 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 25 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 182 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 183 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 184 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 185 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 186 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 187 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 340 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 341 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.49 |
| Metatranscriptomes | 0.32 |
| Isolates | 4.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.77 |
| Nodule | 0.48 |
| Rhizoplane | 10.47 |
| Rhizosphere | 79.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1015234 | 3300000546 | Bacteria | 819 |
| 2 | JGI24740J21852_10022183 | 3300001979 | Bacteria | 2190 |
| 3 | JGI24739J22299_10022390 | 3300001989 | Bacteria | 2242 |
| 4 | JGI24737J22298_10008513 | 3300001990 | Bacteria | 3430 |
| 5 | JGI24735J21928_10039291 | 3300002067 | Bacteria | 1384 |
| 6 | JGI25406J46586_10008756 | 3300003203 | Bacteria | 4559 |
| 7 | JGI25407J50210_10001088 | 3300003373 | Bacteria | 5979 |
| 8 | JGI25407J50210_10028587 | 3300003373 | Bacteria | 1446 |
| 9 | Ga0065714_10074977 | 3300005288 | Bacteria | 2964 |
| 10 | Ga0070658_10521161 | 3300005327 | Bacteria | 1028 |
| 11 | Ga0070683_100092811 | 3300005329 | Bacteria | 2835 |
| 12 | Ga0070670_100937807 | 3300005331 | Bacteria | 786 |
| 13 | Ga0070666_10030503 | 3300005335 | Bacteria | 3552 |
| 14 | Ga0070680_100760283 | 3300005336 | Bacteria | 834 |
| 15 | Ga0070682_100046502 | 3300005337 | Bacteria | 2694 |
| 16 | Ga0070682_100080103 | 3300005337 | Bacteria | 2110 |
| 17 | Ga0068868_100210515 | 3300005338 | Bacteria | 1625 |
| 18 | Ga0070660_101778576 | 3300005339 | Bacteria | 525 |
| 19 | Ga0070689_100151079 | 3300005340 | Bacteria | 1873 |
| 20 | Ga0070687_100239114 | 3300005343 | Bacteria | 1122 |
| 21 | Ga0070661_100110992 | 3300005344 | Bacteria | 2048 |
| 22 | Ga0070668_100001181 | 3300005347 | Bacteria | 18485 |
| 23 | Ga0070668_100161665 | 3300005347 | Bacteria | 1817 |
| 24 | Ga0070675_100562358 | 3300005354 | Bacteria | 1032 |
| 25 | Ga0070673_100444172 | 3300005364 | Bacteria | 1166 |
| 26 | Ga0070688_100238071 | 3300005365 | Bacteria | 1290 |
| 27 | Ga0070659_100285832 | 3300005366 | Bacteria | 1373 |
| 28 | Ga0070667_100000090 | 3300005367 | Bacteria | 112981 |
| 29 | Ga0070667_100008940 | 3300005367 | Bacteria | 8292 |
| 30 | Ga0070667_100036825 | 3300005367 | Bacteria | 4102 |
| 31 | Ga0070709_10177983 | 3300005434 | Bacteria | 1491 |
| 32 | Ga0070714_100010010 | 3300005435 | Bacteria | 7478 |
| 33 | Ga0070714_100031176 | 3300005435 | Bacteria | 4446 |
| 34 | Ga0070713_100030439 | 3300005436 | Bacteria | 4287 |
| 35 | Ga0070708_101203933 | 3300005445 | Bacteria | 708 |
| 36 | Ga0070662_100797673 | 3300005457 | Bacteria | 803 |
| 37 | Ga0070681_10100672 | 3300005458 | Bacteria | 2836 |
| 38 | Ga0070706_100004234 | 3300005467 | Bacteria | 13925 |
| 39 | Ga0070706_100508528 | 3300005467 | Bacteria | 1121 |
| 40 | Ga0070706_100804318 | 3300005467 | Bacteria | 870 |
| 41 | Ga0070698_100001915 | 3300005471 | Bacteria | 23191 |
| 42 | Ga0070698_100208713 | 3300005471 | Bacteria | 1888 |
| 43 | Ga0070698_100588663 | 3300005471 | Bacteria | 1053 |
| 44 | Ga0070699_101211227 | 3300005518 | Bacteria | 693 |
| 45 | Ga0070679_101174559 | 3300005530 | Bacteria | 712 |
| 46 | Ga0070684_100255999 | 3300005535 | Bacteria | 1600 |
| 47 | Ga0070684_100385706 | 3300005535 | Bacteria | 1291 |
| 48 | Ga0070684_100689405 | 3300005535 | Bacteria | 952 |
| 49 | Ga0070697_100153943 | 3300005536 | Bacteria | 1939 |
| 50 | Ga0068853_100079398 | 3300005539 | Bacteria | 2869 |
| 51 | Ga0068853_101153332 | 3300005539 | Bacteria | 748 |
| 52 | Ga0070695_100040203 | 3300005545 | Bacteria | 2959 |
| 53 | Ga0070665_100184717 | 3300005548 | Bacteria | 2086 |
| 54 | Ga0068855_100168815 | 3300005563 | Bacteria | 2478 |
| 55 | Ga0068857_101726123 | 3300005577 | Bacteria | 612 |
| 56 | Ga0068856_100222984 | 3300005614 | Bacteria | 1901 |
| 57 | Ga0070702_100568293 | 3300005615 | Bacteria | 845 |
| 58 | Ga0068852_100607266 | 3300005616 | Bacteria | 1099 |
| 59 | Ga0068859_100383154 | 3300005617 | Bacteria | 1501 |
| 60 | Ga0068870_10156471 | 3300005840 | Bacteria | 1347 |
| 61 | Ga0068858_100721459 | 3300005842 | Bacteria | 970 |
| 62 | Ga0068860_102121369 | 3300005843 | Bacteria | 583 |
| 63 | Ga0081538_10000836 | 3300005981 | Bacteria | 33350 |
| 64 | Ga0081538_10037116 | 3300005981 | Bacteria | 3168 |
| 65 | Ga0081538_10059237 | 3300005981 | Bacteria | 2213 |
| 66 | Ga0081538_10072573 | 3300005981 | Bacteria | 1886 |
| 67 | Ga0081538_10162545 | 3300005981 | Bacteria | 989 |
| 68 | Ga0081538_10244653 | 3300005981 | Bacteria | 689 |
| 69 | Ga0081538_10293091 | 3300005981 | Bacteria | 600 |
| 70 | Ga0081539_10000595 | 3300005985 | Bacteria | 73899 |
| 71 | Ga0081539_10004760 | 3300005985 | Bacteria | 14654 |
| 72 | Ga0070717_10003502 | 3300006028 | Bacteria | 11235 |
| 73 | Ga0070717_10137140 | 3300006028 | Bacteria | 2108 |
| 74 | Ga0070716_100812576 | 3300006173 | Bacteria | 725 |
| 75 | Ga0070712_100332323 | 3300006175 | Bacteria | 1238 |
| 76 | Ga0075367_10387047 | 3300006178 | Bacteria | 884 |
| 77 | Ga0075369_10197448 | 3300006186 | Bacteria | 928 |
| 78 | Ga0075428_100018460 | 3300006844 | Bacteria | 7711 |
| 79 | Ga0075428_100078647 | 3300006844 | Bacteria | 3600 |
| 80 | Ga0075428_101097106 | 3300006844 | Bacteria | 841 |
| 81 | Ga0075430_100011454 | 3300006846 | Bacteria | 7532 |
| 82 | Ga0075430_100018800 | 3300006846 | Bacteria | 5879 |
| 83 | Ga0075431_100027449 | 3300006847 | Bacteria | 5841 |
| 84 | Ga0075431_100044564 | 3300006847 | Bacteria | 4575 |
| 85 | Ga0075431_100052856 | 3300006847 | Bacteria | 4188 |
| 86 | Ga0075433_11750346 | 3300006852 | Bacteria | 535 |
| 87 | Ga0075429_100006279 | 3300006880 | Bacteria | 10285 |
| 88 | Ga0075429_100009117 | 3300006880 | Bacteria | 8612 |
| 89 | Ga0097620_100383172 | 3300006931 | Bacteria | 1501 |
| 90 | Ga0097620_101902857 | 3300006931 | Bacteria | 657 |
| 91 | Ga0099794_10305053 | 3300007265 | Bacteria | 825 |
| 92 | Ga0114129_10039165 | 3300009147 | Bacteria | 6683 |
| 93 | Ga0114129_10124987 | 3300009147 | Bacteria | 3537 |
| 94 | Ga0114129_11259142 | 3300009147 | Bacteria | 919 |
| 95 | Ga0114129_11272416 | 3300009147 | Bacteria | 913 |
| 96 | Ga0114129_11651804 | 3300009147 | Bacteria | 783 |
| 97 | Ga0105243_10039056 | 3300009148 | Bacteria | 3699 |
| 98 | Ga0105243_10648766 | 3300009148 | Bacteria | 1023 |
| 99 | Ga0105243_12160485 | 3300009148 | Bacteria | 593 |
| 100 | Ga0105248_10006939 | 3300009177 | Bacteria | 12410 |
| 101 | Ga0105248_11295847 | 3300009177 | Bacteria | 824 |
| 102 | Ga0105248_12019700 | 3300009177 | Bacteria | 655 |
| 103 | Ga0105237_10003281 | 3300009545 | Bacteria | 19315 |
| 104 | Ga0105237_10003835 | 3300009545 | Bacteria | 17678 |
| 105 | Ga0105237_11189705 | 3300009545 | Bacteria | 769 |
| 106 | Ga0105237_11318084 | 3300009545 | Bacteria | 728 |
| 107 | Ga0105249_10000158 | 3300009553 | Bacteria | 82194 |
| 108 | Ga0105249_10747867 | 3300009553 | Bacteria | 1040 |
| 109 | Ga0105249_11855577 | 3300009553 | Bacteria | 675 |
| 110 | Ga0105239_10004461 | 3300010375 | Bacteria | 16729 |
| 111 | Ga0105239_10032792 | 3300010375 | Bacteria | 5707 |
| 112 | Ga0105239_10132325 | 3300010375 | Bacteria | 2775 |
| 113 | Ga0105239_12849508 | 3300010375 | Bacteria | 564 |
| 114 | Ga0105246_10320449 | 3300011119 | Bacteria | 1259 |
| 115 | Ga0105246_10330478 | 3300011119 | Bacteria | 1242 |
| 116 | Ga0157337_1003498 | 3300012483 | Bacteria | 954 |
| 117 | Ga0157369_10028196 | 3300013105 | Bacteria | 6215 |
| 118 | Ga0157369_10298699 | 3300013105 | Bacteria | 1675 |
| 119 | Ga0157369_10863497 | 3300013105 | Bacteria | 929 |
| 120 | Ga0157374_10952921 | 3300013296 | Bacteria | 877 |
| 121 | Ga0157378_10512995 | 3300013297 | Bacteria | 1199 |
| 122 | Ga0163162_11856040 | 3300013306 | Bacteria | 689 |
| 123 | Ga0157372_10128996 | 3300013307 | Bacteria | 2908 |
| 124 | Ga0157372_10295565 | 3300013307 | Bacteria | 1884 |
| 125 | Ga0157372_10311353 | 3300013307 | Bacteria | 1833 |
| 126 | Ga0157372_10881749 | 3300013307 | Bacteria | 1038 |
| 127 | Ga0157372_11247580 | 3300013307 | Bacteria | 858 |
| 128 | Ga0157372_11384470 | 3300013307 | Bacteria | 811 |
| 129 | Ga0157375_10296944 | 3300013308 | Bacteria | 1779 |
| 130 | Ga0157375_10482520 | 3300013308 | Bacteria | 1404 |
| 131 | Ga0182008_10052972 | 3300014497 | Bacteria | 2010 |
| 132 | Ga0213875_10100082 | 3300021388 | Bacteria | 1353 |
| 133 | Ga0209025_1006137 | 3300025294 | Bacteria | 9468 |
| 134 | Ga0207710_10191822 | 3300025900 | Bacteria | 1006 |
| 135 | Ga0207688_10004942 | 3300025901 | Bacteria | 7257 |
| 136 | Ga0207688_10330394 | 3300025901 | Bacteria | 937 |
| 137 | Ga0207680_10020395 | 3300025903 | Bacteria | 3567 |
| 138 | Ga0207647_10153830 | 3300025904 | Bacteria | 1343 |
| 139 | Ga0207699_10583022 | 3300025906 | Bacteria | 813 |
| 140 | Ga0207643_10049845 | 3300025908 | Bacteria | 2374 |
| 141 | Ga0207684_10042876 | 3300025910 | Bacteria | 3836 |
| 142 | Ga0207684_10850233 | 3300025910 | Bacteria | 769 |
| 143 | Ga0207707_10491970 | 3300025912 | Bacteria | 1047 |
| 144 | Ga0207671_10003414 | 3300025914 | Bacteria | 15879 |
| 145 | Ga0207671_10048514 | 3300025914 | Bacteria | 3143 |
| 146 | Ga0207671_10540459 | 3300025914 | Bacteria | 929 |
| 147 | Ga0207693_10217806 | 3300025915 | Bacteria | 1500 |
| 148 | Ga0207687_10129373 | 3300025927 | Bacteria | 1900 |
| 149 | Ga0207700_10059205 | 3300025928 | Bacteria | 2896 |
| 150 | Ga0207700_10232509 | 3300025928 | Bacteria | 1568 |
| 151 | Ga0207664_10022970 | 3300025929 | Bacteria | 4667 |
| 152 | Ga0207690_10306779 | 3300025932 | Bacteria | 1244 |
| 153 | Ga0207690_10550831 | 3300025932 | Bacteria | 938 |
| 154 | Ga0207706_10183234 | 3300025933 | Bacteria | 1839 |
| 155 | Ga0207709_10255533 | 3300025935 | Bacteria | 1282 |
| 156 | Ga0207670_10309447 | 3300025936 | Bacteria | 1240 |
| 157 | Ga0207670_10385903 | 3300025936 | Bacteria | 1117 |
| 158 | Ga0207711_10001074 | 3300025941 | Bacteria | 26086 |
| 159 | Ga0207661_10202916 | 3300025944 | Bacteria | 1744 |
| 160 | Ga0207667_10143838 | 3300025949 | Bacteria | 2455 |
| 161 | Ga0207712_10001692 | 3300025961 | Bacteria | 14810 |
| 162 | Ga0207712_10684406 | 3300025961 | Bacteria | 894 |
| 163 | Ga0207668_10125165 | 3300025972 | Bacteria | 1953 |
| 164 | Ga0207668_10153548 | 3300025972 | Bacteria | 1785 |
| 165 | Ga0207658_10000255 | 3300025986 | Bacteria | 55438 |
| 166 | Ga0207658_10000502 | 3300025986 | Bacteria | 35835 |
| 167 | Ga0207658_10215693 | 3300025986 | Bacteria | 1611 |
| 168 | Ga0207677_10195233 | 3300026023 | Bacteria | 1604 |
| 169 | Ga0207703_10759734 | 3300026035 | Bacteria | 924 |
| 170 | Ga0207639_10033037 | 3300026041 | Bacteria | 3814 |
| 171 | Ga0207639_10172507 | 3300026041 | Bacteria | 1833 |
| 172 | Ga0207708_10355145 | 3300026075 | Bacteria | 1203 |
| 173 | Ga0207702_10553589 | 3300026078 | Bacteria | 1125 |
| 174 | Ga0207641_11213008 | 3300026088 | Bacteria | 754 |
| 175 | Ga0207676_10674761 | 3300026095 | Bacteria | 999 |
| 176 | Ga0207674_10071819 | 3300026116 | Bacteria | 3477 |
| 177 | Ga0207674_10311528 | 3300026116 | Bacteria | 1523 |
| 178 | Ga0207674_10911415 | 3300026116 | Bacteria | 847 |
| 179 | Ga0268266_10455291 | 3300028379 | Bacteria | 1217 |
| 180 | Ga0268265_10460611 | 3300028380 | Bacteria | 1190 |
| 181 | Ga0268264_11765700 | 3300028381 | Bacteria | 629 |
| 182 | Ga0307515_10001767 | 3300028794 | Bacteria | 48169 |
| 183 | Ga0265770_1069521 | 3300030878 | Bacteria | 669 |
| 184 | Ga0307509_10184257 | 3300031507 | Bacteria | 1948 |
| 185 | Ga0307408_100297797 | 3300031548 | Bacteria | 1350 |
| 186 | Ga0307408_101017990 | 3300031548 | Bacteria | 764 |
| 187 | Ga0307408_101678548 | 3300031548 | Bacteria | 605 |
| 188 | Ga0307508_10364053 | 3300031616 | Bacteria | 1037 |
| 189 | Ga0307405_10101707 | 3300031731 | Bacteria | 1929 |
| 190 | Ga0307405_10421076 | 3300031731 | Bacteria | 1051 |
| 191 | Ga0307410_10014926 | 3300031852 | Bacteria | 4591 |
| 192 | Ga0307410_10045642 | 3300031852 | Bacteria | 2919 |
| 193 | Ga0307410_10161716 | 3300031852 | Bacteria | 1678 |
| 194 | Ga0307410_10527400 | 3300031852 | Bacteria | 975 |
| 195 | Ga0307406_10234162 | 3300031901 | Bacteria | 1373 |
| 196 | Ga0307406_10818815 | 3300031901 | Bacteria | 787 |
| 197 | Ga0307407_10254702 | 3300031903 | Bacteria | 1204 |
| 198 | Ga0307407_10275338 | 3300031903 | Bacteria | 1163 |
| 199 | Ga0307409_100049248 | 3300031995 | Bacteria | 3211 |
| 200 | Ga0307409_100207009 | 3300031995 | Bacteria | 1760 |
| 201 | Ga0307409_100290361 | 3300031995 | Bacteria | 1516 |
| 202 | Ga0307409_100522778 | 3300031995 | Bacteria | 1159 |
| 203 | Ga0307409_100542477 | 3300031995 | Bacteria | 1140 |
| 204 | Ga0307409_101058674 | 3300031995 | Bacteria | 831 |
| 205 | Ga0307416_100000815 | 3300032002 | Bacteria | 16363 |
| 206 | Ga0307416_100013841 | 3300032002 | Bacteria | 5499 |
| 207 | Ga0307416_100113620 | 3300032002 | Bacteria | 2393 |
| 208 | Ga0307416_100469501 | 3300032002 | Bacteria | 1315 |
| 209 | Ga0307416_101038313 | 3300032002 | Bacteria | 923 |
| 210 | Ga0307416_101937834 | 3300032002 | Bacteria | 692 |
| 211 | Ga0307414_10190190 | 3300032004 | Bacteria | 1660 |
| 212 | Ga0307414_10269890 | 3300032004 | Bacteria | 1424 |
| 213 | Ga0307414_10565761 | 3300032004 | Bacteria | 1015 |
| 214 | Ga0307414_10970690 | 3300032004 | Bacteria | 781 |
| 215 | Ga0307411_10062438 | 3300032005 | Bacteria | 2485 |
| 216 | Ga0307411_10115021 | 3300032005 | Bacteria | 1934 |
| 217 | Ga0307411_10367087 | 3300032005 | Bacteria | 1179 |
| 218 | Ga0307415_100000831 | 3300032126 | Bacteria | 14149 |
| 219 | Ga0307415_100068820 | 3300032126 | Bacteria | 2479 |
| 220 | Ga0307415_100070244 | 3300032126 | Bacteria | 2458 |
| 221 | Ga0307415_100297999 | 3300032126 | Bacteria | 1334 |
| 222 | Ga0307415_100898418 | 3300032126 | Bacteria | 816 |
| 223 | Ga0307415_100993652 | 3300032126 | Bacteria | 779 |
| 224 | Ga0307415_101342545 | 3300032126 | Bacteria | 679 |
| 225 | Ga0316214_1021632 | 3300033545 | Bacteria | 901 |
| 226 | Ga0373934_0000056 | 3300035086 | Bacteria | 38785 |
| 227 | Ga0373934_0020293 | 3300035086 | Bacteria | 2553 |
| 228 | Ga0373952_0046214 | 3300035092 | Bacteria | 1023 |
| 229 | Ga0373936_0197239 | 3300035113 | Bacteria | 887 |
| 230 | Ga0373953_0000309 | 3300035117 | Bacteria | 13086 |
| 231 | Ga0373953_0006724 | 3300035117 | Bacteria | 3807 |
| 232 | Ga0373954_0083814 | 3300035118 | Bacteria | 1525 |
| 233 | Ga0373954_0408607 | 3300035118 | Bacteria | 671 |
| 234 | Ga0373956_0003716 | 3300035119 | Bacteria | 6153 |
| 235 | Ga0373956_0011202 | 3300035119 | Bacteria | 3692 |
| 236 | Ga0373957_0000263 | 3300035120 | Bacteria | 13165 |
| 237 | Ga0373957_0016965 | 3300035120 | Bacteria | 2529 |
| 238 | Ga0373943_0096599 | 3300035170 | Bacteria | 1538 |
| 239 | Ga0373943_0898040 | 3300035170 | Bacteria | 529 |
| 240 | Ga0373946_0010541 | 3300035171 | Bacteria | 3422 |
| 241 | Ga0373955_0000050 | 3300035172 | Bacteria | 45664 |
| 242 | Ga0373962_0002136 | 3300035242 | Bacteria | 4716 |
| 243 | Ga0373924_0005896 | 3300035410 | Bacteria | 4368 |
| 244 | Ga0373924_0064615 | 3300035410 | Bacteria | 1536 |
| 245 | Ga0373935_0019521 | 3300035692 | Bacteria | 4133 |
| 246 | Ga0373927_0056271 | 3300035695 | Bacteria | 2542 |
| 247 | Ga0373933_0000149 | 3300035724 | Bacteria | 45676 |
| 248 | Ga0373933_0429195 | 3300035724 | Bacteria | 863 |
| 249 | Ga0373947_0045315 | 3300035725 | Bacteria | 2631 |
| 250 | Ga0373937_0000319 | 3300036401 | Bacteria | 45685 |
| 251 | Ga0373937_0177019 | 3300036401 | Bacteria | 2002 |
| 252 | Ga0373937_0957974 | 3300036401 | Bacteria | 804 |
| 253 | Ga0373925_0009155 | 3300037068 | Bacteria | 7207 |
| 254 | Ga0395899_0497554 | 3300037312 | Bacteria | 791 |
| 255 | Ga0395899_0529993 | 3300037312 | Bacteria | 760 |
| 256 | Ga0395900_0025139 | 3300037418 | Bacteria | 6096 |
| 257 | Ga0395900_0060712 | 3300037418 | Bacteria | 3890 |
| 258 | Ga0395900_0158265 | 3300037418 | Bacteria | 2312 |
| 259 | Ga0395900_0439048 | 3300037418 | Bacteria | 1263 |
| 260 | Ga0395900_0621610 | 3300037418 | Bacteria | 1019 |
| 261 | Ga0395898_0038704 | 3300037466 | Bacteria | 4725 |
| 262 | Ga0395898_0090231 | 3300037466 | Bacteria | 2949 |
| 263 | Ga0395898_0151294 | 3300037466 | Bacteria | 2220 |
| 264 | Ga0395898_0742711 | 3300037466 | Bacteria | 923 |
| 265 | Ga0395898_0992973 | 3300037466 | Bacteria | 775 |
| 266 | Ga0395898_1100528 | 3300037466 | Bacteria | 728 |
| 267 | Ga0395898_1976439 | 3300037466 | Bacteria | 502 |
| 268 | Ga0395905_0227868 | 3300037471 | Bacteria | 1743 |
| 269 | Ga0395905_0412842 | 3300037471 | Bacteria | 1245 |
| 270 | Ga0436364_0686104 | 3300037853 | Bacteria | 2824 |
| 271 | Ga0436364_0978717 | 3300037853 | Bacteria | 704 |
| 272 | Ga0395901_0085421 | 3300038443 | Bacteria | 3299 |
| 273 | Ga0395901_0358880 | 3300038443 | Bacteria | 1503 |
| 274 | Ga0395901_0521255 | 3300038443 | Bacteria | 1207 |
| 275 | Ga0395901_0599298 | 3300038443 | Bacteria | 1111 |
| 276 | Ga0436365_0188410 | 3300039437 | Bacteria | 775 |
| 277 | Ga0436363_1021750 | 3300039450 | Bacteria | 529 |
| 278 | Ga0436363_1124388 | 3300039450 | Bacteria | 1241 |
| 279 | Ga0451789_0959797 | 3300041443 | Bacteria | 512 |
| 280 | Ga0451804_0932012 | 3300041463 | Bacteria | 820 |
| 281 | Ga0439441_184767 | 3300042001 | Bacteria | 503 |
| 282 | Ga0439455_0168417 | 3300042012 | Bacteria | 628 |
| 283 | Ga0439463_036110 | 3300042016 | Bacteria | 1252 |
| 284 | Ga0450903_004758 | 3300042138 | Bacteria | 2299 |
| 285 | Ga0439459_0059552 | 3300042438 | Bacteria | 859 |
| 286 | Ga0439440_0048156 | 3300042993 | Bacteria | 1058 |
| 287 | Ga0439440_0104903 | 3300042993 | Bacteria | 772 |
| 288 | Ga0466969_0157070 | 3300044656 | Bacteria | 1046 |
| 289 | Ga0466972_0298895 | 3300044658 | Bacteria | 752 |
| 290 | Ga0466972_0442200 | 3300044658 | Bacteria | 611 |
| 291 | Ga0466965_0038169 | 3300044683 | Bacteria | 2359 |
| 292 | Ga0466966_0385720 | 3300044684 | Bacteria | 842 |
| 293 | Ga0466966_0389098 | 3300044684 | Bacteria | 838 |
| 294 | Ga0466961_0164309 | 3300044693 | Bacteria | 1383 |
| 295 | Ga0466963_0024741 | 3300044694 | Bacteria | 3823 |
| 296 | Ga0466963_0444829 | 3300044694 | Bacteria | 914 |
| 297 | Ga0466963_0929390 | 3300044694 | Bacteria | 613 |
| 298 | Ga0466963_0959780 | 3300044694 | Bacteria | 602 |
| 299 | Ga0466964_0038943 | 3300044706 | Bacteria | 1913 |
| 300 | Ga0466964_0208900 | 3300044706 | Bacteria | 942 |
| 301 | Ga0466964_0436095 | 3300044706 | Bacteria | 692 |
| 302 | Ga0466964_0475028 | 3300044706 | Bacteria | 667 |
| 303 | Ga0466970_0245719 | 3300044765 | Bacteria | 1002 |
| 304 | Ga0466970_0438580 | 3300044765 | Bacteria | 748 |
| 305 | Ga0466957_0056310 | 3300044842 | Bacteria | 2404 |
| 306 | Ga0466957_0057752 | 3300044842 | Bacteria | 2376 |
| 307 | Ga0466957_0100783 | 3300044842 | Bacteria | 1820 |
| 308 | Ga0466957_0229379 | 3300044842 | Bacteria | 1229 |
| 309 | Ga0466957_1214097 | 3300044842 | Bacteria | 546 |
| 310 | Ga0466960_0035699 | 3300044901 | Bacteria | 2325 |
| 311 | Ga0466960_0037831 | 3300044901 | Bacteria | 2266 |
| 312 | Ga0466960_0073723 | 3300044901 | Bacteria | 1704 |
| 313 | Ga0466960_0189772 | 3300044901 | Bacteria | 1118 |
| 314 | Ga0466960_0223251 | 3300044901 | Bacteria | 1038 |
| 315 | Ga0466960_0223868 | 3300044901 | Bacteria | 1036 |
| 316 | Ga0466960_0369047 | 3300044901 | Bacteria | 822 |
| 317 | Ga0466959_0159917 | 3300045049 | Bacteria | 1584 |
| 318 | Ga0466959_0238415 | 3300045049 | Bacteria | 1257 |
| 319 | Ga0466959_0260890 | 3300045049 | Bacteria | 1193 |
| 320 | Ga0466959_0654620 | 3300045049 | Bacteria | 705 |
| 321 | Ga0466958_0066772 | 3300045836 | Bacteria | 2196 |
| 322 | Ga0466958_0216394 | 3300045836 | Bacteria | 1222 |
| 323 | Ga0466967_0001059 | 3300045976 | Bacteria | 15165 |
| 324 | Ga0466967_0002981 | 3300045976 | Bacteria | 10837 |
| 325 | Ga0466967_0003925 | 3300045976 | Bacteria | 9878 |
| 326 | Ga0466967_0010513 | 3300045976 | Bacteria | 6949 |
| 327 | Ga0466967_0030610 | 3300045976 | Bacteria | 4519 |
| 328 | Ga0466967_0156048 | 3300045976 | Bacteria | 2138 |
| 329 | Ga0466967_0310382 | 3300045976 | Bacteria | 1519 |
| 330 | Ga0466967_0396339 | 3300045976 | Bacteria | 1342 |
| 331 | Ga0466967_0492077 | 3300045976 | Bacteria | 1203 |
| 332 | Ga0466967_1188609 | 3300045976 | Bacteria | 760 |
| 333 | Ga0466967_1368395 | 3300045976 | Bacteria | 705 |
| 334 | Ga0495617_118430 | 3300046452 | Bacteria | 854 |
| 335 | Ga0495592_0000255 | 3300046454 | Bacteria | 45685 |
| 336 | Ga0495603_0000550 | 3300046455 | Bacteria | 20947 |
| 337 | Ga0495603_0009715 | 3300046455 | Bacteria | 5819 |
| 338 | Ga0495603_0036090 | 3300046455 | Bacteria | 2968 |
| 339 | Ga0495603_0707324 | 3300046455 | Bacteria | 576 |
| 340 | Ga0495629_0001975 | 3300046459 | Bacteria | 15979 |
| 341 | Ga0495629_0003408 | 3300046459 | Bacteria | 12027 |
| 342 | Ga0495629_0508081 | 3300046459 | Bacteria | 812 |
| 343 | Ga0495638_0104562 | 3300046460 | Bacteria | 1689 |
| 344 | Ga0495641_0026618 | 3300046461 | Bacteria | 2819 |
| 345 | Ga0495651_0000199 | 3300046462 | Bacteria | 45685 |
| 346 | Ga0495653_0010908 | 3300046463 | Bacteria | 7439 |
| 347 | Ga0495580_0017038 | 3300046472 | Bacteria | 5444 |
| 348 | Ga0495582_0100086 | 3300046473 | Bacteria | 1622 |
| 349 | Ga0495639_0039380 | 3300046475 | Bacteria | 2125 |
| 350 | Ga0495662_0064845 | 3300046476 | Bacteria | 1765 |
| 351 | Ga0495664_0038694 | 3300046477 | Bacteria | 2816 |
| 352 | Ga0495664_0052566 | 3300046477 | Bacteria | 2421 |
| 353 | Ga0495594_0001353 | 3300046499 | Bacteria | 12719 |
| 354 | Ga0495594_0012361 | 3300046499 | Bacteria | 4447 |
| 355 | Ga0495594_0061282 | 3300046499 | Bacteria | 2082 |
| 356 | Ga0495596_0388172 | 3300046500 | Bacteria | 544 |
| 357 | Ga0495607_0126401 | 3300046501 | Bacteria | 1336 |
| 358 | Ga0495583_0062146 | 3300046506 | Bacteria | 1664 |
| 359 | Ga0495608_0001171 | 3300046511 | Bacteria | 18587 |
| 360 | Ga0495608_0093930 | 3300046511 | Bacteria | 1937 |
| 361 | Ga0495618_0137865 | 3300046514 | Bacteria | 1560 |
| 362 | Ga0495628_0000282 | 3300046516 | Bacteria | 45645 |
| 363 | Ga0495630_0411024 | 3300046517 | Bacteria | 1037 |
| 364 | Ga0495630_0429988 | 3300046517 | Bacteria | 1011 |
| 365 | Ga0495631_0209531 | 3300046518 | Bacteria | 833 |
| 366 | Ga0495643_0344285 | 3300046522 | Bacteria | 669 |
| 367 | Ga0495648_0002385 | 3300046524 | Bacteria | 17443 |
| 368 | Ga0495642_0241457 | 3300046528 | Bacteria | 789 |
| 369 | Ga0495652_0002623 | 3300046529 | Bacteria | 18356 |
| 370 | Ga0495652_0272412 | 3300046529 | Bacteria | 1243 |
| 371 | Ga0495654_0154269 | 3300046530 | Bacteria | 1013 |
| 372 | Ga0495665_0016094 | 3300046531 | Bacteria | 4029 |
| 373 | Ga0495665_0200947 | 3300046531 | Bacteria | 1033 |
| 374 | Ga0495665_0245957 | 3300046531 | Bacteria | 921 |
| 375 | Ga0495587_0000189 | 3300046536 | Bacteria | 45681 |
| 376 | Ga0495645_0072661 | 3300046543 | Bacteria | 2478 |
| 377 | Ga0495645_0177067 | 3300046543 | Bacteria | 1464 |
| 378 | Ga0495633_0071662 | 3300046558 | Bacteria | 1616 |
| 379 | Ga0495667_0000136 | 3300046559 | Bacteria | 50731 |
| 380 | Ga0495667_0031636 | 3300046559 | Bacteria | 3549 |
| 381 | Ga0495668_0014484 | 3300046616 | Bacteria | 4623 |
| 382 | Ga0495634_0196880 | 3300046642 | Bacteria | 1253 |
| 383 | Ga0495635_0159568 | 3300046663 | Bacteria | 1534 |
| 384 | Ga0495659_0310752 | 3300046664 | Bacteria | 668 |
| 385 | Ga0495659_0500420 | 3300046664 | Bacteria | 533 |
| 386 | Ga0495659_0555931 | 3300046664 | Bacteria | 506 |
| 387 | Ga0495661_0196239 | 3300046665 | Bacteria | 1060 |
| 388 | Ga0495588_0015689 | 3300046674 | Bacteria | 3651 |
| 389 | Ga0495588_0125537 | 3300046674 | Bacteria | 1353 |
| 390 | Ga0495588_0172842 | 3300046674 | Bacteria | 1142 |
| 391 | Ga0495657_0000290 | 3300046675 | Bacteria | 45685 |
| 392 | Ga0495599_0000676 | 3300046678 | Bacteria | 19312 |
| 393 | Ga0495599_0121476 | 3300046678 | Bacteria | 1623 |
| 394 | Ga0495623_0002482 | 3300046679 | Bacteria | 12231 |
| 395 | Ga0495623_0047070 | 3300046679 | Bacteria | 2737 |
| 396 | Ga0495646_0024101 | 3300046680 | Bacteria | 3832 |
| 397 | Ga0495646_0028819 | 3300046680 | Bacteria | 3473 |
| 398 | Ga0495658_0057220 | 3300046683 | Bacteria | 2226 |
| 399 | Ga0495669_0002865 | 3300046684 | Bacteria | 7075 |
| 400 | Ga0495613_0130140 | 3300046689 | Bacteria | 1802 |
| 401 | Ga0495624_0045742 | 3300046690 | Bacteria | 2785 |
| 402 | Ga0495670_0002672 | 3300046691 | Bacteria | 8801 |
| 403 | Ga0495670_0026483 | 3300046691 | Bacteria | 2870 |
| 404 | Ga0495671_0100396 | 3300046692 | Bacteria | 1415 |
| 405 | Ga0495589_0096022 | 3300046794 | Bacteria | 1437 |
| 406 | Ga0495589_0122363 | 3300046794 | Bacteria | 1252 |
| 407 | Ga0495589_0174270 | 3300046794 | Bacteria | 1022 |
| 408 | Ga0495600_0004743 | 3300046809 | Bacteria | 8156 |
| 409 | Ga0495600_0053994 | 3300046809 | Bacteria | 2624 |
| 410 | Ga0495581_0006043 | 3300047315 | Bacteria | 7017 |
| 411 | Ga0495581_0101454 | 3300047315 | Bacteria | 1672 |
| 412 | Ga0495604_0000280 | 3300047317 | Bacteria | 45685 |
| 413 | Ga0495604_0141334 | 3300047317 | Bacteria | 1719 |
| 414 | Ga0495636_0282957 | 3300047318 | Bacteria | 773 |
| 415 | Ga0495636_0335831 | 3300047318 | Bacteria | 711 |
| 416 | Ga0495674_0145394 | 3300047319 | Bacteria | 1990 |
| 417 | Ga0495672_0004058 | 3300047320 | Bacteria | 12221 |
| 418 | Ga0495672_0008155 | 3300047320 | Bacteria | 7772 |
| 419 | Ga0495676_0004019 | 3300047321 | Bacteria | 13389 |
| 420 | Ga0495676_0005888 | 3300047321 | Bacteria | 11254 |
| 421 | Ga0495676_0009607 | 3300047321 | Bacteria | 8805 |
| 422 | Ga0495676_0394140 | 3300047321 | Bacteria | 920 |
| 423 | Ga0495676_0427719 | 3300047321 | Bacteria | 876 |
| 424 | Ga0495680_0000430 | 3300047322 | Bacteria | 47076 |
| 425 | Ga0495683_0045770 | 3300047323 | Bacteria | 2198 |
| 426 | Ga0495675_0000347 | 3300047444 | Bacteria | 32584 |
| 427 | Ga0495675_0021589 | 3300047444 | Bacteria | 4101 |
| 428 | Ga0495677_0430329 | 3300047445 | Bacteria | 523 |
| 429 | Ga0495685_042549 | 3300047447 | Bacteria | 1550 |
| 430 | Ga0495673_0002967 | 3300047469 | Bacteria | 11433 |
| 431 | Ga0495684_0120685 | 3300047471 | Bacteria | 1974 |
| 432 | Ga0495686_0001693 | 3300047472 | Bacteria | 22821 |
| 433 | Ga0495593_0202494 | 3300047673 | Bacteria | 997 |
| 434 | Ga0495602_0000297 | 3300048088 | Bacteria | 45689 |
| 435 | Ga0495602_0050303 | 3300048088 | Bacteria | 3724 |
| 436 | Ga0495614_0002695 | 3300048089 | Bacteria | 7888 |
| 437 | Ga0496100_0000067 | 3300048903 | Bacteria | 58703 |
| 438 | Ga0496100_0002909 | 3300048903 | Bacteria | 8789 |
| 439 | Ga0496100_0046449 | 3300048903 | Bacteria | 2792 |
| 440 | Ga0496100_0177743 | 3300048903 | Bacteria | 1537 |
| 441 | Ga0496101_0000019 | 3300048904 | Bacteria | 220382 |
| 442 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 443 | Ga0496101_0008278 | 3300048904 | Bacteria | 6793 |
| 444 | Ga0496102_0000007 | 3300048905 | Bacteria | 417224 |
| 445 | Ga0496102_0006394 | 3300048905 | Bacteria | 10042 |
| 446 | Ga0496102_0006622 | 3300048905 | Bacteria | 9899 |
| 447 | Ga0496102_0117849 | 3300048905 | Bacteria | 2478 |
| 448 | Ga0496102_0145474 | 3300048905 | Bacteria | 2224 |
| 449 | Ga0496102_0192889 | 3300048905 | Bacteria | 1920 |
| 450 | Ga0496102_0202042 | 3300048905 | Bacteria | 1873 |
| 451 | Ga0496103_0000013 | 3300048906 | Bacteria | 297928 |
| 452 | Ga0496103_0001890 | 3300048906 | Bacteria | 13618 |
| 453 | Ga0496103_0041337 | 3300048906 | Bacteria | 2834 |
| 454 | Ga0496103_0090849 | 3300048906 | Bacteria | 1926 |
| 455 | Ga0496103_0246162 | 3300048906 | Bacteria | 1150 |
| 456 | Ga0496104_0162218 | 3300048907 | Bacteria | 2144 |
| 457 | Ga0496104_0342200 | 3300048907 | Bacteria | 1409 |
| 458 | Ga0496105_0274069 | 3300048908 | Bacteria | 1362 |
| 459 | Ga0496105_0531857 | 3300048908 | Bacteria | 920 |
| 460 | Ga0496105_0646913 | 3300048908 | Bacteria | 816 |
| 461 | Ga0496105_0764609 | 3300048908 | Bacteria | 737 |
| 462 | Ga0496106_0003289 | 3300048909 | Bacteria | 12074 |
| 463 | Ga0496106_0028565 | 3300048909 | Bacteria | 4155 |
| 464 | Ga0496106_0092809 | 3300048909 | Bacteria | 2332 |
| 465 | Ga0496106_0190484 | 3300048909 | Bacteria | 1630 |
| 466 | Ga0496107_0004793 | 3300048910 | Bacteria | 9187 |
| 467 | Ga0496107_0018178 | 3300048910 | Bacteria | 4947 |
| 468 | Ga0496107_0121731 | 3300048910 | Bacteria | 1922 |
| 469 | Ga0496107_0246474 | 3300048910 | Bacteria | 1329 |
| 470 | Ga0496108_0004506 | 3300048911 | Bacteria | 11223 |
| 471 | Ga0496108_0027387 | 3300048911 | Bacteria | 4706 |
| 472 | Ga0496108_0663719 | 3300048911 | Bacteria | 906 |
| 473 | Ga0496108_0868713 | 3300048911 | Bacteria | 775 |
| 474 | Ga0496108_1133390 | 3300048911 | Bacteria | 663 |
| 475 | Ga0496109_0000159 | 3300048912 | Bacteria | 66124 |
| 476 | Ga0496109_0000667 | 3300048912 | Bacteria | 28438 |
| 477 | Ga0496109_0015932 | 3300048912 | Bacteria | 6566 |
| 478 | Ga0496109_0516785 | 3300048912 | Bacteria | 1127 |
| 479 | Ga0496110_0068018 | 3300048913 | Bacteria | 3152 |
| 480 | Ga0496110_0072941 | 3300048913 | Bacteria | 3046 |
| 481 | Ga0496110_0380277 | 3300048913 | Bacteria | 1287 |
| 482 | Ga0496110_0479442 | 3300048913 | Bacteria | 1133 |
| 483 | Ga0496110_0723779 | 3300048913 | Bacteria | 897 |
| 484 | Ga0496111_0026328 | 3300048914 | Bacteria | 4106 |
| 485 | Ga0496111_0123849 | 3300048914 | Bacteria | 1910 |
| 486 | Ga0496111_0127288 | 3300048914 | Bacteria | 1883 |
| 487 | Ga0496112_0297157 | 3300048915 | Bacteria | 1561 |
| 488 | Ga0496112_0339660 | 3300048915 | Bacteria | 1445 |
| 489 | Ga0496112_1352863 | 3300048915 | Bacteria | 627 |
| 490 | Ga0496113_0162263 | 3300048916 | Bacteria | 1767 |
| 491 | Ga0496113_0166959 | 3300048916 | Bacteria | 1742 |
| 492 | Ga0496113_0228606 | 3300048916 | Bacteria | 1483 |
| 493 | Ga0496114_0002664 | 3300048917 | Bacteria | 13626 |
| 494 | Ga0496114_0107386 | 3300048917 | Bacteria | 2389 |
| 495 | Ga0496114_0130811 | 3300048917 | Bacteria | 2167 |
| 496 | Ga0496114_0275916 | 3300048917 | Bacteria | 1482 |
| 497 | Ga0496114_0287177 | 3300048917 | Bacteria | 1451 |
| 498 | Ga0496114_0784164 | 3300048917 | Bacteria | 831 |
| 499 | Ga0496115_0618562 | 3300048918 | Bacteria | 859 |
| 500 | Ga0496116_0000033 | 3300048919 | Bacteria | 418191 |
| 501 | Ga0496116_0002510 | 3300048919 | Bacteria | 19213 |
| 502 | Ga0496117_0000025 | 3300048920 | Bacteria | 418106 |
| 503 | Ga0496117_0000738 | 3300048920 | Bacteria | 51389 |
| 504 | Ga0496117_0031052 | 3300048920 | Bacteria | 4086 |
| 505 | Ga0496118_0000023 | 3300048921 | Bacteria | 418106 |
| 506 | Ga0496118_0000222 | 3300048921 | Bacteria | 99509 |
| 507 | Ga0496118_0002673 | 3300048921 | Bacteria | 23562 |
| 508 | Ga0496118_0028057 | 3300048921 | Bacteria | 4749 |
| 509 | Ga0496118_0052738 | 3300048921 | Bacteria | 3099 |
| 510 | Ga0496119_0000512 | 3300048922 | Bacteria | 52761 |
| 511 | Ga0496119_0001355 | 3300048922 | Bacteria | 29948 |
| 512 | Ga0496119_0035065 | 3300048922 | Bacteria | 3293 |
| 513 | Ga0496119_0158389 | 3300048922 | Bacteria | 1206 |
| 514 | Ga0496120_0000382 | 3300048923 | Bacteria | 71535 |
| 515 | Ga0496120_0037251 | 3300048923 | Bacteria | 2888 |
| 516 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 517 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 518 | Ga0496122_0000126 | 3300048925 | Bacteria | 178362 |
| 519 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 520 | Ga0496123_0002656 | 3300048926 | Bacteria | 21612 |
| 521 | Ga0496123_0021516 | 3300048926 | Bacteria | 5009 |
| 522 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 523 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 524 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 525 | Ga0496126_0002371 | 3300048929 | Bacteria | 25680 |
| 526 | Ga0496126_0005034 | 3300048929 | Bacteria | 15369 |
| 527 | Ga0496126_0200594 | 3300048929 | Bacteria | 1685 |
| 528 | Ga0496126_0226032 | 3300048929 | Bacteria | 1570 |
| 529 | Ga0501033_0036710 | 3300049570 | Bacteria | 3671 |
| 530 | Ga0501033_0388939 | 3300049570 | Bacteria | 974 |
| 531 | Ga0501036_0702000 | 3300049572 | Bacteria | 836 |
| 532 | Ga0501036_1198961 | 3300049572 | Bacteria | 619 |
| 533 | Ga0501038_0404148 | 3300049574 | Bacteria | 1056 |
| 534 | Ga0501038_0747576 | 3300049574 | Bacteria | 730 |
| 535 | Ga0501039_0312370 | 3300049575 | Bacteria | 1236 |
| 536 | Ga0501039_0354897 | 3300049575 | Bacteria | 1152 |
| 537 | Ga0501040_0323804 | 3300049576 | Bacteria | 1103 |
| 538 | Ga0501040_1382564 | 3300049576 | Bacteria | 511 |
| 539 | Ga0501041_0038998 | 3300049577 | Bacteria | 2882 |
| 540 | Ga0501042_0161009 | 3300049578 | Bacteria | 1619 |
| 541 | Ga0501042_0656242 | 3300049578 | Bacteria | 763 |
| 542 | Ga0501047_0022525 | 3300049581 | Bacteria | 6050 |
| 543 | Ga0501047_0123709 | 3300049581 | Bacteria | 2467 |
| 544 | Ga0501048_0194631 | 3300049582 | Bacteria | 1437 |
| 545 | Ga0501048_0538296 | 3300049582 | Bacteria | 838 |
| 546 | Ga0501067_0017474 | 3300049583 | Bacteria | 3967 |
| 547 | Ga0501067_0033673 | 3300049583 | Bacteria | 2842 |
| 548 | Ga0501068_0077444 | 3300049584 | Bacteria | 2036 |
| 549 | Ga0501068_0149607 | 3300049584 | Bacteria | 1467 |
| 550 | Ga0501069_0112835 | 3300049585 | Bacteria | 1549 |
| 551 | Ga0501069_0165879 | 3300049585 | Bacteria | 1273 |
| 552 | Ga0501070_0435513 | 3300049586 | Bacteria | 1058 |
| 553 | Ga0501071_0229096 | 3300049587 | Bacteria | 1400 |
| 554 | Ga0501072_0061383 | 3300049588 | Bacteria | 2965 |
| 555 | Ga0501072_0666156 | 3300049588 | Bacteria | 819 |
| 556 | Ga0501072_1131878 | 3300049588 | Bacteria | 609 |
| 557 | Ga0501074_0073126 | 3300049590 | Bacteria | 2463 |
| 558 | Ga0501221_176816 | 3300049704 | Bacteria | 581 |
| 559 | Ga0501234_102737 | 3300049707 | Bacteria | 521 |
| 560 | Ga0501079_0632779 | 3300049741 | Bacteria | 842 |
| 561 | Ga0501080_0009244 | 3300049742 | Bacteria | 8984 |
| 562 | Ga0501083_1095695 | 3300049744 | Bacteria | 518 |
| 563 | Ga0501035_0412620 | 3300049822 | Bacteria | 1122 |
| 564 | Ga0501044_0066437 | 3300049823 | Bacteria | 3677 |
| 565 | Ga0501045_0454466 | 3300049824 | Bacteria | 952 |
| 566 | Ga0501045_0984617 | 3300049824 | Bacteria | 618 |
| 567 | nmdc:mga06z11_199538_c1 | 3300050494 | Bacteria | 1161 |
| 568 | nmdc:mga05p37_1161515_c1 | 3300050507 | Bacteria | 802 |
| 569 | nmdc:mga05p37_24150_c1 | 3300050507 | Bacteria | 7385 |
| 570 | nmdc:mga05p37_81702_c1 | 3300050507 | Bacteria | 3981 |
| 571 | nmdc:mga09592_1296365_c1 | 3300050508 | Bacteria | 599 |
| 572 | nmdc:mga09592_22160_c1 | 3300050508 | Bacteria | 5242 |
| 573 | nmdc:mga0qj67_17465_c1 | 3300050509 | Bacteria | 5455 |
| 574 | nmdc:mga0qj67_4976_c1 | 3300050509 | Bacteria | 9657 |
| 575 | nmdc:mga06r32_37973_c1 | 3300050510 | Bacteria | 4559 |
| 576 | nmdc:mga06r32_6314_c1 | 3300050510 | Bacteria | 10644 |
| 577 | nmdc:mga08y16_1177672_c1 | 3300050511 | Bacteria | 738 |
| 578 | nmdc:mga0n895_556797_c1 | 3300050512 | Bacteria | 1152 |
| 579 | nmdc:mga0sz30_115007_c1 | 3300050516 | Bacteria | 1180 |
| 580 | Ga0495601_0034611 | 3300053077 | Bacteria | 3152 |
| 581 | Ga0495601_0303231 | 3300053077 | Bacteria | 1040 |
| 582 | Ga0495612_0005080 | 3300053078 | Bacteria | 5449 |
| 583 | Ga0495619_0207222 | 3300053085 | Bacteria | 1357 |
| 584 | Ga0495619_0604320 | 3300053085 | Bacteria | 750 |
| 585 | Ga0500643_001928 | 3300053087 | Bacteria | 11259 |
| 586 | Ga0500644_0049411 | 3300053088 | Bacteria | 1435 |
| 587 | Ga0500556_0000251 | 3300053104 | Bacteria | 43573 |
| 588 | Ga0500597_015966 | 3300053120 | Bacteria | 2851 |
| 589 | Ga0500577_0186471 | 3300053142 | Bacteria | 891 |
| 590 | Ga0500616_0403194 | 3300053153 | Bacteria | 546 |
| 591 | Ga0501084_0635002 | 3300054114 | Bacteria | 902 |
| 592 | Ga0501084_0929631 | 3300054114 | Bacteria | 731 |
| 593 | Ga0587073_0123235 | 3300059492 | Bacteria | 702 |
| 594 | Ga0501082_0799174 | 3300060353 | Bacteria | 825 |
| 595 | Ga0530510_0146492 | 3300061734 | Bacteria | 1742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10183234 | Ga0207706_101832342 | 105 |
| 2 | 3300050508 | nmdc:mga09592_1296365_c1 | nmdc:mga09592_1296365_c1_200_556 | 117 |
| 3 | 3300046531 | Ga0495665_0200947 | Ga0495665_0200947_323_733 | 126 |
| 4 | 3300048905 | Ga0496102_0117849 | Ga0496102_0117849_55_441 | 127 |
| 5 | 3300048906 | Ga0496103_0246162 | Ga0496103_0246162_428_814 | 127 |
| 6 | 3300048921 | Ga0496118_0000222 | Ga0496118_0000222_89334_89720 | 127 |
| 7 | 3300053153 | Ga0500616_0403194 | Ga0500616_0403194_86_496 | 127 |
| 8 | 3300032126 | Ga0307415_100898418 | Ga0307415_1008984182 | 129 |
| 9 | iso_pu_bacteria | 2558860112 | 2558908087 | 131 |
| 10 | iso_pu_bacteria | 2585428094 | 2587861856 | 131 |
| 11 | iso_pu_bacteria | 2643221961 | 2645719661 | 131 |
| 12 | iso_pu_bacteria | 2643221962 | 2645726553 | 131 |
| 13 | iso_pu_bacteria | 2744054611 | 2744954416 | 131 |
| 14 | iso_pu_bacteria | 2751185734 | 2753073454 | 131 |
| 15 | iso_pu_bacteria | 2775506925 | 2776372609 | 131 |
| 16 | iso_pu_bacteria | 2818991463 | 2819697185 | 131 |
| 17 | iso_pu_bacteria | 2837268691 | 2837272870 | 131 |
| 18 | iso_pu_bacteria | 2839986021 | 2839988532 | 131 |
| 19 | iso_pu_bacteria | 2852646457 | 2852647210 | 131 |
| 20 | iso_pu_bacteria | 2856858025 | 2856862890 | 131 |
| 21 | iso_pu_bacteria | 2862574272 | 2862581501 | 131 |
| 22 | iso_pu_bacteria | 2863067949 | 2863073910 | 131 |
| 23 | iso_pu_bacteria | 2867302475 | 2867306256 | 131 |
| 24 | iso_pu_bacteria | 2870721527 | 2870721737 | 131 |
| 25 | iso_pu_bacteria | 2884994152 | 2884995951 | 131 |
| 26 | iso_pu_bacteria | 2899359706 | 2899364937 | 131 |
| 27 | iso_pu_bacteria | 2902792274 | 2902797768 | 131 |
| 28 | iso_pu_bacteria | 2945968032 | 2945971671 | 131 |
| 29 | iso_pu_bacteria | 2990088156 | 2990088864 | 131 |
| 30 | iso_pu_bacteria | 649633069 | 649815334 | 131 |
| 31 | 3300005335 | Ga0070666_10030503 | Ga0070666_100305034 | 134 |
| 32 | 3300005367 | Ga0070667_100008940 | Ga0070667_1000089409 | 134 |
| 33 | 3300005842 | Ga0068858_100721459 | Ga0068858_1007214592 | 134 |
| 34 | 3300009553 | Ga0105249_11855577 | Ga0105249_118555772 | 134 |
| 35 | 3300025903 | Ga0207680_10020395 | Ga0207680_100203954 | 134 |
| 36 | 3300025986 | Ga0207658_10000502 | Ga0207658_100005028 | 134 |
| 37 | 3300026035 | Ga0207703_10759734 | Ga0207703_107597342 | 134 |
| 38 | 3300031852 | Ga0307410_10161716 | Ga0307410_101617162 | 134 |
| 39 | 3300031901 | Ga0307406_10234162 | Ga0307406_102341622 | 134 |
| 40 | 3300031903 | Ga0307407_10275338 | Ga0307407_102753382 | 134 |
| 41 | 3300031995 | Ga0307409_100290361 | Ga0307409_1002903612 | 134 |
| 42 | 3300032126 | Ga0307415_100070244 | Ga0307415_1000702441 | 134 |
| 43 | 3300035242 | Ga0373962_0002136 | Ga0373962_0002136_996_1403 | 134 |
| 44 | 3300044658 | Ga0466972_0298895 | Ga0466972_0298895_66_473 | 134 |
| 45 | 3300044765 | Ga0466970_0438580 | Ga0466970_0438580_84_491 | 134 |
| 46 | 3300044901 | Ga0466960_0037831 | Ga0466960_0037831_1825_2232 | 134 |
| 47 | 3300045976 | Ga0466967_0310382 | Ga0466967_0310382_122_529 | 134 |
| 48 | 3300048903 | Ga0496100_0000067 | Ga0496100_0000067_2375_2782 | 134 |
| 49 | 3300048904 | Ga0496101_0000099 | Ga0496101_0000099_67005_67412 | 134 |
| 50 | 3300048905 | Ga0496102_0006622 | Ga0496102_0006622_3987_4394 | 134 |
| 51 | 3300048906 | Ga0496103_0001890 | Ga0496103_0001890_7505_7912 | 134 |
| 52 | 3300048907 | Ga0496104_0342200 | Ga0496104_0342200_182_589 | 134 |
| 53 | 3300048908 | Ga0496105_0764609 | Ga0496105_0764609_310_717 | 134 |
| 54 | 3300048909 | Ga0496106_0003289 | Ga0496106_0003289_3032_3439 | 134 |
| 55 | 3300048910 | Ga0496107_0004793 | Ga0496107_0004793_1933_2340 | 134 |
| 56 | 3300048911 | Ga0496108_0004506 | Ga0496108_0004506_9229_9636 | 134 |
| 57 | 3300048912 | Ga0496109_0000159 | Ga0496109_0000159_56320_56727 | 134 |
| 58 | 3300048913 | Ga0496110_0068018 | Ga0496110_0068018_298_705 | 134 |
| 59 | 3300048914 | Ga0496111_0026328 | Ga0496111_0026328_1593_2000 | 134 |
| 60 | 3300048917 | Ga0496114_0002664 | Ga0496114_0002664_1269_1676 | 134 |
| 61 | 3300048919 | Ga0496116_0002510 | Ga0496116_0002510_690_1097 | 134 |
| 62 | 3300048920 | Ga0496117_0031052 | Ga0496117_0031052_516_923 | 134 |
| 63 | 3300048921 | Ga0496118_0028057 | Ga0496118_0028057_1179_1586 | 134 |
| 64 | 3300048922 | Ga0496119_0035065 | Ga0496119_0035065_1003_1410 | 134 |
| 65 | 3300048923 | Ga0496120_0037251 | Ga0496120_0037251_475_882 | 134 |
| 66 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_310968_311375 | 134 |
| 67 | 3300048925 | Ga0496122_0000284 | Ga0496122_0000284_24887_25294 | 134 |
| 68 | 3300048926 | Ga0496123_0021516 | Ga0496123_0021516_1768_2175 | 134 |
| 69 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_67015_67422 | 134 |
| 70 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_393279_393686 | 134 |
| 71 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_393279_393686 | 134 |
| 72 | 3300053088 | Ga0500644_0049411 | Ga0500644_0049411_372_779 | 134 |
| 73 | 3300053104 | Ga0500556_0000251 | Ga0500556_0000251_4434_4844 | 134 |
| 74 | iso_pu_bacteria | 2501939600 | 2501942030 | 134 |
| 75 | iso_pu_bacteria | 2671180195 | 2671832551 | 134 |
| 76 | iso_pu_bacteria | 2773857922 | 2774850707 | 134 |
| 77 | 3300001979 | JGI24740J21852_10022183 | JGI24740J21852_100221832 | 135 |
| 78 | 3300001989 | JGI24739J22299_10022390 | JGI24739J22299_100223905 | 135 |
| 79 | 3300001990 | JGI24737J22298_10008513 | JGI24737J22298_100085132 | 135 |
| 80 | 3300002067 | JGI24735J21928_10039291 | JGI24735J21928_100392912 | 135 |
| 81 | 3300005329 | Ga0070683_100092811 | Ga0070683_1000928114 | 135 |
| 82 | 3300005331 | Ga0070670_100937807 | Ga0070670_1009378072 | 135 |
| 83 | 3300005337 | Ga0070682_100046502 | Ga0070682_1000465023 | 135 |
| 84 | 3300005337 | Ga0070682_100080103 | Ga0070682_1000801031 | 135 |
| 85 | 3300005338 | Ga0068868_100210515 | Ga0068868_1002105151 | 135 |
| 86 | 3300005339 | Ga0070660_101778576 | Ga0070660_1017785761 | 135 |
| 87 | 3300005340 | Ga0070689_100151079 | Ga0070689_1001510791 | 135 |
| 88 | 3300005343 | Ga0070687_100239114 | Ga0070687_1002391142 | 135 |
| 89 | 3300005344 | Ga0070661_100110992 | Ga0070661_1001109923 | 135 |
| 90 | 3300005347 | Ga0070668_100161665 | Ga0070668_1001616652 | 135 |
| 91 | 3300005354 | Ga0070675_100562358 | Ga0070675_1005623582 | 135 |
| 92 | 3300005364 | Ga0070673_100444172 | Ga0070673_1004441722 | 135 |
| 93 | 3300005365 | Ga0070688_100238071 | Ga0070688_1002380712 | 135 |
| 94 | 3300005367 | Ga0070667_100000090 | Ga0070667_10000009082 | 135 |
| 95 | 3300005367 | Ga0070667_100036825 | Ga0070667_1000368254 | 135 |
| 96 | 3300005434 | Ga0070709_10177983 | Ga0070709_101779832 | 135 |
| 97 | 3300005435 | Ga0070714_100010010 | Ga0070714_1000100106 | 135 |
| 98 | 3300005435 | Ga0070714_100031176 | Ga0070714_1000311763 | 135 |
| 99 | 3300005436 | Ga0070713_100030439 | Ga0070713_1000304394 | 135 |
| 100 | 3300005445 | Ga0070708_101203933 | Ga0070708_1012039331 | 135 |
| 101 | 3300005457 | Ga0070662_100797673 | Ga0070662_1007976732 | 135 |
| 102 | 3300005467 | Ga0070706_100004234 | Ga0070706_10000423415 | 135 |
| 103 | 3300005467 | Ga0070706_100804318 | Ga0070706_1008043182 | 135 |
| 104 | 3300005471 | Ga0070698_100001915 | Ga0070698_10000191518 | 135 |
| 105 | 3300005471 | Ga0070698_100208713 | Ga0070698_1002087132 | 135 |
| 106 | 3300005539 | Ga0068853_100079398 | Ga0068853_1000793983 | 135 |
| 107 | 3300005539 | Ga0068853_101153332 | Ga0068853_1011533322 | 135 |
| 108 | 3300005548 | Ga0070665_100184717 | Ga0070665_1001847173 | 135 |
| 109 | 3300005563 | Ga0068855_100168815 | Ga0068855_1001688152 | 135 |
| 110 | 3300005615 | Ga0070702_100568293 | Ga0070702_1005682932 | 135 |
| 111 | 3300005617 | Ga0068859_100383154 | Ga0068859_1003831542 | 135 |
| 112 | 3300005840 | Ga0068870_10156471 | Ga0068870_101564712 | 135 |
| 113 | 3300005843 | Ga0068860_102121369 | Ga0068860_1021213692 | 135 |
| 114 | 3300005981 | Ga0081538_10059237 | Ga0081538_100592372 | 135 |
| 115 | 3300005981 | Ga0081538_10293091 | Ga0081538_102930911 | 135 |
| 116 | 3300005985 | Ga0081539_10000595 | Ga0081539_1000059512 | 135 |
| 117 | 3300006028 | Ga0070717_10003502 | Ga0070717_100035024 | 135 |
| 118 | 3300006028 | Ga0070717_10137140 | Ga0070717_101371402 | 135 |
| 119 | 3300006173 | Ga0070716_100812576 | Ga0070716_1008125762 | 135 |
| 120 | 3300006175 | Ga0070712_100332323 | Ga0070712_1003323232 | 135 |
| 121 | 3300006178 | Ga0075367_10387047 | Ga0075367_103870472 | 135 |
| 122 | 3300006186 | Ga0075369_10197448 | Ga0075369_101974482 | 135 |
| 123 | 3300006844 | Ga0075428_100018460 | Ga0075428_1000184606 | 135 |
| 124 | 3300006844 | Ga0075428_100078647 | Ga0075428_1000786472 | 135 |
| 125 | 3300006844 | Ga0075428_101097106 | Ga0075428_1010971062 | 135 |
| 126 | 3300006846 | Ga0075430_100011454 | Ga0075430_1000114546 | 135 |
| 127 | 3300006846 | Ga0075430_100018800 | Ga0075430_1000188007 | 135 |
| 128 | 3300006847 | Ga0075431_100027449 | Ga0075431_1000274492 | 135 |
| 129 | 3300006847 | Ga0075431_100044564 | Ga0075431_1000445645 | 135 |
| 130 | 3300006847 | Ga0075431_100052856 | Ga0075431_1000528566 | 135 |
| 131 | 3300006880 | Ga0075429_100006279 | Ga0075429_1000062798 | 135 |
| 132 | 3300006880 | Ga0075429_100009117 | Ga0075429_1000091173 | 135 |
| 133 | 3300006931 | Ga0097620_100383172 | Ga0097620_1003831722 | 135 |
| 134 | 3300006931 | Ga0097620_101902857 | Ga0097620_1019028571 | 135 |
| 135 | 3300007265 | Ga0099794_10305053 | Ga0099794_103050532 | 135 |
| 136 | 3300009147 | Ga0114129_10039165 | Ga0114129_100391654 | 135 |
| 137 | 3300009147 | Ga0114129_10124987 | Ga0114129_101249873 | 135 |
| 138 | 3300009147 | Ga0114129_11259142 | Ga0114129_112591421 | 135 |
| 139 | 3300009147 | Ga0114129_11651804 | Ga0114129_116518042 | 135 |
| 140 | 3300009148 | Ga0105243_10039056 | Ga0105243_100390564 | 135 |
| 141 | 3300009148 | Ga0105243_10648766 | Ga0105243_106487662 | 135 |
| 142 | 3300009148 | Ga0105243_12160485 | Ga0105243_121604851 | 135 |
| 143 | 3300009177 | Ga0105248_10006939 | Ga0105248_100069396 | 135 |
| 144 | 3300009177 | Ga0105248_11295847 | Ga0105248_112958471 | 135 |
| 145 | 3300009177 | Ga0105248_12019700 | Ga0105248_120197002 | 135 |
| 146 | 3300009545 | Ga0105237_10003281 | Ga0105237_100032815 | 135 |
| 147 | 3300009545 | Ga0105237_10003835 | Ga0105237_100038355 | 135 |
| 148 | 3300009545 | Ga0105237_11189705 | Ga0105237_111897052 | 135 |
| 149 | 3300009545 | Ga0105237_11318084 | Ga0105237_113180842 | 135 |
| 150 | 3300009553 | Ga0105249_10000158 | Ga0105249_1000015810 | 135 |
| 151 | 3300009553 | Ga0105249_10747867 | Ga0105249_107478672 | 135 |
| 152 | 3300010375 | Ga0105239_10004461 | Ga0105239_1000446115 | 135 |
| 153 | 3300010375 | Ga0105239_10032792 | Ga0105239_100327926 | 135 |
| 154 | 3300010375 | Ga0105239_10132325 | Ga0105239_101323251 | 135 |
| 155 | 3300010375 | Ga0105239_12849508 | Ga0105239_128495081 | 135 |
| 156 | 3300011119 | Ga0105246_10320449 | Ga0105246_103204492 | 135 |
| 157 | 3300011119 | Ga0105246_10330478 | Ga0105246_103304782 | 135 |
| 158 | 3300012483 | Ga0157337_1003498 | Ga0157337_10034981 | 135 |
| 159 | 3300013105 | Ga0157369_10028196 | Ga0157369_100281964 | 135 |
| 160 | 3300013105 | Ga0157369_10863497 | Ga0157369_108634972 | 135 |
| 161 | 3300013296 | Ga0157374_10952921 | Ga0157374_109529211 | 135 |
| 162 | 3300013297 | Ga0157378_10512995 | Ga0157378_105129953 | 135 |
| 163 | 3300013306 | Ga0163162_11856040 | Ga0163162_118560401 | 135 |
| 164 | 3300013307 | Ga0157372_10128996 | Ga0157372_101289961 | 135 |
| 165 | 3300013307 | Ga0157372_10295565 | Ga0157372_102955652 | 135 |
| 166 | 3300013307 | Ga0157372_11247580 | Ga0157372_112475801 | 135 |
| 167 | 3300013307 | Ga0157372_11384470 | Ga0157372_113844702 | 135 |
| 168 | 3300013308 | Ga0157375_10482520 | Ga0157375_104825202 | 135 |
| 169 | 3300014497 | Ga0182008_10052972 | Ga0182008_100529722 | 135 |
| 170 | 3300021388 | Ga0213875_10100082 | Ga0213875_101000822 | 135 |
| 171 | 3300025294 | Ga0209025_1006137 | Ga0209025_10061379 | 135 |
| 172 | 3300025900 | Ga0207710_10191822 | Ga0207710_101918222 | 135 |
| 173 | 3300025901 | Ga0207688_10004942 | Ga0207688_100049429 | 135 |
| 174 | 3300025901 | Ga0207688_10330394 | Ga0207688_103303942 | 135 |
| 175 | 3300025904 | Ga0207647_10153830 | Ga0207647_101538302 | 135 |
| 176 | 3300025906 | Ga0207699_10583022 | Ga0207699_105830222 | 135 |
| 177 | 3300025908 | Ga0207643_10049845 | Ga0207643_100498453 | 135 |
| 178 | 3300025910 | Ga0207684_10850233 | Ga0207684_108502331 | 135 |
| 179 | 3300025914 | Ga0207671_10003414 | Ga0207671_100034143 | 135 |
| 180 | 3300025914 | Ga0207671_10048514 | Ga0207671_100485142 | 135 |
| 181 | 3300025914 | Ga0207671_10540459 | Ga0207671_105404592 | 135 |
| 182 | 3300025915 | Ga0207693_10217806 | Ga0207693_102178062 | 135 |
| 183 | 3300025927 | Ga0207687_10129373 | Ga0207687_101293733 | 135 |
| 184 | 3300025928 | Ga0207700_10059205 | Ga0207700_100592052 | 135 |
| 185 | 3300025929 | Ga0207664_10022970 | Ga0207664_100229702 | 135 |
| 186 | 3300025932 | Ga0207690_10550831 | Ga0207690_105508312 | 135 |
| 187 | 3300025935 | Ga0207709_10255533 | Ga0207709_102555332 | 135 |
| 188 | 3300025936 | Ga0207670_10309447 | Ga0207670_103094472 | 135 |
| 189 | 3300025936 | Ga0207670_10385903 | Ga0207670_103859031 | 135 |
| 190 | 3300025941 | Ga0207711_10001074 | Ga0207711_1000107412 | 135 |
| 191 | 3300025949 | Ga0207667_10143838 | Ga0207667_101438382 | 135 |
| 192 | 3300025961 | Ga0207712_10001692 | Ga0207712_1000169211 | 135 |
| 193 | 3300025961 | Ga0207712_10684406 | Ga0207712_106844062 | 135 |
| 194 | 3300025972 | Ga0207668_10125165 | Ga0207668_101251652 | 135 |
| 195 | 3300025986 | Ga0207658_10000255 | Ga0207658_1000025538 | 135 |
| 196 | 3300025986 | Ga0207658_10215693 | Ga0207658_102156932 | 135 |
| 197 | 3300026023 | Ga0207677_10195233 | Ga0207677_101952333 | 135 |
| 198 | 3300026041 | Ga0207639_10033037 | Ga0207639_100330375 | 135 |
| 199 | 3300026041 | Ga0207639_10172507 | Ga0207639_101725073 | 135 |
| 200 | 3300026075 | Ga0207708_10355145 | Ga0207708_103551452 | 135 |
| 201 | 3300026116 | Ga0207674_10071819 | Ga0207674_100718193 | 135 |
| 202 | 3300028379 | Ga0268266_10455291 | Ga0268266_104552912 | 135 |
| 203 | 3300028380 | Ga0268265_10460611 | Ga0268265_104606113 | 135 |
| 204 | 3300028381 | Ga0268264_11765700 | Ga0268264_117657002 | 135 |
| 205 | 3300028794 | Ga0307515_10001767 | Ga0307515_1000176727 | 135 |
| 206 | 3300030878 | Ga0265770_1069521 | Ga0265770_10695212 | 135 |
| 207 | 3300031507 | Ga0307509_10184257 | Ga0307509_101842573 | 135 |
| 208 | 3300031548 | Ga0307408_100297797 | Ga0307408_1002977972 | 135 |
| 209 | 3300031548 | Ga0307408_101017990 | Ga0307408_1010179902 | 135 |
| 210 | 3300031548 | Ga0307408_101678548 | Ga0307408_1016785481 | 135 |
| 211 | 3300031616 | Ga0307508_10364053 | Ga0307508_103640532 | 135 |
| 212 | 3300031731 | Ga0307405_10101707 | Ga0307405_101017072 | 135 |
| 213 | 3300031731 | Ga0307405_10421076 | Ga0307405_104210762 | 135 |
| 214 | 3300031852 | Ga0307410_10014926 | Ga0307410_100149262 | 135 |
| 215 | 3300031852 | Ga0307410_10045642 | Ga0307410_100456422 | 135 |
| 216 | 3300031903 | Ga0307407_10254702 | Ga0307407_102547022 | 135 |
| 217 | 3300031995 | Ga0307409_100049248 | Ga0307409_1000492483 | 135 |
| 218 | 3300031995 | Ga0307409_100207009 | Ga0307409_1002070093 | 135 |
| 219 | 3300031995 | Ga0307409_100522778 | Ga0307409_1005227782 | 135 |
| 220 | 3300031995 | Ga0307409_100542477 | Ga0307409_1005424772 | 135 |
| 221 | 3300032002 | Ga0307416_100000815 | Ga0307416_10000081510 | 135 |
| 222 | 3300032002 | Ga0307416_100013841 | Ga0307416_1000138417 | 135 |
| 223 | 3300032002 | Ga0307416_100113620 | Ga0307416_1001136202 | 135 |
| 224 | 3300032002 | Ga0307416_101038313 | Ga0307416_1010383132 | 135 |
| 225 | 3300032002 | Ga0307416_101937834 | Ga0307416_1019378342 | 135 |
| 226 | 3300032004 | Ga0307414_10190190 | Ga0307414_101901902 | 135 |
| 227 | 3300032004 | Ga0307414_10269890 | Ga0307414_102698902 | 135 |
| 228 | 3300032004 | Ga0307414_10970690 | Ga0307414_109706901 | 135 |
| 229 | 3300032005 | Ga0307411_10062438 | Ga0307411_100624384 | 135 |
| 230 | 3300032005 | Ga0307411_10115021 | Ga0307411_101150214 | 135 |
| 231 | 3300032126 | Ga0307415_100000831 | Ga0307415_1000008315 | 135 |
| 232 | 3300032126 | Ga0307415_100068820 | Ga0307415_1000688203 | 135 |
| 233 | 3300032126 | Ga0307415_100297999 | Ga0307415_1002979992 | 135 |
| 234 | 3300033545 | Ga0316214_1021632 | Ga0316214_10216322 | 135 |
| 235 | 3300035086 | Ga0373934_0000056 | Ga0373934_0000056_27291_27701 | 135 |
| 236 | 3300035086 | Ga0373934_0020293 | Ga0373934_0020293_1544_1954 | 135 |
| 237 | 3300035092 | Ga0373952_0046214 | Ga0373952_0046214_474_884 | 135 |
| 238 | 3300035113 | Ga0373936_0197239 | Ga0373936_0197239_328_738 | 135 |
| 239 | 3300035117 | Ga0373953_0000309 | Ga0373953_0000309_1610_2020 | 135 |
| 240 | 3300035117 | Ga0373953_0006724 | Ga0373953_0006724_2124_2534 | 135 |
| 241 | 3300035118 | Ga0373954_0083814 | Ga0373954_0083814_380_790 | 135 |
| 242 | 3300035118 | Ga0373954_0408607 | Ga0373954_0408607_224_634 | 135 |
| 243 | 3300035119 | Ga0373956_0003716 | Ga0373956_0003716_1649_2059 | 135 |
| 244 | 3300035119 | Ga0373956_0011202 | Ga0373956_0011202_1442_1852 | 135 |
| 245 | 3300035120 | Ga0373957_0000263 | Ga0373957_0000263_1724_2134 | 135 |
| 246 | 3300035120 | Ga0373957_0016965 | Ga0373957_0016965_1443_1853 | 135 |
| 247 | 3300035170 | Ga0373943_0096599 | Ga0373943_0096599_903_1313 | 135 |
| 248 | 3300035170 | Ga0373943_0898040 | Ga0373943_0898040_100_510 | 135 |
| 249 | 3300035171 | Ga0373946_0010541 | Ga0373946_0010541_2336_2746 | 135 |
| 250 | 3300035172 | Ga0373955_0000050 | Ga0373955_0000050_39238_39648 | 135 |
| 251 | 3300035410 | Ga0373924_0005896 | Ga0373924_0005896_1920_2330 | 135 |
| 252 | 3300035410 | Ga0373924_0064615 | Ga0373924_0064615_1088_1498 | 135 |
| 253 | 3300035692 | Ga0373935_0019521 | Ga0373935_0019521_2092_2502 | 135 |
| 254 | 3300035695 | Ga0373927_0056271 | Ga0373927_0056271_1695_2105 | 135 |
| 255 | 3300035724 | Ga0373933_0000149 | Ga0373933_0000149_6038_6448 | 135 |
| 256 | 3300035724 | Ga0373933_0429195 | Ga0373933_0429195_439_849 | 135 |
| 257 | 3300035725 | Ga0373947_0045315 | Ga0373947_0045315_711_1121 | 135 |
| 258 | 3300036401 | Ga0373937_0000319 | Ga0373937_0000319_39238_39648 | 135 |
| 259 | 3300036401 | Ga0373937_0177019 | Ga0373937_0177019_546_956 | 135 |
| 260 | 3300036401 | Ga0373937_0957974 | Ga0373937_0957974_345_755 | 135 |
| 261 | 3300037068 | Ga0373925_0009155 | Ga0373925_0009155_5812_6222 | 135 |
| 262 | 3300037418 | Ga0395900_0158265 | Ga0395900_0158265_1786_2196 | 135 |
| 263 | 3300037418 | Ga0395900_0439048 | Ga0395900_0439048_593_1003 | 135 |
| 264 | 3300037418 | Ga0395900_0621610 | Ga0395900_0621610_582_992 | 135 |
| 265 | 3300037466 | Ga0395898_0038704 | Ga0395898_0038704_651_1061 | 135 |
| 266 | 3300037466 | Ga0395898_0151294 | Ga0395898_0151294_113_523 | 135 |
| 267 | 3300037466 | Ga0395898_0742711 | Ga0395898_0742711_185_595 | 135 |
| 268 | 3300037466 | Ga0395898_0992973 | Ga0395898_0992973_118_528 | 135 |
| 269 | 3300037466 | Ga0395898_1100528 | Ga0395898_1100528_223_633 | 135 |
| 270 | 3300037471 | Ga0395905_0227868 | Ga0395905_0227868_331_741 | 135 |
| 271 | 3300037853 | Ga0436364_0686104 | Ga0436364_0686104_1076_1486 | 135 |
| 272 | 3300037853 | Ga0436364_0978717 | Ga0436364_0978717_43_453 | 135 |
| 273 | 3300038443 | Ga0395901_0085421 | Ga0395901_0085421_2574_2984 | 135 |
| 274 | 3300038443 | Ga0395901_0599298 | Ga0395901_0599298_40_450 | 135 |
| 275 | 3300039437 | Ga0436365_0188410 | Ga0436365_0188410_256_666 | 135 |
| 276 | 3300039450 | Ga0436363_1124388 | Ga0436363_1124388_450_860 | 135 |
| 277 | 3300041443 | Ga0451789_0959797 | Ga0451789_0959797_26_436 | 135 |
| 278 | 3300041463 | Ga0451804_0932012 | Ga0451804_0932012_120_530 | 135 |
| 279 | 3300042001 | Ga0439441_184767 | Ga0439441_184767_38_448 | 135 |
| 280 | 3300042012 | Ga0439455_0168417 | Ga0439455_0168417_184_597 | 135 |
| 281 | 3300042016 | Ga0439463_036110 | Ga0439463_036110_53_466 | 135 |
| 282 | 3300042138 | Ga0450903_004758 | Ga0450903_004758_1844_2254 | 135 |
| 283 | 3300042438 | Ga0439459_0059552 | Ga0439459_0059552_138_548 | 135 |
| 284 | 3300042993 | Ga0439440_0104903 | Ga0439440_0104903_293_706 | 135 |
| 285 | 3300044656 | Ga0466969_0157070 | Ga0466969_0157070_385_795 | 135 |
| 286 | 3300044658 | Ga0466972_0442200 | Ga0466972_0442200_174_584 | 135 |
| 287 | 3300044683 | Ga0466965_0038169 | Ga0466965_0038169_1452_1862 | 135 |
| 288 | 3300044684 | Ga0466966_0385720 | Ga0466966_0385720_132_542 | 135 |
| 289 | 3300044684 | Ga0466966_0389098 | Ga0466966_0389098_157_567 | 135 |
| 290 | 3300044693 | Ga0466961_0164309 | Ga0466961_0164309_895_1305 | 135 |
| 291 | 3300044694 | Ga0466963_0024741 | Ga0466963_0024741_1257_1667 | 135 |
| 292 | 3300044694 | Ga0466963_0444829 | Ga0466963_0444829_462_872 | 135 |
| 293 | 3300044694 | Ga0466963_0959780 | Ga0466963_0959780_138_551 | 135 |
| 294 | 3300044706 | Ga0466964_0038943 | Ga0466964_0038943_1263_1673 | 135 |
| 295 | 3300044706 | Ga0466964_0208900 | Ga0466964_0208900_468_878 | 135 |
| 296 | 3300044706 | Ga0466964_0436095 | Ga0466964_0436095_200_610 | 135 |
| 297 | 3300044765 | Ga0466970_0245719 | Ga0466970_0245719_89_499 | 135 |
| 298 | 3300044842 | Ga0466957_0056310 | Ga0466957_0056310_638_1048 | 135 |
| 299 | 3300044842 | Ga0466957_0057752 | Ga0466957_0057752_468_878 | 135 |
| 300 | 3300044842 | Ga0466957_0100783 | Ga0466957_0100783_844_1254 | 135 |
| 301 | 3300044842 | Ga0466957_0229379 | Ga0466957_0229379_365_775 | 135 |
| 302 | 3300044842 | Ga0466957_1214097 | Ga0466957_1214097_92_502 | 135 |
| 303 | 3300044901 | Ga0466960_0035699 | Ga0466960_0035699_872_1282 | 135 |
| 304 | 3300044901 | Ga0466960_0073723 | Ga0466960_0073723_1007_1417 | 135 |
| 305 | 3300044901 | Ga0466960_0189772 | Ga0466960_0189772_210_620 | 135 |
| 306 | 3300044901 | Ga0466960_0223251 | Ga0466960_0223251_236_646 | 135 |
| 307 | 3300044901 | Ga0466960_0223868 | Ga0466960_0223868_541_951 | 135 |
| 308 | 3300044901 | Ga0466960_0369047 | Ga0466960_0369047_350_760 | 135 |
| 309 | 3300045049 | Ga0466959_0159917 | Ga0466959_0159917_918_1328 | 135 |
| 310 | 3300045049 | Ga0466959_0238415 | Ga0466959_0238415_527_937 | 135 |
| 311 | 3300045049 | Ga0466959_0654620 | Ga0466959_0654620_255_665 | 135 |
| 312 | 3300045836 | Ga0466958_0066772 | Ga0466958_0066772_1555_1965 | 135 |
| 313 | 3300045836 | Ga0466958_0216394 | Ga0466958_0216394_635_1045 | 135 |
| 314 | 3300045976 | Ga0466967_0002981 | Ga0466967_0002981_6204_6614 | 135 |
| 315 | 3300045976 | Ga0466967_0010513 | Ga0466967_0010513_3755_4168 | 135 |
| 316 | 3300045976 | Ga0466967_0030610 | Ga0466967_0030610_712_1122 | 135 |
| 317 | 3300045976 | Ga0466967_0156048 | Ga0466967_0156048_328_738 | 135 |
| 318 | 3300045976 | Ga0466967_0396339 | Ga0466967_0396339_171_581 | 135 |
| 319 | 3300045976 | Ga0466967_0492077 | Ga0466967_0492077_479_889 | 135 |
| 320 | 3300045976 | Ga0466967_1188609 | Ga0466967_1188609_240_650 | 135 |
| 321 | 3300046452 | Ga0495617_118430 | Ga0495617_118430_183_593 | 135 |
| 322 | 3300046454 | Ga0495592_0000255 | Ga0495592_0000255_39238_39648 | 135 |
| 323 | 3300046455 | Ga0495603_0000550 | Ga0495603_0000550_11891_12301 | 135 |
| 324 | 3300046455 | Ga0495603_0009715 | Ga0495603_0009715_70_480 | 135 |
| 325 | 3300046455 | Ga0495603_0036090 | Ga0495603_0036090_624_1034 | 135 |
| 326 | 3300046455 | Ga0495603_0707324 | Ga0495603_0707324_79_489 | 135 |
| 327 | 3300046459 | Ga0495629_0001975 | Ga0495629_0001975_7988_8398 | 135 |
| 328 | 3300046459 | Ga0495629_0003408 | Ga0495629_0003408_654_1064 | 135 |
| 329 | 3300046459 | Ga0495629_0508081 | Ga0495629_0508081_190_600 | 135 |
| 330 | 3300046460 | Ga0495638_0104562 | Ga0495638_0104562_1057_1467 | 135 |
| 331 | 3300046461 | Ga0495641_0026618 | Ga0495641_0026618_677_1087 | 135 |
| 332 | 3300046462 | Ga0495651_0000199 | Ga0495651_0000199_6038_6448 | 135 |
| 333 | 3300046463 | Ga0495653_0010908 | Ga0495653_0010908_5988_6398 | 135 |
| 334 | 3300046472 | Ga0495580_0017038 | Ga0495580_0017038_3144_3554 | 135 |
| 335 | 3300046473 | Ga0495582_0100086 | Ga0495582_0100086_902_1312 | 135 |
| 336 | 3300046475 | Ga0495639_0039380 | Ga0495639_0039380_165_575 | 135 |
| 337 | 3300046476 | Ga0495662_0064845 | Ga0495662_0064845_918_1328 | 135 |
| 338 | 3300046477 | Ga0495664_0038694 | Ga0495664_0038694_1885_2295 | 135 |
| 339 | 3300046477 | Ga0495664_0052566 | Ga0495664_0052566_569_979 | 135 |
| 340 | 3300046499 | Ga0495594_0001353 | Ga0495594_0001353_9866_10276 | 135 |
| 341 | 3300046499 | Ga0495594_0012361 | Ga0495594_0012361_1833_2243 | 135 |
| 342 | 3300046499 | Ga0495594_0061282 | Ga0495594_0061282_551_961 | 135 |
| 343 | 3300046501 | Ga0495607_0126401 | Ga0495607_0126401_36_446 | 135 |
| 344 | 3300046506 | Ga0495583_0062146 | Ga0495583_0062146_940_1350 | 135 |
| 345 | 3300046511 | Ga0495608_0001171 | Ga0495608_0001171_5989_6399 | 135 |
| 346 | 3300046511 | Ga0495608_0093930 | Ga0495608_0093930_1018_1428 | 135 |
| 347 | 3300046514 | Ga0495618_0137865 | Ga0495618_0137865_1112_1522 | 135 |
| 348 | 3300046516 | Ga0495628_0000282 | Ga0495628_0000282_5998_6408 | 135 |
| 349 | 3300046517 | Ga0495630_0429988 | Ga0495630_0429988_274_684 | 135 |
| 350 | 3300046518 | Ga0495631_0209531 | Ga0495631_0209531_258_668 | 135 |
| 351 | 3300046522 | Ga0495643_0344285 | Ga0495643_0344285_132_542 | 135 |
| 352 | 3300046524 | Ga0495648_0002385 | Ga0495648_0002385_13030_13440 | 135 |
| 353 | 3300046528 | Ga0495642_0241457 | Ga0495642_0241457_128_538 | 135 |
| 354 | 3300046529 | Ga0495652_0002623 | Ga0495652_0002623_6037_6447 | 135 |
| 355 | 3300046529 | Ga0495652_0272412 | Ga0495652_0272412_510_920 | 135 |
| 356 | 3300046530 | Ga0495654_0154269 | Ga0495654_0154269_275_685 | 135 |
| 357 | 3300046531 | Ga0495665_0016094 | Ga0495665_0016094_1790_2200 | 135 |
| 358 | 3300046531 | Ga0495665_0245957 | Ga0495665_0245957_81_491 | 135 |
| 359 | 3300046536 | Ga0495587_0000189 | Ga0495587_0000189_6038_6448 | 135 |
| 360 | 3300046543 | Ga0495645_0072661 | Ga0495645_0072661_1115_1525 | 135 |
| 361 | 3300046543 | Ga0495645_0177067 | Ga0495645_0177067_267_677 | 135 |
| 362 | 3300046558 | Ga0495633_0071662 | Ga0495633_0071662_953_1363 | 135 |
| 363 | 3300046559 | Ga0495667_0000136 | Ga0495667_0000136_11084_11494 | 135 |
| 364 | 3300046559 | Ga0495667_0031636 | Ga0495667_0031636_598_1008 | 135 |
| 365 | 3300046616 | Ga0495668_0014484 | Ga0495668_0014484_2193_2603 | 135 |
| 366 | 3300046642 | Ga0495634_0196880 | Ga0495634_0196880_644_1054 | 135 |
| 367 | 3300046663 | Ga0495635_0159568 | Ga0495635_0159568_1086_1496 | 135 |
| 368 | 3300046664 | Ga0495659_0310752 | Ga0495659_0310752_17_427 | 135 |
| 369 | 3300046664 | Ga0495659_0500420 | Ga0495659_0500420_107_517 | 135 |
| 370 | 3300046664 | Ga0495659_0555931 | Ga0495659_0555931_73_483 | 135 |
| 371 | 3300046665 | Ga0495661_0196239 | Ga0495661_0196239_377_787 | 135 |
| 372 | 3300046674 | Ga0495588_0125537 | Ga0495588_0125537_710_1120 | 135 |
| 373 | 3300046675 | Ga0495657_0000290 | Ga0495657_0000290_6038_6448 | 135 |
| 374 | 3300046678 | Ga0495599_0000676 | Ga0495599_0000676_7822_8232 | 135 |
| 375 | 3300046678 | Ga0495599_0121476 | Ga0495599_0121476_439_849 | 135 |
| 376 | 3300046679 | Ga0495623_0002482 | Ga0495623_0002482_5808_6218 | 135 |
| 377 | 3300046679 | Ga0495623_0047070 | Ga0495623_0047070_1877_2287 | 135 |
| 378 | 3300046680 | Ga0495646_0024101 | Ga0495646_0024101_1207_1617 | 135 |
| 379 | 3300046680 | Ga0495646_0028819 | Ga0495646_0028819_1963_2373 | 135 |
| 380 | 3300046683 | Ga0495658_0057220 | Ga0495658_0057220_1732_2142 | 135 |
| 381 | 3300046684 | Ga0495669_0002865 | Ga0495669_0002865_1367_1777 | 135 |
| 382 | 3300046689 | Ga0495613_0130140 | Ga0495613_0130140_439_849 | 135 |
| 383 | 3300046690 | Ga0495624_0045742 | Ga0495624_0045742_1524_1934 | 135 |
| 384 | 3300046691 | Ga0495670_0002672 | Ga0495670_0002672_8119_8529 | 135 |
| 385 | 3300046692 | Ga0495671_0100396 | Ga0495671_0100396_187_597 | 135 |
| 386 | 3300046794 | Ga0495589_0096022 | Ga0495589_0096022_641_1051 | 135 |
| 387 | 3300046794 | Ga0495589_0122363 | Ga0495589_0122363_111_521 | 135 |
| 388 | 3300046809 | Ga0495600_0004743 | Ga0495600_0004743_322_732 | 135 |
| 389 | 3300046809 | Ga0495600_0053994 | Ga0495600_0053994_324_734 | 135 |
| 390 | 3300047315 | Ga0495581_0006043 | Ga0495581_0006043_6080_6490 | 135 |
| 391 | 3300047315 | Ga0495581_0101454 | Ga0495581_0101454_1098_1508 | 135 |
| 392 | 3300047317 | Ga0495604_0000280 | Ga0495604_0000280_6038_6448 | 135 |
| 393 | 3300047317 | Ga0495604_0141334 | Ga0495604_0141334_535_945 | 135 |
| 394 | 3300047318 | Ga0495636_0335831 | Ga0495636_0335831_264_674 | 135 |
| 395 | 3300047319 | Ga0495674_0145394 | Ga0495674_0145394_903_1313 | 135 |
| 396 | 3300047320 | Ga0495672_0004058 | Ga0495672_0004058_3074_3484 | 135 |
| 397 | 3300047320 | Ga0495672_0008155 | Ga0495672_0008155_2830_3240 | 135 |
| 398 | 3300047321 | Ga0495676_0004019 | Ga0495676_0004019_6715_7125 | 135 |
| 399 | 3300047321 | Ga0495676_0005888 | Ga0495676_0005888_772_1182 | 135 |
| 400 | 3300047321 | Ga0495676_0009607 | Ga0495676_0009607_5347_5757 | 135 |
| 401 | 3300047321 | Ga0495676_0394140 | Ga0495676_0394140_223_633 | 135 |
| 402 | 3300047321 | Ga0495676_0427719 | Ga0495676_0427719_55_465 | 135 |
| 403 | 3300047322 | Ga0495680_0000430 | Ga0495680_0000430_7425_7835 | 135 |
| 404 | 3300047323 | Ga0495683_0045770 | Ga0495683_0045770_1099_1509 | 135 |
| 405 | 3300047444 | Ga0495675_0000347 | Ga0495675_0000347_21208_21618 | 135 |
| 406 | 3300047444 | Ga0495675_0021589 | Ga0495675_0021589_3454_3864 | 135 |
| 407 | 3300047445 | Ga0495677_0430329 | Ga0495677_0430329_62_472 | 135 |
| 408 | 3300047447 | Ga0495685_042549 | Ga0495685_042549_1018_1428 | 135 |
| 409 | 3300047469 | Ga0495673_0002967 | Ga0495673_0002967_1582_1992 | 135 |
| 410 | 3300047471 | Ga0495684_0120685 | Ga0495684_0120685_328_738 | 135 |
| 411 | 3300047472 | Ga0495686_0001693 | Ga0495686_0001693_15510_15920 | 135 |
| 412 | 3300047673 | Ga0495593_0202494 | Ga0495593_0202494_565_975 | 135 |
| 413 | 3300048088 | Ga0495602_0000297 | Ga0495602_0000297_6038_6448 | 135 |
| 414 | 3300048088 | Ga0495602_0050303 | Ga0495602_0050303_510_920 | 135 |
| 415 | 3300048089 | Ga0495614_0002695 | Ga0495614_0002695_3177_3587 | 135 |
| 416 | 3300048903 | Ga0496100_0002909 | Ga0496100_0002909_4801_5211 | 135 |
| 417 | 3300048903 | Ga0496100_0046449 | Ga0496100_0046449_2115_2525 | 135 |
| 418 | 3300048904 | Ga0496101_0000019 | Ga0496101_0000019_92263_92673 | 135 |
| 419 | 3300048905 | Ga0496102_0000007 | Ga0496102_0000007_240497_240907 | 135 |
| 420 | 3300048905 | Ga0496102_0006394 | Ga0496102_0006394_7868_8278 | 135 |
| 421 | 3300048905 | Ga0496102_0192889 | Ga0496102_0192889_1321_1731 | 135 |
| 422 | 3300048906 | Ga0496103_0000013 | Ga0496103_0000013_121354_121764 | 135 |
| 423 | 3300048906 | Ga0496103_0041337 | Ga0496103_0041337_557_967 | 135 |
| 424 | 3300048907 | Ga0496104_0162218 | Ga0496104_0162218_1015_1425 | 135 |
| 425 | 3300048908 | Ga0496105_0274069 | Ga0496105_0274069_787_1197 | 135 |
| 426 | 3300048908 | Ga0496105_0531857 | Ga0496105_0531857_68_478 | 135 |
| 427 | 3300048908 | Ga0496105_0646913 | Ga0496105_0646913_152_562 | 135 |
| 428 | 3300048909 | Ga0496106_0028565 | Ga0496106_0028565_153_563 | 135 |
| 429 | 3300048909 | Ga0496106_0092809 | Ga0496106_0092809_497_907 | 135 |
| 430 | 3300048910 | Ga0496107_0121731 | Ga0496107_0121731_783_1193 | 135 |
| 431 | 3300048910 | Ga0496107_0246474 | Ga0496107_0246474_758_1168 | 135 |
| 432 | 3300048911 | Ga0496108_0663719 | Ga0496108_0663719_371_781 | 135 |
| 433 | 3300048911 | Ga0496108_0868713 | Ga0496108_0868713_94_504 | 135 |
| 434 | 3300048911 | Ga0496108_1133390 | Ga0496108_1133390_23_433 | 135 |
| 435 | 3300048912 | Ga0496109_0000667 | Ga0496109_0000667_26245_26658 | 135 |
| 436 | 3300048912 | Ga0496109_0516785 | Ga0496109_0516785_263_673 | 135 |
| 437 | 3300048913 | Ga0496110_0072941 | Ga0496110_0072941_2352_2762 | 135 |
| 438 | 3300048913 | Ga0496110_0380277 | Ga0496110_0380277_767_1177 | 135 |
| 439 | 3300048913 | Ga0496110_0479442 | Ga0496110_0479442_298_708 | 135 |
| 440 | 3300048914 | Ga0496111_0123849 | Ga0496111_0123849_1349_1759 | 135 |
| 441 | 3300048915 | Ga0496112_0297157 | Ga0496112_0297157_1025_1435 | 135 |
| 442 | 3300048915 | Ga0496112_0339660 | Ga0496112_0339660_745_1155 | 135 |
| 443 | 3300048916 | Ga0496113_0162263 | Ga0496113_0162263_227_637 | 135 |
| 444 | 3300048917 | Ga0496114_0130811 | Ga0496114_0130811_1285_1695 | 135 |
| 445 | 3300048917 | Ga0496114_0275916 | Ga0496114_0275916_270_680 | 135 |
| 446 | 3300048917 | Ga0496114_0287177 | Ga0496114_0287177_696_1106 | 135 |
| 447 | 3300048917 | Ga0496114_0784164 | Ga0496114_0784164_109_519 | 135 |
| 448 | 3300048918 | Ga0496115_0618562 | Ga0496115_0618562_294_704 | 135 |
| 449 | 3300048919 | Ga0496116_0000033 | Ga0496116_0000033_177264_177674 | 135 |
| 450 | 3300048920 | Ga0496117_0000025 | Ga0496117_0000025_177194_177604 | 135 |
| 451 | 3300048920 | Ga0496117_0000738 | Ga0496117_0000738_17172_17585 | 135 |
| 452 | 3300048921 | Ga0496118_0000023 | Ga0496118_0000023_240503_240913 | 135 |
| 453 | 3300048921 | Ga0496118_0002673 | Ga0496118_0002673_9302_9715 | 135 |
| 454 | 3300048921 | Ga0496118_0052738 | Ga0496118_0052738_712_1122 | 135 |
| 455 | 3300048922 | Ga0496119_0000512 | Ga0496119_0000512_37448_37858 | 135 |
| 456 | 3300048922 | Ga0496119_0001355 | Ga0496119_0001355_19063_19476 | 135 |
| 457 | 3300048922 | Ga0496119_0158389 | Ga0496119_0158389_112_522 | 135 |
| 458 | 3300048923 | Ga0496120_0000382 | Ga0496120_0000382_37576_37986 | 135 |
| 459 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_75206_75616 | 135 |
| 460 | 3300048925 | Ga0496122_0000126 | Ga0496122_0000126_159176_159586 | 135 |
| 461 | 3300048926 | Ga0496123_0002656 | Ga0496123_0002656_6993_7403 | 135 |
| 462 | 3300048929 | Ga0496126_0002371 | Ga0496126_0002371_12758_13168 | 135 |
| 463 | 3300048929 | Ga0496126_0005034 | Ga0496126_0005034_14003_14416 | 135 |
| 464 | 3300048929 | Ga0496126_0200594 | Ga0496126_0200594_117_527 | 135 |
| 465 | 3300048929 | Ga0496126_0226032 | Ga0496126_0226032_212_622 | 135 |
| 466 | 3300049570 | Ga0501033_0036710 | Ga0501033_0036710_2737_3147 | 135 |
| 467 | 3300049570 | Ga0501033_0388939 | Ga0501033_0388939_428_838 | 135 |
| 468 | 3300049572 | Ga0501036_0702000 | Ga0501036_0702000_21_431 | 135 |
| 469 | 3300049572 | Ga0501036_1198961 | Ga0501036_1198961_175_585 | 135 |
| 470 | 3300049574 | Ga0501038_0404148 | Ga0501038_0404148_147_557 | 135 |
| 471 | 3300049574 | Ga0501038_0747576 | Ga0501038_0747576_271_681 | 135 |
| 472 | 3300049575 | Ga0501039_0312370 | Ga0501039_0312370_569_979 | 135 |
| 473 | 3300049575 | Ga0501039_0354897 | Ga0501039_0354897_33_443 | 135 |
| 474 | 3300049576 | Ga0501040_0323804 | Ga0501040_0323804_432_842 | 135 |
| 475 | 3300049576 | Ga0501040_1382564 | Ga0501040_1382564_33_443 | 135 |
| 476 | 3300049578 | Ga0501042_0161009 | Ga0501042_0161009_535_945 | 135 |
| 477 | 3300049578 | Ga0501042_0656242 | Ga0501042_0656242_289_699 | 135 |
| 478 | 3300049581 | Ga0501047_0123709 | Ga0501047_0123709_203_613 | 135 |
| 479 | 3300049582 | Ga0501048_0194631 | Ga0501048_0194631_653_1063 | 135 |
| 480 | 3300049583 | Ga0501067_0017474 | Ga0501067_0017474_2907_3317 | 135 |
| 481 | 3300049583 | Ga0501067_0033673 | Ga0501067_0033673_1857_2267 | 135 |
| 482 | 3300049584 | Ga0501068_0077444 | Ga0501068_0077444_453_863 | 135 |
| 483 | 3300049585 | Ga0501069_0112835 | Ga0501069_0112835_133_543 | 135 |
| 484 | 3300049585 | Ga0501069_0165879 | Ga0501069_0165879_46_456 | 135 |
| 485 | 3300049586 | Ga0501070_0435513 | Ga0501070_0435513_430_840 | 135 |
| 486 | 3300049587 | Ga0501071_0229096 | Ga0501071_0229096_391_801 | 135 |
| 487 | 3300049588 | Ga0501072_0061383 | Ga0501072_0061383_2535_2945 | 135 |
| 488 | 3300049588 | Ga0501072_0666156 | Ga0501072_0666156_10_420 | 135 |
| 489 | 3300049588 | Ga0501072_1131878 | Ga0501072_1131878_27_437 | 135 |
| 490 | 3300049704 | Ga0501221_176816 | Ga0501221_176816_159_569 | 135 |
| 491 | 3300049707 | Ga0501234_102737 | Ga0501234_102737_19_429 | 135 |
| 492 | 3300049744 | Ga0501083_1095695 | Ga0501083_1095695_12_422 | 135 |
| 493 | 3300049822 | Ga0501035_0412620 | Ga0501035_0412620_571_981 | 135 |
| 494 | 3300049823 | Ga0501044_0066437 | Ga0501044_0066437_74_484 | 135 |
| 495 | 3300049824 | Ga0501045_0454466 | Ga0501045_0454466_195_605 | 135 |
| 496 | 3300049824 | Ga0501045_0984617 | Ga0501045_0984617_102_512 | 135 |
| 497 | 3300050494 | nmdc:mga06z11_199538_c1 | nmdc:mga06z11_199538_c1_607_1017 | 135 |
| 498 | 3300050507 | nmdc:mga05p37_1161515_c1 | nmdc:mga05p37_1161515_c1_359_769 | 135 |
| 499 | 3300050507 | nmdc:mga05p37_24150_c1 | nmdc:mga05p37_24150_c1_4465_4875 | 135 |
| 500 | 3300050507 | nmdc:mga05p37_81702_c1 | nmdc:mga05p37_81702_c1_436_846 | 135 |
| 501 | 3300050508 | nmdc:mga09592_22160_c1 | nmdc:mga09592_22160_c1_2232_2642 | 135 |
| 502 | 3300050509 | nmdc:mga0qj67_4976_c1 | nmdc:mga0qj67_4976_c1_6756_7166 | 135 |
| 503 | 3300050510 | nmdc:mga06r32_37973_c1 | nmdc:mga06r32_37973_c1_3225_3635 | 135 |
| 504 | 3300050511 | nmdc:mga08y16_1177672_c1 | nmdc:mga08y16_1177672_c1_21_431 | 135 |
| 505 | 3300050512 | nmdc:mga0n895_556797_c1 | nmdc:mga0n895_556797_c1_191_601 | 135 |
| 506 | 3300050516 | nmdc:mga0sz30_115007_c1 | nmdc:mga0sz30_115007_c1_88_498 | 135 |
| 507 | 3300053077 | Ga0495601_0034611 | Ga0495601_0034611_2694_3104 | 135 |
| 508 | 3300053077 | Ga0495601_0303231 | Ga0495601_0303231_204_614 | 135 |
| 509 | 3300053078 | Ga0495612_0005080 | Ga0495612_0005080_10_420 | 135 |
| 510 | 3300053085 | Ga0495619_0207222 | Ga0495619_0207222_536_946 | 135 |
| 511 | 3300053085 | Ga0495619_0604320 | Ga0495619_0604320_301_711 | 135 |
| 512 | 3300053087 | Ga0500643_001928 | Ga0500643_001928_10495_10905 | 135 |
| 513 | 3300053120 | Ga0500597_015966 | Ga0500597_015966_2197_2607 | 135 |
| 514 | 3300054114 | Ga0501084_0635002 | Ga0501084_0635002_25_435 | 135 |
| 515 | 3300054114 | Ga0501084_0929631 | Ga0501084_0929631_244_654 | 135 |
| 516 | 3300060353 | Ga0501082_0799174 | Ga0501082_0799174_147_557 | 135 |
| 517 | 3300061734 | Ga0530510_0146492 | Ga0530510_0146492_267_677 | 135 |
| 518 | 3300005467 | Ga0070706_100508528 | Ga0070706_1005085281 | 136 |
| 519 | 3300005471 | Ga0070698_100588663 | Ga0070698_1005886632 | 136 |
| 520 | 3300006852 | Ga0075433_11750346 | Ga0075433_117503461 | 136 |
| 521 | 3300009147 | Ga0114129_11272416 | Ga0114129_112724162 | 136 |
| 522 | 3300025910 | Ga0207684_10042876 | Ga0207684_100428762 | 136 |
| 523 | 3300026088 | Ga0207641_11213008 | Ga0207641_112130082 | 136 |
| 524 | 3300026095 | Ga0207676_10674761 | Ga0207676_106747612 | 136 |
| 525 | 3300048912 | Ga0496109_0015932 | Ga0496109_0015932_1132_1545 | 136 |
| 526 | 3300048913 | Ga0496110_0723779 | Ga0496110_0723779_197_610 | 136 |
| 527 | 3300048915 | Ga0496112_1352863 | Ga0496112_1352863_201_614 | 136 |
| 528 | 3300048916 | Ga0496113_0166959 | Ga0496113_0166959_997_1410 | 136 |
| 529 | 3300049581 | Ga0501047_0022525 | Ga0501047_0022525_4750_5163 | 136 |
| 530 | 3300003373 | JGI25407J50210_10001088 | JGI25407J50210_100010884 | 137 |
| 531 | 3300003373 | JGI25407J50210_10028587 | JGI25407J50210_100285873 | 137 |
| 532 | 3300005981 | Ga0081538_10037116 | Ga0081538_100371161 | 137 |
| 533 | 3300005981 | Ga0081538_10244653 | Ga0081538_102446531 | 137 |
| 534 | 3300013307 | Ga0157372_10881749 | Ga0157372_108817492 | 137 |
| 535 | 3300031901 | Ga0307406_10818815 | Ga0307406_108188152 | 137 |
| 536 | 3300037312 | Ga0395899_0497554 | Ga0395899_0497554_107_526 | 137 |
| 537 | 3300037418 | Ga0395900_0060712 | Ga0395900_0060712_2000_2419 | 137 |
| 538 | 3300037466 | Ga0395898_1976439 | Ga0395898_1976439_72_488 | 137 |
| 539 | 3300037471 | Ga0395905_0412842 | Ga0395905_0412842_795_1214 | 137 |
| 540 | 3300038443 | Ga0395901_0358880 | Ga0395901_0358880_855_1271 | 137 |
| 541 | 3300038443 | Ga0395901_0521255 | Ga0395901_0521255_181_600 | 137 |
| 542 | 3300042993 | Ga0439440_0048156 | Ga0439440_0048156_495_911 | 137 |
| 543 | 3300046500 | Ga0495596_0388172 | Ga0495596_0388172_44_463 | 137 |
| 544 | 3300049584 | Ga0501068_0149607 | Ga0501068_0149607_364_780 | 137 |
| 545 | 3300049590 | Ga0501074_0073126 | Ga0501074_0073126_1422_1838 | 137 |
| 546 | 3300049742 | Ga0501080_0009244 | Ga0501080_0009244_1237_1653 | 137 |
| 547 | 3300053142 | Ga0500577_0186471 | Ga0500577_0186471_44_460 | 137 |
| 548 | 3300003203 | JGI25406J46586_10008756 | JGI25406J46586_100087562 | 138 |
| 549 | 3300005288 | Ga0065714_10074977 | Ga0065714_100749773 | 138 |
| 550 | 3300005327 | Ga0070658_10521161 | Ga0070658_105211611 | 138 |
| 551 | 3300005336 | Ga0070680_100760283 | Ga0070680_1007602831 | 138 |
| 552 | 3300005347 | Ga0070668_100001181 | Ga0070668_1000011814 | 138 |
| 553 | 3300005366 | Ga0070659_100285832 | Ga0070659_1002858322 | 138 |
| 554 | 3300005458 | Ga0070681_10100672 | Ga0070681_101006722 | 138 |
| 555 | 3300005518 | Ga0070699_101211227 | Ga0070699_1012112272 | 138 |
| 556 | 3300005530 | Ga0070679_101174559 | Ga0070679_1011745591 | 138 |
| 557 | 3300005535 | Ga0070684_100255999 | Ga0070684_1002559992 | 138 |
| 558 | 3300005535 | Ga0070684_100385706 | Ga0070684_1003857062 | 138 |
| 559 | 3300005536 | Ga0070697_100153943 | Ga0070697_1001539433 | 138 |
| 560 | 3300005545 | Ga0070695_100040203 | Ga0070695_1000402032 | 138 |
| 561 | 3300005614 | Ga0068856_100222984 | Ga0068856_1002229844 | 138 |
| 562 | 3300005616 | Ga0068852_100607266 | Ga0068852_1006072663 | 138 |
| 563 | 3300005981 | Ga0081538_10000836 | Ga0081538_1000083633 | 138 |
| 564 | 3300005981 | Ga0081538_10072573 | Ga0081538_100725733 | 138 |
| 565 | 3300005981 | Ga0081538_10162545 | Ga0081538_101625452 | 138 |
| 566 | 3300005985 | Ga0081539_10004760 | Ga0081539_100047604 | 138 |
| 567 | 3300013105 | Ga0157369_10298699 | Ga0157369_102986994 | 138 |
| 568 | 3300013307 | Ga0157372_10311353 | Ga0157372_103113532 | 138 |
| 569 | 3300013308 | Ga0157375_10296944 | Ga0157375_102969442 | 138 |
| 570 | 3300025912 | Ga0207707_10491970 | Ga0207707_104919702 | 138 |
| 571 | 3300025928 | Ga0207700_10232509 | Ga0207700_102325093 | 138 |
| 572 | 3300025932 | Ga0207690_10306779 | Ga0207690_103067793 | 138 |
| 573 | 3300025944 | Ga0207661_10202916 | Ga0207661_102029163 | 138 |
| 574 | 3300025972 | Ga0207668_10153548 | Ga0207668_101535482 | 138 |
| 575 | 3300026078 | Ga0207702_10553589 | Ga0207702_105535892 | 138 |
| 576 | 3300026116 | Ga0207674_10311528 | Ga0207674_103115282 | 138 |
| 577 | 3300026116 | Ga0207674_10911415 | Ga0207674_109114152 | 138 |
| 578 | 3300031852 | Ga0307410_10527400 | Ga0307410_105274002 | 138 |
| 579 | 3300031995 | Ga0307409_101058674 | Ga0307409_1010586742 | 138 |
| 580 | 3300032002 | Ga0307416_100469501 | Ga0307416_1004695012 | 138 |
| 581 | 3300032004 | Ga0307414_10565761 | Ga0307414_105657612 | 138 |
| 582 | 3300032005 | Ga0307411_10367087 | Ga0307411_103670872 | 138 |
| 583 | 3300032126 | Ga0307415_100993652 | Ga0307415_1009936522 | 138 |
| 584 | 3300032126 | Ga0307415_101342545 | Ga0307415_1013425452 | 138 |
| 585 | 3300037312 | Ga0395899_0529993 | Ga0395899_0529993_229_648 | 138 |
| 586 | 3300037418 | Ga0395900_0025139 | Ga0395900_0025139_2751_3170 | 138 |
| 587 | 3300037466 | Ga0395898_0090231 | Ga0395898_0090231_485_904 | 138 |
| 588 | 3300039450 | Ga0436363_1021750 | Ga0436363_1021750_92_511 | 138 |
| 589 | 3300044706 | Ga0466964_0475028 | Ga0466964_0475028_158_577 | 138 |
| 590 | 3300045976 | Ga0466967_0003925 | Ga0466967_0003925_8372_8791 | 138 |
| 591 | 3300045976 | Ga0466967_1368395 | Ga0466967_1368395_47_466 | 138 |
| 592 | 3300046517 | Ga0495630_0411024 | Ga0495630_0411024_299_718 | 138 |
| 593 | 3300046674 | Ga0495588_0015689 | Ga0495588_0015689_2979_3398 | 138 |
| 594 | 3300046674 | Ga0495588_0172842 | Ga0495588_0172842_181_600 | 138 |
| 595 | 3300046691 | Ga0495670_0026483 | Ga0495670_0026483_1089_1508 | 138 |
| 596 | 3300046794 | Ga0495589_0174270 | Ga0495589_0174270_588_1007 | 138 |
| 597 | 3300047318 | Ga0495636_0282957 | Ga0495636_0282957_15_434 | 138 |
| 598 | 3300048903 | Ga0496100_0177743 | Ga0496100_0177743_470_889 | 138 |
| 599 | 3300048904 | Ga0496101_0008278 | Ga0496101_0008278_2192_2611 | 138 |
| 600 | 3300048905 | Ga0496102_0145474 | Ga0496102_0145474_622_1041 | 138 |
| 601 | 3300048905 | Ga0496102_0202042 | Ga0496102_0202042_1112_1531 | 138 |
| 602 | 3300048906 | Ga0496103_0090849 | Ga0496103_0090849_580_999 | 138 |
| 603 | 3300048909 | Ga0496106_0190484 | Ga0496106_0190484_927_1346 | 138 |
| 604 | 3300048910 | Ga0496107_0018178 | Ga0496107_0018178_3602_4021 | 138 |
| 605 | 3300048911 | Ga0496108_0027387 | Ga0496108_0027387_3293_3712 | 138 |
| 606 | 3300048914 | Ga0496111_0127288 | Ga0496111_0127288_202_621 | 138 |
| 607 | 3300048916 | Ga0496113_0228606 | Ga0496113_0228606_311_730 | 138 |
| 608 | 3300048917 | Ga0496114_0107386 | Ga0496114_0107386_546_965 | 138 |
| 609 | 3300049577 | Ga0501041_0038998 | Ga0501041_0038998_2225_2644 | 138 |
| 610 | 3300049582 | Ga0501048_0538296 | Ga0501048_0538296_362_781 | 138 |
| 611 | 3300059492 | Ga0587073_0123235 | Ga0587073_0123235_32_451 | 138 |
| 612 | 3300005535 | Ga0070684_100689405 | Ga0070684_1006894052 | 139 |
| 613 | 3300005577 | Ga0068857_101726123 | Ga0068857_1017261231 | 139 |
| 614 | 3300044694 | Ga0466963_0929390 | Ga0466963_0929390_65_490 | 140 |
| 615 | 3300045049 | Ga0466959_0260890 | Ga0466959_0260890_249_674 | 140 |
| 616 | 3300045976 | Ga0466967_0001059 | Ga0466967_0001059_6079_6504 | 140 |
| 617 | 3300049741 | Ga0501079_0632779 | Ga0501079_0632779_44_532 | 142 |
| 618 | 3300050509 | nmdc:mga0qj67_17465_c1 | nmdc:mga0qj67_17465_c1_3870_4319 | 142 |
| 619 | 3300050510 | nmdc:mga06r32_6314_c1 | nmdc:mga06r32_6314_c1_4559_5008 | 142 |
| 620 | iso_pu_bacteria | 8056060235 | 8056064001 | 146 |
| 621 | 3300000546 | LJNas_1015234 | LJNas_10152342 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8731 | 12 | 145 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8667 | 12 | 145 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8666 | 14 | 146 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8546 | 12 | 145 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8492 | 12 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9505 | 93 | 142 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9458 | 93 | 144 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8792 | 93 | 142 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8665 | 93 | 144 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8618 | 94 | 148 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9NV14-F1-model_v4 | VOC family protein | 0.9969 | 12 | 146 |
|
| AF-A0A0M8YYP4-F1-model_v4 | Glyoxalase | 0.9957 | 12 | 146 |
|
| AF-A0A1A1XR19-F1-model_v4 | deleted | 0.9943 | 12 | 146 |
|
| AF-A0A4V2YPG6-F1-model_v4 | VOC family protein | 0.9941 | 13 | 146 |
|
| AF-A0A1A3D5H7-F1-model_v4 | Glyoxalase | 0.9937 | 12 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar