F469842

General Info

Members Datasets Scaffolds Average Seq Length
619 203 619 213

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0087339|Ga0439460_0087339_302_958
Length 212
Sequence MTSSSRKRVVPRTYKEQPFDLYGLDGISDPQITEHLALYAGYVKQVNGLNEALAAMTGRGQASGKNPEFAELTRRLGFEYNGMLLHEHYFSSLRPAADPNPPSGSALAAALAESFGSVAQWQAAFHAIGELRGVGWVILFQDPATHWLTNQEGVPAGFKPLLVMDVWEHAFMRDYKATEKAKYVEAFFRNIDWQAVEHRLREESAVRPAAAA

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
158 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11689533 3300004798 Bacteria 700
2 Ga0058860_11955186 3300004801 Bacteria 695
3 Ga0058860_12112715 3300004801 Bacteria 930
4 Ga0065707_10116350 3300005295 Bacteria 2240
5 Ga0070676_10000511 3300005328 Bacteria 18619
6 Ga0070670_100075781 3300005331 Bacteria 2890
7 Ga0068869_100003089 3300005334 Bacteria 10143
8 Ga0070666_10273608 3300005335 Bacteria 1199
9 Ga0070680_100077107 3300005336 Bacteria 2745
10 Ga0070682_100002931 3300005337 Bacteria 9468
11 Ga0068868_100063653 3300005338 Bacteria 2926
12 Ga0070660_100002746 3300005339 Bacteria 12099
13 Ga0070689_100058468 3300005340 Bacteria 2994
14 Ga0070691_10010763 3300005341 Bacteria 4173
15 Ga0070661_100001190 3300005344 Bacteria 18360
16 Ga0070692_10025020 3300005345 Bacteria 2940
17 Ga0070669_100275790 3300005353 Bacteria 1346
18 Ga0070675_100282933 3300005354 Bacteria 1458
19 Ga0070673_100027615 3300005364 Bacteria 4209
20 Ga0070659_100004742 3300005366 Bacteria 9717
21 Ga0070703_10013321 3300005406 Bacteria 2335
22 Ga0070705_100012575 3300005440 Bacteria 4306
23 Ga0070694_100000075 3300005444 Bacteria 47763
24 Ga0070694_100000116 3300005444 Bacteria 38891
25 Ga0070694_100008467 3300005444 Bacteria 6292
26 Ga0070694_100017101 3300005444 Bacteria 4577
27 Ga0070708_100034263 3300005445 Bacteria 4416
28 Ga0070708_100074445 3300005445 Bacteria 3063
29 Ga0070708_100165213 3300005445 Bacteria 2064
30 Ga0070708_100275140 3300005445 Bacteria 1584
31 Ga0070708_100285388 3300005445 Bacteria 1554
32 Ga0070708_100297354 3300005445 Bacteria 1520
33 Ga0070708_100305060 3300005445 Bacteria 1499
34 Ga0070708_100354137 3300005445 Bacteria 1383
35 Ga0070708_100733283 3300005445 Bacteria 929
36 Ga0070663_100013766 3300005455 Bacteria 5173
37 Ga0070662_100002383 3300005457 Bacteria 11548
38 Ga0070681_10301354 3300005458 Bacteria 1512
39 Ga0070681_10551841 3300005458 Bacteria 1066
40 Ga0068867_100001933 3300005459 Bacteria 14438
41 Ga0068867_100376735 3300005459 Unclassified 1191
42 Ga0068867_100822340 3300005459 Bacteria 830
43 Ga0070706_100009685 3300005467 Bacteria 8954
44 Ga0070706_100015253 3300005467 Bacteria 7093
45 Ga0070706_100027912 3300005467 Bacteria 5192
46 Ga0070706_100328797 3300005467 Bacteria 1425
47 Ga0070706_100590099 3300005467 Bacteria 1033
48 Ga0070707_100028514 3300005468 Bacteria 5314
49 Ga0070707_100036914 3300005468 Bacteria 4664
50 Ga0070707_100062738 3300005468 Bacteria 3566
51 Ga0070707_100095679 3300005468 Bacteria 2876
52 Ga0070707_100521327 3300005468 Bacteria 1150
53 Ga0070698_100007345 3300005471 Bacteria 11929
54 Ga0070698_100041498 3300005471 Bacteria 4723
55 Ga0070698_100088346 3300005471 Bacteria 3085
56 Ga0070698_100169228 3300005471 Bacteria 2126
57 Ga0070698_100219241 3300005471 Bacteria 1836
58 Ga0070699_100005568 3300005518 Bacteria 11042
59 Ga0070699_100009767 3300005518 Bacteria 8302
60 Ga0070699_100291231 3300005518 Unclassified 1464
61 Ga0070699_100470125 3300005518 Bacteria 1141
62 Ga0070679_100049808 3300005530 Bacteria 4172
63 Ga0070684_100299333 3300005535 Bacteria 1476
64 Ga0070697_100007110 3300005536 Bacteria 8705
65 Ga0070697_100008056 3300005536 Bacteria 8219
66 Ga0070697_100013814 3300005536 Bacteria 6335
67 Ga0070697_100050339 3300005536 Bacteria 3381
68 Ga0070697_100058677 3300005536 Bacteria 3132
69 Ga0070697_100506022 3300005536 Bacteria 1056
70 Ga0068853_100003438 3300005539 Bacteria 12113
71 Ga0070695_100004280 3300005545 Bacteria 8349
72 Ga0070695_100018873 3300005545 Bacteria 4192
73 Ga0070695_100617043 3300005545 Unclassified 853
74 Ga0070696_100002014 3300005546 Bacteria 13327
75 Ga0070696_100212415 3300005546 Bacteria 1449
76 Ga0070696_100256293 3300005546 Bacteria 1325
77 Ga0070696_100301142 3300005546 Bacteria 1228
78 Ga0070696_100350839 3300005546 Bacteria 1143
79 Ga0070693_100067378 3300005547 Bacteria 2098
80 Ga0070704_100075391 3300005549 Bacteria 2464
81 Ga0070704_100076771 3300005549 Bacteria 2445
82 Ga0068855_100282070 3300005563 Bacteria 1844
83 Ga0068856_100111323 3300005614 Bacteria 2735
84 Ga0070702_100667812 3300005615 Unclassified 788
85 Ga0068859_100054000 3300005617 Bacteria 4040
86 Ga0068859_100064852 3300005617 Bacteria 3686
87 Ga0068859_100551621 3300005617 Bacteria 1247
88 Ga0068864_100041871 3300005618 Bacteria 3918
89 Ga0068866_10160244 3300005718 Bacteria 1311
90 Ga0068861_100041484 3300005719 Bacteria 3447
91 Ga0068861_100120721 3300005719 Bacteria 2114
92 Ga0068870_10008586 3300005840 Bacteria 4602
93 Ga0068863_100270582 3300005841 Bacteria 1644
94 Ga0068858_101296265 3300005842 Bacteria 717
95 Ga0068860_100171965 3300005843 Bacteria 2093
96 Ga0068862_100003295 3300005844 Bacteria 13970
97 Ga0068862_100087371 3300005844 Bacteria 2712
98 Ga0068862_100346460 3300005844 Unclassified 1377
99 Ga0081455_10024112 3300005937 Bacteria 5643
100 Ga0081455_10340821 3300005937 Unclassified 1061
101 Ga0081540_1019047 3300005983 Unclassified 4188
102 Ga0081539_10000002 3300005985 Bacteria 601032
103 Ga0075428_100006097 3300006844 Bacteria 13408
104 Ga0075428_100011162 3300006844 Bacteria 9995
105 Ga0075428_100011421 3300006844 Bacteria 9880
106 Ga0075428_100015425 3300006844 Bacteria 8470
107 Ga0075428_100040376 3300006844 Bacteria 5134
108 Ga0075428_100082923 3300006844 Bacteria 3498
109 Ga0075428_100175935 3300006844 Bacteria 2318
110 Ga0075428_100185254 3300006844 Unclassified 2253
111 Ga0075428_100441458 3300006844 Bacteria 1394
112 Ga0075430_100000647 3300006846 Bacteria 26556
113 Ga0075430_100010977 3300006846 Bacteria 7672
114 Ga0075430_100071989 3300006846 Bacteria 2899
115 Ga0075430_100145741 3300006846 Bacteria 1972
116 Ga0075430_100494040 3300006846 Bacteria 1010
117 Ga0075431_100002578 3300006847 Bacteria 17509
118 Ga0075431_100004635 3300006847 Bacteria 13502
119 Ga0075431_100009590 3300006847 Bacteria 9721
120 Ga0075431_100023269 3300006847 Bacteria 6338
121 Ga0075431_100025646 3300006847 Bacteria 6042
122 Ga0075431_100037293 3300006847 Bacteria 5009
123 Ga0075431_100057380 3300006847 Bacteria 4016
124 Ga0075431_100076001 3300006847 Bacteria 3466
125 Ga0075431_100094219 3300006847 Bacteria 3090
126 Ga0075431_100251435 3300006847 Unclassified 1796
127 Ga0075431_100339958 3300006847 Bacteria 1511
128 Ga0075431_100372777 3300006847 Bacteria 1432
129 Ga0075433_10000423 3300006852 Bacteria 27086
130 Ga0075433_10008518 3300006852 Bacteria 8179
131 Ga0075433_10008925 3300006852 Bacteria 8003
132 Ga0075433_10014900 3300006852 Bacteria 6363
133 Ga0075433_10106600 3300006852 Bacteria 2484
134 Ga0075433_10180433 3300006852 Bacteria 1879
135 Ga0075433_10310517 3300006852 Bacteria 1396
136 Ga0075433_10353349 3300006852 Bacteria 1299
137 Ga0075433_10364357 3300006852 Bacteria 1277
138 Ga0075433_10453276 3300006852 Bacteria 1131
139 Ga0075434_100031055 3300006871 Bacteria 5265
140 Ga0075434_100152018 3300006871 Bacteria 2335
141 Ga0075434_100323918 3300006871 Bacteria 1561
142 Ga0075434_100334524 3300006871 Bacteria 1535
143 Ga0075434_100424331 3300006871 Bacteria 1351
144 Ga0075434_100436357 3300006871 Unclassified 1331
145 Ga0075434_100519998 3300006871 Bacteria 1210
146 Ga0075434_100645475 3300006871 Bacteria 1077
147 Ga0075434_100708748 3300006871 Bacteria 1024
148 Ga0075429_100003550 3300006880 Bacteria 13290
149 Ga0075429_100006040 3300006880 Bacteria 10474
150 Ga0075429_100016852 3300006880 Bacteria 6322
151 Ga0075429_100039263 3300006880 Bacteria 4121
152 Ga0075429_100056205 3300006880 Bacteria 3425
153 Ga0075429_100097566 3300006880 Bacteria 2564
154 Ga0075429_100185657 3300006880 Bacteria 1822
155 Ga0075429_100308265 3300006880 Bacteria 1386
156 Ga0075429_100486300 3300006880 Bacteria 1081
157 Ga0068865_100592421 3300006881 Bacteria 936
158 Ga0075436_100006114 3300006914 Bacteria 8262
159 Ga0075436_100167064 3300006914 Bacteria 1553
160 Ga0075436_100203768 3300006914 Bacteria 1401
161 Ga0097620_100053998 3300006931 Bacteria 4040
162 Ga0097620_100064850 3300006931 Bacteria 3686
163 Ga0097620_100551577 3300006931 Bacteria 1247
164 Ga0075435_100008330 3300007076 Bacteria 7430
165 Ga0075435_100011334 3300007076 Bacteria 6553
166 Ga0075435_100023078 3300007076 Bacteria 4804
167 Ga0075435_100032795 3300007076 Bacteria 4103
168 Ga0075435_100049491 3300007076 Bacteria 3380
169 Ga0075435_100053454 3300007076 Bacteria 3257
170 Ga0075435_100057239 3300007076 Bacteria 3153
171 Ga0075435_100259646 3300007076 Bacteria 1480
172 Ga0075435_101069402 3300007076 Bacteria 705
173 Ga0099794_10024311 3300007265 Bacteria 2779
174 Ga0099794_10068353 3300007265 Bacteria 1737
175 Ga0099794_10125445 3300007265 Unclassified 1294
176 Ga0111539_10000122 3300009094 Bacteria 87286
177 Ga0111539_10003950 3300009094 Bacteria 19474
178 Ga0111539_10122923 3300009094 Bacteria 3042
179 Ga0111539_10397398 3300009094 Bacteria 1605
180 Ga0111539_10580813 3300009094 Unclassified 1305
181 Ga0114129_10000439 3300009147 Bacteria 49346
182 Ga0114129_10001249 3300009147 Bacteria 33890
183 Ga0114129_10004586 3300009147 Bacteria 19493
184 Ga0114129_10008384 3300009147 Bacteria 14725
185 Ga0114129_10011311 3300009147 Bacteria 12716
186 Ga0114129_10015348 3300009147 Bacteria 10898
187 Ga0114129_10031976 3300009147 Bacteria 7439
188 Ga0114129_10064562 3300009147 Bacteria 5110
189 Ga0114129_10099806 3300009147 Bacteria 4017
190 Ga0114129_10123209 3300009147 Bacteria 3566
191 Ga0114129_10163179 3300009147 Bacteria 3042
192 Ga0114129_10178773 3300009147 Bacteria 2889
193 Ga0114129_10184313 3300009147 Bacteria 2838
194 Ga0114129_10192638 3300009147 Bacteria 2767
195 Ga0114129_10195056 3300009147 Bacteria 2747
196 Ga0114129_10212927 3300009147 Bacteria 2611
197 Ga0114129_10229024 3300009147 Bacteria 2504
198 Ga0114129_10281563 3300009147 Bacteria 2221
199 Ga0114129_10378760 3300009147 Bacteria 1869
200 Ga0114129_10579419 3300009147 Bacteria 1456
201 Ga0114129_10785514 3300009147 Bacteria 1216
202 Ga0105243_10165077 3300009148 Bacteria 1913
203 Ga0105241_10000067 3300009174 Bacteria 79719
204 Ga0105241_10089667 3300009174 Bacteria 2423
205 Ga0105242_10412002 3300009176 Bacteria 1264
206 Ga0105248_10414379 3300009177 Bacteria 1517
207 Ga0105249_10387817 3300009553 Bacteria 1424
208 Ga0105249_10545226 3300009553 Bacteria 1210
209 Ga0105249_11173298 3300009553 Bacteria 839
210 Ga0157373_10000398 3300013100 Bacteria 34875
211 Ga0157369_10135236 3300013105 Bacteria 2610
212 Ga0157378_10347283 3300013297 Unclassified 1448
213 Ga0163162_10430773 3300013306 Unclassified 1451
214 Ga0163162_10572756 3300013306 Bacteria 1256
215 Ga0157372_10027845 3300013307 Bacteria 6160
216 Ga0157372_10343757 3300013307 Bacteria 1738
217 Ga0157375_10085411 3300013308 Bacteria 3206
218 Ga0157375_10254035 3300013308 Bacteria 1919
219 Ga0157380_10119075 3300014326 Bacteria 2233
220 Ga0157380_10228888 3300014326 Bacteria 1668
221 Ga0157377_10178718 3300014745 Bacteria 1333
222 Ga0157377_10199201 3300014745 Unclassified 1270
223 Ga0224712_10068158 3300022467 Bacteria 1437
224 Ga0224712_10291508 3300022467 Bacteria 761
225 Ga0207653_10003059 3300025885 Bacteria 5309
226 Ga0207653_10110341 3300025885 Bacteria 981
227 Ga0207645_10000406 3300025907 Bacteria 35625
228 Ga0207643_10000439 3300025908 Bacteria 27215
229 Ga0207684_10002380 3300025910 Bacteria 19025
230 Ga0207684_10008128 3300025910 Bacteria 9354
231 Ga0207684_10063810 3300025910 Bacteria 3127
232 Ga0207684_10097662 3300025910 Bacteria 2508
233 Ga0207684_10260208 3300025910 Bacteria 1497
234 Ga0207707_10000124 3300025912 Bacteria 79966
235 Ga0207663_10417759 3300025916 Bacteria 1029
236 Ga0207660_10006409 3300025917 Bacteria 7628
237 Ga0207660_10052397 3300025917 Bacteria 2905
238 Ga0207657_10000085 3300025919 Bacteria 89158
239 Ga0207649_10089428 3300025920 Bacteria 2013
240 Ga0207652_10000264 3300025921 Bacteria 54769
241 Ga0207646_10003351 3300025922 Bacteria 18176
242 Ga0207646_10008545 3300025922 Bacteria 10246
243 Ga0207646_10012323 3300025922 Bacteria 8222
244 Ga0207646_10016164 3300025922 Bacteria 7013
245 Ga0207646_10033162 3300025922 Bacteria 4672
246 Ga0207646_10037706 3300025922 Bacteria 4357
247 Ga0207646_10057844 3300025922 Bacteria 3464
248 Ga0207646_10103560 3300025922 Bacteria 2552
249 Ga0207681_10143897 3300025923 Bacteria 1779
250 Ga0207681_10461600 3300025923 Bacteria 1035
251 Ga0207650_10120989 3300025925 Bacteria 2038
252 Ga0207690_10038431 3300025932 Bacteria 3115
253 Ga0207706_10003538 3300025933 Bacteria 14917
254 Ga0207706_10082314 3300025933 Bacteria 2829
255 Ga0207709_10507766 3300025935 Bacteria 942
256 Ga0207670_10245831 3300025936 Bacteria 1380
257 Ga0207704_10275150 3300025938 Bacteria 1277
258 Ga0207691_10037554 3300025940 Bacteria 4485
259 Ga0207691_10973863 3300025940 Unclassified 708
260 Ga0207689_10000579 3300025942 Bacteria 34972
261 Ga0207689_10008697 3300025942 Bacteria 8834
262 Ga0207667_10101222 3300025949 Bacteria 2972
263 Ga0207712_10285044 3300025961 Bacteria 1349
264 Ga0207640_10002946 3300025981 Bacteria 9157
265 Ga0207677_10404016 3300026023 Bacteria 1159
266 Ga0207703_10218884 3300026035 Bacteria 1701
267 Ga0207703_10576259 3300026035 Bacteria 1063
268 Ga0207639_10117609 3300026041 Bacteria 2178
269 Ga0207678_10038916 3300026067 Bacteria 4129
270 Ga0207678_10254989 3300026067 Bacteria 1503
271 Ga0207641_10022933 3300026088 Bacteria 5142
272 Ga0207641_10388500 3300026088 Bacteria 1338
273 Ga0207648_10006511 3300026089 Bacteria 11597
274 Ga0207648_10612522 3300026089 Unclassified 1004
275 Ga0207648_10806863 3300026089 Bacteria 874
276 Ga0207676_10005191 3300026095 Bacteria 9216
277 Ga0207675_100016892 3300026118 Bacteria 6819
278 Ga0207675_100028417 3300026118 Bacteria 5207
279 Ga0207675_100275443 3300026118 Unclassified 1634
280 Ga0207675_100404853 3300026118 Bacteria 1345
281 Ga0207675_101203130 3300026118 Bacteria 778
282 Ga0209981_1025527 3300027378 Bacteria 855
283 Ga0209970_1004248 3300027614 Bacteria 2384
284 Ga0209983_1000006 3300027665 Bacteria 24144
285 Ga0209971_1000053 3300027682 Bacteria 37308
286 Ga0209966_1000266 3300027695 Bacteria 18647
287 Ga0209998_10000083 3300027717 Bacteria 37282
288 Ga0209974_10020741 3300027876 Bacteria 2178
289 Ga0209974_10038511 3300027876 Bacteria 1589
290 Ga0207428_10000033 3300027907 Bacteria 232081
291 Ga0207428_10151472 3300027907 Bacteria 1765
292 Ga0207428_10697737 3300027907 Bacteria 726
293 Ga0268265_10060192 3300028380 Bacteria 2909
294 Ga0268265_10063522 3300028380 Bacteria 2841
295 Ga0268265_10202159 3300028380 Bacteria 1724
296 Ga0268265_10722527 3300028380 Unclassified 964
297 Ga0268264_10070525 3300028381 Bacteria 2958
298 Ga0268264_10085808 3300028381 Bacteria 2703
299 Ga0307408_100346354 3300031548 Unclassified 1259
300 Ga0307410_10090357 3300031852 Bacteria 2172
301 Ga0307410_10158311 3300031852 Bacteria 1694
302 Ga0307416_100651515 3300032002 Bacteria 1138
303 Ga0307416_101676821 3300032002 Bacteria 740
304 Ga0307411_10197852 3300032005 Bacteria 1541
305 Ga0307411_10261695 3300032005 Bacteria 1366
306 Ga0307411_11091684 3300032005 Bacteria 719
307 Ga0373959_0052868 3300034820 Bacteria 881
308 Ga0373949_0134355 3300035090 Bacteria 704
309 Ga0373952_0025924 3300035092 Unclassified 1270
310 Ga0373932_0001934 3300035112 Bacteria 5499
311 Ga0373939_0034581 3300035114 Unclassified 1484
312 Ga0373960_0007876 3300035121 Bacteria 2536
313 Ga0373961_0143584 3300035241 Unclassified 808
314 Ga0373931_0062357 3300035691 Bacteria 2012
315 Ga0395899_0079906 3300037312 Bacteria 2381
316 Ga0395900_0002001 3300037418 Bacteria 23007
317 Ga0395898_0018739 3300037466 Bacteria 7054
318 Ga0395905_0215361 3300037471 Bacteria 1799
319 Ga0395905_0780356 3300037471 Unclassified 858
320 Ga0395901_0000506 3300038443 Bacteria 45146
321 Ga0395901_0015352 3300038443 Bacteria 7794
322 Ga0242420_028490 3300038996 Bacteria 1028
323 Ga0439458_0004698 3300042157 Bacteria 3113
324 Ga0439458_0048494 3300042157 Bacteria 1044
325 Ga0439444_0017563 3300042437 Bacteria 1230
326 Ga0439459_0022598 3300042438 Bacteria 1218
327 Ga0439460_0009583 3300042461 Bacteria 2460
328 Ga0439460_0063668 3300042461 Bacteria 1130
329 Ga0439460_0087339 3300042461 Unclassified 987
330 Ga0451577_0082703 3300042876 Bacteria 2864
331 Ga0451577_0103310 3300042876 Bacteria 2547
332 Ga0451577_0135248 3300042876 Bacteria 2213
333 Ga0451577_0384818 3300042876 Bacteria 1273
334 Ga0453683_0010371 3300044673 Bacteria 6176
335 Ga0453683_0042884 3300044673 Bacteria 2840
336 Ga0451576_0008158 3300045051 Bacteria 12329
337 Ga0451576_0027403 3300045051 Bacteria 6119
338 Ga0451576_0046122 3300045051 Bacteria 4589
339 Ga0451576_0248820 3300045051 Bacteria 1857
340 Ga0451576_0385986 3300045051 Unclassified 1468
341 Ga0451576_0451726 3300045051 Bacteria 1349
342 Ga0495580_0000545 3300046472 Bacteria 31827
343 Ga0495580_0098535 3300046472 Bacteria 2033
344 Ga0495580_0105561 3300046472 Bacteria 1957
345 Ga0495584_0124715 3300046491 Bacteria 1305
346 Ga0495659_0077219 3300046664 Unclassified 1258
347 Ga0495669_0126592 3300046684 Unclassified 1201
348 Ga0495670_0352483 3300046691 Unclassified 792
349 Ga0496101_0758302 3300048904 Bacteria 766
350 Ga0496102_0018364 3300048905 Bacteria 6144
351 Ga0496102_0110028 3300048905 Bacteria 2568
352 Ga0496106_0080046 3300048909 Bacteria 2509
353 Ga0496107_0112497 3300048910 Bacteria 2002
354 Ga0501290_016192 3300049513 Bacteria 992
355 Ga0501292_030173 3300049515 Bacteria 909
356 Ga0501298_075720 3300049521 Bacteria 733
357 Ga0501299_008100 3300049522 Bacteria 1700
358 Ga0501031_0021370 3300049568 Bacteria 4219
359 Ga0501033_0046375 3300049570 Bacteria 3232
360 Ga0501033_0059811 3300049570 Bacteria 2813
361 Ga0501033_0077750 3300049570 Bacteria 2435
362 Ga0501036_0002194 3300049572 Bacteria 15254
363 Ga0501036_0011211 3300049572 Bacteria 7416
364 Ga0501036_0012994 3300049572 Bacteria 6913
365 Ga0501036_0098851 3300049572 Bacteria 2468
366 Ga0501037_0184616 3300049573 Unclassified 1479
367 Ga0501037_0361501 3300049573 Bacteria 1000
368 Ga0501037_0411746 3300049573 Bacteria 926
369 Ga0501038_0003015 3300049574 Bacteria 15701
370 Ga0501038_0032957 3300049574 Bacteria 4564
371 Ga0501038_0076909 3300049574 Bacteria 2819
372 Ga0501038_0141659 3300049574 Bacteria 1966
373 Ga0501038_0210424 3300049574 Bacteria 1556
374 Ga0501038_0441533 3300049574 Bacteria 1002
375 Ga0501038_0598975 3300049574 Bacteria 834
376 Ga0501038_0619721 3300049574 Bacteria 817
377 Ga0501039_0028341 3300049575 Bacteria 4311
378 Ga0501039_0059579 3300049575 Bacteria 2957
379 Ga0501039_0087764 3300049575 Unclassified 2423
380 Ga0501039_0210846 3300049575 Bacteria 1528
381 Ga0501039_0221096 3300049575 Bacteria 1489
382 Ga0501039_0233672 3300049575 Bacteria 1445
383 Ga0501040_0000517 3300049576 Bacteria 23113
384 Ga0501040_0003453 3300049576 Bacteria 10199
385 Ga0501040_0005290 3300049576 Bacteria 8347
386 Ga0501040_0005709 3300049576 Bacteria 8050
387 Ga0501040_0134478 3300049576 Bacteria 1740
388 Ga0501040_0141777 3300049576 Bacteria 1693
389 Ga0501040_0173624 3300049576 Bacteria 1527
390 Ga0501040_0208081 3300049576 Bacteria 1390
391 Ga0501040_0430330 3300049576 Bacteria 949
392 Ga0501041_0001305 3300049577 Bacteria 13711
393 Ga0501041_0005451 3300049577 Bacteria 7450
394 Ga0501041_0005901 3300049577 Bacteria 7157
395 Ga0501041_0026681 3300049577 Bacteria 3476
396 Ga0501041_0036506 3300049577 Bacteria 2977
397 Ga0501041_0039235 3300049577 Bacteria 2874
398 Ga0501041_0177926 3300049577 Bacteria 1331
399 Ga0501041_0191823 3300049577 Bacteria 1280
400 Ga0501041_0423468 3300049577 Bacteria 844
401 Ga0501042_0000656 3300049578 Bacteria 18578
402 Ga0501042_0015940 3300049578 Bacteria 5154
403 Ga0501042_0083867 3300049578 Unclassified 2284
404 Ga0501042_0151474 3300049578 Bacteria 1672
405 Ga0501042_0157058 3300049578 Bacteria 1641
406 Ga0501042_0387679 3300049578 Bacteria 1012
407 Ga0501042_0477895 3300049578 Unclassified 904
408 Ga0501043_0153575 3300049579 Bacteria 1801
409 Ga0501046_0007755 3300049580 Bacteria 9417
410 Ga0501046_0009018 3300049580 Bacteria 8649
411 Ga0501046_0132753 3300049580 Bacteria 1888
412 Ga0501046_0238810 3300049580 Bacteria 1341
413 Ga0501046_0331983 3300049580 Bacteria 1106
414 Ga0501047_0020667 3300049581 Bacteria 6321
415 Ga0501048_0001395 3300049582 Bacteria 18319
416 Ga0501048_0010878 3300049582 Bacteria 6786
417 Ga0501048_0049956 3300049582 Bacteria 2979
418 Ga0501048_0057315 3300049582 Bacteria 2763
419 Ga0501067_0149863 3300049583 Bacteria 1299
420 Ga0501068_0033284 3300049584 Bacteria 3069
421 Ga0501068_0043910 3300049584 Bacteria 2690
422 Ga0501068_0352964 3300049584 Bacteria 945
423 Ga0501069_0092002 3300049585 Bacteria 1716
424 Ga0501069_0132468 3300049585 Bacteria 1428
425 Ga0501070_0035967 3300049586 Bacteria 4136
426 Ga0501070_0351514 3300049586 Bacteria 1196
427 Ga0501071_0000310 3300049587 Bacteria 23357
428 Ga0501071_0025796 3300049587 Bacteria 4119
429 Ga0501071_0113454 3300049587 Unclassified 2004
430 Ga0501071_0219417 3300049587 Bacteria 1431
431 Ga0501071_0249706 3300049587 Bacteria 1339
432 Ga0501072_0000642 3300049588 Bacteria 25065
433 Ga0501072_0007106 3300049588 Bacteria 8497
434 Ga0501072_0024337 3300049588 Bacteria 4710
435 Ga0501072_0043461 3300049588 Bacteria 3531
436 Ga0501072_0082547 3300049588 Bacteria 2548
437 Ga0501072_0085551 3300049588 Bacteria 2501
438 Ga0501072_0091346 3300049588 Bacteria 2417
439 Ga0501072_0272981 3300049588 Bacteria 1345
440 Ga0501072_0305032 3300049588 Bacteria 1266
441 Ga0501072_0406774 3300049588 Bacteria 1079
442 Ga0501072_0549280 3300049588 Bacteria 912
443 Ga0501074_0000460 3300049590 Bacteria 24494
444 Ga0501074_0014360 3300049590 Bacteria 5763
445 Ga0501074_0142163 3300049590 Bacteria 1716
446 Ga0501074_0163178 3300049590 Bacteria 1591
447 Ga0501075_0000003 3300049591 Bacteria 173182
448 Ga0501075_0000200 3300049591 Bacteria 31730
449 Ga0501075_0003950 3300049591 Bacteria 9990
450 Ga0501075_0030465 3300049591 Bacteria 3997
451 Ga0501075_0049513 3300049591 Bacteria 3158
452 Ga0501075_0072650 3300049591 Bacteria 2601
453 Ga0501075_0090102 3300049591 Bacteria 2327
454 Ga0501075_0142929 3300049591 Bacteria 1824
455 Ga0501075_0626299 3300049591 Bacteria 820
456 Ga0501075_0640867 3300049591 Archaea 810
457 Ga0501075_0850311 3300049591 Bacteria 694
458 Ga0501076_0000010 3300049592 Bacteria 116774
459 Ga0501076_0000868 3300049592 Bacteria 19647
460 Ga0501076_0028545 3300049592 Bacteria 4333
461 Ga0501076_0036622 3300049592 Bacteria 3845
462 Ga0501076_0038015 3300049592 Bacteria 3777
463 Ga0501076_0088158 3300049592 Bacteria 2494
464 Ga0501076_0115229 3300049592 Bacteria 2175
465 Ga0501076_0140587 3300049592 Bacteria 1961
466 Ga0501076_0230981 3300049592 Bacteria 1512
467 Ga0501076_0324836 3300049592 Bacteria 1262
468 Ga0501077_0000171 3300049593 Bacteria 37157
469 Ga0501077_0048521 3300049593 Bacteria 2698
470 Ga0501077_0057620 3300049593 Bacteria 2466
471 Ga0501077_0076316 3300049593 Bacteria 2123
472 Ga0501079_0001602 3300049741 Bacteria 16109
473 Ga0501079_0007978 3300049741 Bacteria 8022
474 Ga0501079_0009344 3300049741 Bacteria 7431
475 Ga0501079_0011807 3300049741 Bacteria 6670
476 Ga0501079_0011947 3300049741 Bacteria 6627
477 Ga0501079_0122282 3300049741 Unclassified 2024
478 Ga0501079_0159801 3300049741 Bacteria 1757
479 Ga0501079_0420806 3300049741 Bacteria 1049
480 Ga0501079_0430141 3300049741 Unclassified 1036
481 Ga0501080_0036903 3300049742 Bacteria 4562
482 Ga0501080_0180659 3300049742 Unclassified 1942
483 Ga0501080_0280110 3300049742 Bacteria 1516
484 Ga0501080_0281866 3300049742 Bacteria 1511
485 Ga0501081_0000019 3300049743 Bacteria 56581
486 Ga0501081_0000618 3300049743 Bacteria 20298
487 Ga0501081_0004472 3300049743 Bacteria 8967
488 Ga0501081_0006317 3300049743 Bacteria 7681
489 Ga0501081_0009366 3300049743 Bacteria 6382
490 Ga0501081_0021237 3300049743 Bacteria 4332
491 Ga0501081_0035498 3300049743 Bacteria 3394
492 Ga0501081_0272546 3300049743 Bacteria 1238
493 Ga0501081_0285936 3300049743 Bacteria 1208
494 Ga0501081_0347724 3300049743 Bacteria 1092
495 Ga0501081_0367940 3300049743 Bacteria 1061
496 Ga0501083_0054764 3300049744 Bacteria 2676
497 Ga0501083_0068550 3300049744 Bacteria 2361
498 Ga0501083_0181941 3300049744 Bacteria 1372
499 Ga0501035_0051281 3300049822 Bacteria 3695
500 Ga0501035_0084820 3300049822 Bacteria 2793
501 Ga0501035_0205097 3300049822 Bacteria 1689
502 Ga0501044_0893199 3300049823 Bacteria 764
503 Ga0501045_0000013 3300049824 Bacteria 73989
504 Ga0501045_0003706 3300049824 Bacteria 10511
505 Ga0501045_0022050 3300049824 Bacteria 4557
506 Ga0501045_0024044 3300049824 Bacteria 4373
507 Ga0501045_0049003 3300049824 Bacteria 3080
508 Ga0501045_0085066 3300049824 Unclassified 2334
509 Ga0501045_0239822 3300049824 Bacteria 1350
510 Ga0501045_0489999 3300049824 Unclassified 913
511 nmdc:mga05p37_108685_c1 3300050507 Bacteria 3412
512 nmdc:mga05p37_112684_c1 3300050507 Bacteria 3345
513 nmdc:mga05p37_12745_c1 3300050507 Bacteria 10052
514 nmdc:mga05p37_176674_c1 3300050507 Bacteria 2601
515 nmdc:mga05p37_187771_c1 3300050507 Bacteria 2512
516 nmdc:mga05p37_201989_c1 3300050507 Bacteria 2407
517 nmdc:mga05p37_2058_c1 3300050507 Bacteria 23449
518 nmdc:mga05p37_227723_c1 3300050507 Bacteria 2247
519 nmdc:mga05p37_317883_c1 3300050507 Bacteria 1844
520 nmdc:mga05p37_34802_c1 3300050507 Bacteria 5416
521 nmdc:mga05p37_364155_c1 3300050507 Bacteria 1699
522 nmdc:mga05p37_378021_c1 3300050507 Bacteria 1661
523 nmdc:mga05p37_3858_c1 3300050507 Bacteria 9061
524 nmdc:mga05p37_454833_c1 3300050507 Bacteria 1481
525 nmdc:mga05p37_46742_c1 3300050507 Bacteria 5322
526 nmdc:mga05p37_4699_c1 3300050507 Bacteria 15950
527 nmdc:mga05p37_682318_c1 3300050507 Unclassified 1145
528 nmdc:mga05p37_685159_c1 3300050507 Bacteria 1142
529 nmdc:mga05p37_7483_c1 3300050507 Bacteria 12876
530 nmdc:mga05p37_91501_c1 3300050507 Bacteria 3748
531 nmdc:mga05p37_94147_c1 3300050507 Bacteria 3691
532 nmdc:mga09592_19515_c1 3300050508 Bacteria 5568
533 nmdc:mga09592_273319_c1 3300050508 Bacteria 1466
534 nmdc:mga09592_31416_c1 3300050508 Bacteria 4425
535 nmdc:mga09592_36834_c1 3300050508 Bacteria 4100
536 nmdc:mga09592_472834_c1 3300050508 Unclassified 1080
537 nmdc:mga09592_52066_c1 3300050508 Bacteria 3455
538 nmdc:mga0qj67_12237_c1 3300050509 Bacteria 6461
539 nmdc:mga0qj67_1548_c1 3300050509 Bacteria 16140
540 nmdc:mga0qj67_211759_c1 3300050509 Bacteria 1574
541 nmdc:mga0qj67_27387_c1 3300050509 Bacteria 4418
542 nmdc:mga0qj67_89963_c1 3300050509 Bacteria 2465
543 nmdc:mga06r32_106945_c1 3300050510 Unclassified 2749
544 nmdc:mga06r32_130421_c1 3300050510 Bacteria 2486
545 nmdc:mga06r32_148066_c1 3300050510 Unclassified 2325
546 nmdc:mga06r32_14886_c1 3300050510 Bacteria 7058
547 nmdc:mga06r32_220849_c1 3300050510 Bacteria 1883
548 nmdc:mga06r32_221871_c1 3300050510 Bacteria 1879
549 nmdc:mga06r32_30838_c1 3300050510 Bacteria 5031
550 nmdc:mga06r32_3605_c1 3300050510 Bacteria 13817
551 nmdc:mga06r32_55702_c1 3300050510 Bacteria 3794
552 nmdc:mga06r32_777324_c1 3300050510 Unclassified 919
553 nmdc:mga08y16_10576_c1 3300050511 Bacteria 9684
554 nmdc:mga08y16_1358968_c1 3300050511 Bacteria 675
555 nmdc:mga08y16_23200_c1 3300050511 Bacteria 6550
556 nmdc:mga08y16_454772_c1 3300050511 Unclassified 1305
557 nmdc:mga08y16_515123_c1 3300050511 Bacteria 1214
558 nmdc:mga0n895_102752_c1 3300050512 Bacteria 2869
559 nmdc:mga0n895_195215_c1 3300050512 Unclassified 2055
560 nmdc:mga0n895_22977_c1 3300050512 Bacteria 5854
561 nmdc:mga0n895_23856_c1 3300050512 Bacteria 5757
562 nmdc:mga0n895_254853_c1 3300050512 Bacteria 1781
563 nmdc:mga0n895_369708_c1 3300050512 Bacteria 1452
564 nmdc:mga0n895_55399_c1 3300050512 Bacteria 3903
565 nmdc:mga0n895_557357_c1 3300050512 Unclassified 1151
566 nmdc:mga0rr50_1027_c1 3300050513 Bacteria 15146
567 nmdc:mga0rr50_11272_c1 3300050513 Bacteria 5714
568 nmdc:mga0rr50_185167_c1 3300050513 Bacteria 1704
569 nmdc:mga0rr50_34273_c1 3300050513 Bacteria 3634
570 nmdc:mga0rr50_40556_c1 3300050513 Bacteria 3386
571 nmdc:mga0rr50_46281_c1 3300050513 Bacteria 3203
572 nmdc:mga08x19_10951_c1 3300050514 Bacteria 5456
573 nmdc:mga08x19_176721_c1 3300050514 Bacteria 1456
574 nmdc:mga0a205_114774_c1 3300050515 Bacteria 2592
575 nmdc:mga0a205_150209_c1 3300050515 Unclassified 2230
576 nmdc:mga0a205_161179_c1 3300050515 Bacteria 2140
577 nmdc:mga0a205_17873_c1 3300050515 Bacteria 6655
578 nmdc:mga0a205_263970_c1 3300050515 Bacteria 1599
579 nmdc:mga0a205_331748_c1 3300050515 Unclassified 1391
580 nmdc:mga0a205_3408_c1 3300050515 Bacteria 14171
581 nmdc:mga0a205_478120_c1 3300050515 Bacteria 1104
582 nmdc:mga0a205_536054_c1 3300050515 Unclassified 1026
583 nmdc:mga0a205_60135_c1 3300050515 Bacteria 3670
584 nmdc:mga0a205_8240_c1 3300050515 Bacteria 9473
585 nmdc:mga0a205_90189_c1 3300050515 Bacteria 2962
586 nmdc:mga0a205_97598_c1 3300050515 Bacteria 2837
587 Ga0501084_0000482 3300054114 Bacteria 30469
588 Ga0501084_0001427 3300054114 Bacteria 18952
589 Ga0501084_0007855 3300054114 Bacteria 8779
590 Ga0501084_0023316 3300054114 Bacteria 5167
591 Ga0501084_0037416 3300054114 Bacteria 4054
592 Ga0501084_0058981 3300054114 Bacteria 3212
593 Ga0501084_0063331 3300054114 Bacteria 3096
594 Ga0501084_0091133 3300054114 Bacteria 2560
595 Ga0501084_0245288 3300054114 Bacteria 1512
596 Ga0501084_0294431 3300054114 Bacteria 1371
597 Ga0501084_0388450 3300054114 Bacteria 1179
598 Ga0501084_0523590 3300054114 Unclassified 1002
599 Ga0501084_0911705 3300054114 Bacteria 739
600 Ga0501084_0923464 3300054114 Bacteria 734
601 Ga0501084_1018091 3300054114 Bacteria 696
602 Ga0590075_102529 3300059424 Bacteria 745
603 Ga0501082_0000752 3300060353 Bacteria 28466
604 Ga0501082_0002328 3300060353 Bacteria 16621
605 Ga0501082_0005201 3300060353 Bacteria 11313
606 Ga0501082_0020773 3300060353 Bacteria 5662
607 Ga0501082_0217974 3300060353 Bacteria 1660
608 Ga0530510_0000008 3300061734 Bacteria 165671
609 Ga0530510_0000706 3300061734 Bacteria 21648
610 Ga0530510_0013201 3300061734 Bacteria 5809
611 Ga0530510_0019068 3300061734 Bacteria 4865
612 Ga0530510_0027979 3300061734 Bacteria 4041
613 Ga0530510_0055100 3300061734 Bacteria 2873
614 Ga0530510_0068834 3300061734 Bacteria 2568
615 Ga0530510_0072266 3300061734 Bacteria 2504
616 Ga0530510_0102316 3300061734 Bacteria 2095
617 Ga0530510_0129223 3300061734 Bacteria 1858
618 Ga0530510_0702392 3300061734 Unclassified 771
619 Ga0530510_0795585 3300061734 Bacteria 721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100076001 Ga0075431_1000760014 197
2 3300050510 nmdc:mga06r32_3605_c1 nmdc:mga06r32_3605_c1_11764_12396 197
3 3300005468 Ga0070707_100036914 Ga0070707_1000369145 205
4 3300005471 Ga0070698_100088346 Ga0070698_1000883465 205
5 3300025922 Ga0207646_10037706 Ga0207646_100377063 205
6 3300026089 Ga0207648_10612522 Ga0207648_106125222 206
7 3300042876 Ga0451577_0103310 Ga0451577_0103310_1866_2504 206
8 3300005295 Ga0065707_10116350 Ga0065707_101163503 207
9 3300005615 Ga0070702_100667812 Ga0070702_1006678121 207
10 3300005844 Ga0068862_100346460 Ga0068862_1003464601 207
11 3300005937 Ga0081455_10340821 Ga0081455_103408211 207
12 3300005985 Ga0081539_10000002 Ga0081539_10000002571 207
13 3300006844 Ga0075428_100011421 Ga0075428_1000114214 207
14 3300006844 Ga0075428_100040376 Ga0075428_1000403765 207
15 3300006846 Ga0075430_100494040 Ga0075430_1004940402 207
16 3300006847 Ga0075431_100002578 Ga0075431_1000025789 207
17 3300006847 Ga0075431_100251435 Ga0075431_1002514352 207
18 3300006852 Ga0075433_10106600 Ga0075433_101066002 207
19 3300006871 Ga0075434_100334524 Ga0075434_1003345241 207
20 3300006880 Ga0075429_100006040 Ga0075429_1000060409 207
21 3300006880 Ga0075429_100185657 Ga0075429_1001856572 207
22 3300007076 Ga0075435_100008330 Ga0075435_1000083304 207
23 3300007076 Ga0075435_101069402 Ga0075435_1010694021 207
24 3300007265 Ga0099794_10125445 Ga0099794_101254452 207
25 3300009094 Ga0111539_10122923 Ga0111539_101229233 207
26 3300009147 Ga0114129_10015348 Ga0114129_100153486 207
27 3300009147 Ga0114129_10123209 Ga0114129_101232092 207
28 3300009147 Ga0114129_10163179 Ga0114129_101631793 207
29 3300013306 Ga0163162_10430773 Ga0163162_104307733 207
30 3300025940 Ga0207691_10973863 Ga0207691_109738631 207
31 3300028380 Ga0268265_10722527 Ga0268265_107225272 207
32 3300042461 Ga0439460_0087339 Ga0439460_0087339_302_958 207
33 3300049588 Ga0501072_0085551 Ga0501072_0085551_1841_2464 207
34 3300050507 nmdc:mga05p37_12745_c1 nmdc:mga05p37_12745_c1_5248_5871 207
35 3300050507 nmdc:mga05p37_317883_c1 nmdc:mga05p37_317883_c1_600_1223 207
36 3300050507 nmdc:mga05p37_46742_c1 nmdc:mga05p37_46742_c1_1086_1709 207
37 3300050507 nmdc:mga05p37_682318_c1 nmdc:mga05p37_682318_c1_144_767 207
38 3300050508 nmdc:mga09592_19515_c1 nmdc:mga09592_19515_c1_400_1023 207
39 3300050508 nmdc:mga09592_273319_c1 nmdc:mga09592_273319_c1_644_1267 207
40 3300050510 nmdc:mga06r32_148066_c1 nmdc:mga06r32_148066_c1_900_1523 207
41 3300050510 nmdc:mga06r32_14886_c1 nmdc:mga06r32_14886_c1_5248_5871 207
42 3300050510 nmdc:mga06r32_220849_c1 nmdc:mga06r32_220849_c1_1177_1800 207
43 3300050512 nmdc:mga0n895_102752_c1 nmdc:mga0n895_102752_c1_401_1024 207
44 3300050515 nmdc:mga0a205_150209_c1 nmdc:mga0a205_150209_c1_97_720 207
45 3300050515 nmdc:mga0a205_263970_c1 nmdc:mga0a205_263970_c1_626_1249 207
46 3300050515 nmdc:mga0a205_60135_c1 nmdc:mga0a205_60135_c1_21_644 207
47 3300004801 Ga0058860_12112715 Ga0058860_121127151 208
48 3300005445 Ga0070708_100034263 Ga0070708_1000342635 208
49 3300005467 Ga0070706_100015253 Ga0070706_1000152537 208
50 3300005468 Ga0070707_100095679 Ga0070707_1000956792 208
51 3300005471 Ga0070698_100007345 Ga0070698_1000073457 208
52 3300005518 Ga0070699_100009767 Ga0070699_1000097677 208
53 3300005536 Ga0070697_100013814 Ga0070697_10001381413 208
54 3300005545 Ga0070695_100617043 Ga0070695_1006170431 208
55 3300005546 Ga0070696_100350839 Ga0070696_1003508392 208
56 3300005842 Ga0068858_101296265 Ga0068858_1012962651 208
57 3300006846 Ga0075430_100071989 Ga0075430_1000719893 208
58 3300006847 Ga0075431_100004635 Ga0075431_10000463516 208
59 3300006847 Ga0075431_100057380 Ga0075431_1000573803 208
60 3300006852 Ga0075433_10014900 Ga0075433_100149005 208
61 3300006852 Ga0075433_10453276 Ga0075433_104532762 208
62 3300006871 Ga0075434_100519998 Ga0075434_1005199982 208
63 3300006880 Ga0075429_100003550 Ga0075429_1000035508 208
64 3300006914 Ga0075436_100006114 Ga0075436_1000061149 208
65 3300006914 Ga0075436_100203768 Ga0075436_1002037682 208
66 3300007076 Ga0075435_100057239 Ga0075435_1000572394 208
67 3300007265 Ga0099794_10024311 Ga0099794_100243112 208
68 3300009147 Ga0114129_10008384 Ga0114129_1000838413 208
69 3300009147 Ga0114129_10031976 Ga0114129_100319766 208
70 3300009177 Ga0105248_10414379 Ga0105248_104143793 208
71 3300013306 Ga0163162_10572756 Ga0163162_105727562 208
72 3300025910 Ga0207684_10008128 Ga0207684_100081287 208
73 3300025922 Ga0207646_10008545 Ga0207646_100085458 208
74 3300027907 Ga0207428_10697737 Ga0207428_106977371 208
75 3300037471 Ga0395905_0780356 Ga0395905_0780356_141_767 208
76 3300038443 Ga0395901_0015352 Ga0395901_0015352_2553_3179 208
77 3300049574 Ga0501038_0141659 Ga0501038_0141659_34_672 208
78 3300049575 Ga0501039_0059579 Ga0501039_0059579_434_1072 208
79 3300049577 Ga0501041_0039235 Ga0501041_0039235_1275_1913 208
80 3300049578 Ga0501042_0151474 Ga0501042_0151474_944_1582 208
81 3300049580 Ga0501046_0331983 Ga0501046_0331983_325_963 208
82 3300049585 Ga0501069_0092002 Ga0501069_0092002_328_966 208
83 3300049588 Ga0501072_0007106 Ga0501072_0007106_5728_6366 208
84 3300049590 Ga0501074_0163178 Ga0501074_0163178_236_874 208
85 3300049591 Ga0501075_0072650 Ga0501075_0072650_1886_2524 208
86 3300049591 Ga0501075_0850311 Ga0501075_0850311_23_649 208
87 3300049592 Ga0501076_0140587 Ga0501076_0140587_1072_1710 208
88 3300049741 Ga0501079_0420806 Ga0501079_0420806_373_1011 208
89 3300049743 Ga0501081_0009366 Ga0501081_0009366_93_719 208
90 3300049743 Ga0501081_0035498 Ga0501081_0035498_2632_3270 208
91 3300049824 Ga0501045_0024044 Ga0501045_0024044_3580_4218 208
92 3300050507 nmdc:mga05p37_3858_c1 nmdc:mga05p37_3858_c1_3421_4047 208
93 3300050508 nmdc:mga09592_31416_c1 nmdc:mga09592_31416_c1_229_855 208
94 3300050511 nmdc:mga08y16_1358968_c1 nmdc:mga08y16_1358968_c1_17_655 208
95 3300050512 nmdc:mga0n895_23856_c1 nmdc:mga0n895_23856_c1_1774_2400 208
96 3300050513 nmdc:mga0rr50_11272_c1 nmdc:mga0rr50_11272_c1_1608_2234 208
97 3300050514 nmdc:mga08x19_10951_c1 nmdc:mga08x19_10951_c1_3537_4163 208
98 3300050514 nmdc:mga08x19_176721_c1 nmdc:mga08x19_176721_c1_347_982 208
99 3300050515 nmdc:mga0a205_17873_c1 nmdc:mga0a205_17873_c1_4736_5362 208
100 3300050515 nmdc:mga0a205_478120_c1 nmdc:mga0a205_478120_c1_38_676 208
101 3300050515 nmdc:mga0a205_90189_c1 nmdc:mga0a205_90189_c1_247_882 208
102 3300054114 Ga0501084_0023316 Ga0501084_0023316_1274_1912 208
103 3300054114 Ga0501084_0388450 Ga0501084_0388450_357_983 208
104 3300005536 Ga0070697_100058677 Ga0070697_1000586772 209
105 3300005983 Ga0081540_1019047 Ga0081540_10190472 209
106 3300006844 Ga0075428_100011162 Ga0075428_1000111629 209
107 3300006847 Ga0075431_100009590 Ga0075431_1000095907 209
108 3300006847 Ga0075431_100339958 Ga0075431_1003399582 209
109 3300006847 Ga0075431_100372777 Ga0075431_1003727773 209
110 3300006852 Ga0075433_10008925 Ga0075433_100089255 209
111 3300006852 Ga0075433_10364357 Ga0075433_103643571 209
112 3300006871 Ga0075434_100152018 Ga0075434_1001520182 209
113 3300006880 Ga0075429_100056205 Ga0075429_1000562057 209
114 3300006880 Ga0075429_100097566 Ga0075429_1000975662 209
115 3300006880 Ga0075429_100486300 Ga0075429_1004863001 209
116 3300007076 Ga0075435_100049491 Ga0075435_1000494913 209
117 3300007076 Ga0075435_100259646 Ga0075435_1002596462 209
118 3300009094 Ga0111539_10000122 Ga0111539_1000012247 209
119 3300009147 Ga0114129_10184313 Ga0114129_101843132 209
120 3300009147 Ga0114129_10212927 Ga0114129_102129273 209
121 3300009147 Ga0114129_10785514 Ga0114129_107855142 209
122 3300025910 Ga0207684_10260208 Ga0207684_102602082 209
123 3300025922 Ga0207646_10033162 Ga0207646_100331622 209
124 3300026118 Ga0207675_100275443 Ga0207675_1002754432 209
125 3300027378 Ga0209981_1025527 Ga0209981_10255271 209
126 3300027876 Ga0209974_10020741 Ga0209974_100207412 209
127 3300027907 Ga0207428_10000033 Ga0207428_10000033124 209
128 3300031548 Ga0307408_100346354 Ga0307408_1003463542 209
129 3300031852 Ga0307410_10158311 Ga0307410_101583112 209
130 3300032002 Ga0307416_100651515 Ga0307416_1006515151 209
131 3300032005 Ga0307411_11091684 Ga0307411_110916841 209
132 3300035092 Ga0373952_0025924 Ga0373952_0025924_368_1006 209
133 3300035112 Ga0373932_0001934 Ga0373932_0001934_4364_5002 209
134 3300035114 Ga0373939_0034581 Ga0373939_0034581_590_1228 209
135 3300035241 Ga0373961_0143584 Ga0373961_0143584_130_768 209
136 3300038996 Ga0242420_028490 Ga0242420_028490_226_855 209
137 3300045051 Ga0451576_0385986 Ga0451576_0385986_384_1022 209
138 3300049572 Ga0501036_0011211 Ga0501036_0011211_501_1130 209
139 3300049573 Ga0501037_0411746 Ga0501037_0411746_83_712 209
140 3300049574 Ga0501038_0441533 Ga0501038_0441533_293_922 209
141 3300049575 Ga0501039_0233672 Ga0501039_0233672_276_905 209
142 3300049576 Ga0501040_0005709 Ga0501040_0005709_5468_6097 209
143 3300049576 Ga0501040_0430330 Ga0501040_0430330_50_679 209
144 3300049577 Ga0501041_0005451 Ga0501041_0005451_4658_5287 209
145 3300049577 Ga0501041_0177926 Ga0501041_0177926_563_1192 209
146 3300049580 Ga0501046_0132753 Ga0501046_0132753_470_1099 209
147 3300049582 Ga0501048_0049956 Ga0501048_0049956_74_703 209
148 3300049583 Ga0501067_0149863 Ga0501067_0149863_639_1268 209
149 3300049584 Ga0501068_0352964 Ga0501068_0352964_240_869 209
150 3300049586 Ga0501070_0035967 Ga0501070_0035967_56_685 209
151 3300049587 Ga0501071_0025796 Ga0501071_0025796_3011_3640 209
152 3300049587 Ga0501071_0113454 Ga0501071_0113454_1251_1880 209
153 3300049588 Ga0501072_0043461 Ga0501072_0043461_1245_1874 209
154 3300049591 Ga0501075_0003950 Ga0501075_0003950_5357_5986 209
155 3300049591 Ga0501075_0030465 Ga0501075_0030465_2449_3078 209
156 3300049591 Ga0501075_0142929 Ga0501075_0142929_1041_1670 209
157 3300049592 Ga0501076_0038015 Ga0501076_0038015_347_976 209
158 3300049593 Ga0501077_0057620 Ga0501077_0057620_711_1340 209
159 3300049741 Ga0501079_0007978 Ga0501079_0007978_515_1144 209
160 3300049741 Ga0501079_0009344 Ga0501079_0009344_5213_5842 209
161 3300049743 Ga0501081_0021237 Ga0501081_0021237_3032_3661 209
162 3300049743 Ga0501081_0347724 Ga0501081_0347724_396_1073 209
163 3300049744 Ga0501083_0181941 Ga0501083_0181941_481_1110 209
164 3300049822 Ga0501035_0205097 Ga0501035_0205097_457_1086 209
165 3300049823 Ga0501044_0893199 Ga0501044_0893199_97_726 209
166 3300049824 Ga0501045_0022050 Ga0501045_0022050_1011_1640 209
167 3300049824 Ga0501045_0049003 Ga0501045_0049003_1345_1974 209
168 3300050507 nmdc:mga05p37_187771_c1 nmdc:mga05p37_187771_c1_724_1353 209
169 3300050507 nmdc:mga05p37_7483_c1 nmdc:mga05p37_7483_c1_4146_4784 209
170 3300050507 nmdc:mga05p37_94147_c1 nmdc:mga05p37_94147_c1_2295_2924 209
171 3300050508 nmdc:mga09592_36834_c1 nmdc:mga09592_36834_c1_1884_2522 209
172 3300050508 nmdc:mga09592_52066_c1 nmdc:mga09592_52066_c1_2294_2923 209
173 3300050509 nmdc:mga0qj67_1548_c1 nmdc:mga0qj67_1548_c1_1884_2522 209
174 3300050509 nmdc:mga0qj67_89963_c1 nmdc:mga0qj67_89963_c1_1181_1810 209
175 3300050510 nmdc:mga06r32_130421_c1 nmdc:mga06r32_130421_c1_142_780 209
176 3300050510 nmdc:mga06r32_55702_c1 nmdc:mga06r32_55702_c1_2498_3127 209
177 3300050511 nmdc:mga08y16_10576_c1 nmdc:mga08y16_10576_c1_6402_7040 209
178 3300050513 nmdc:mga0rr50_185167_c1 nmdc:mga0rr50_185167_c1_703_1341 209
179 3300050515 nmdc:mga0a205_331748_c1 nmdc:mga0a205_331748_c1_23_661 209
180 3300054114 Ga0501084_0007855 Ga0501084_0007855_3063_3692 209
181 3300054114 Ga0501084_0058981 Ga0501084_0058981_1040_1669 209
182 3300054114 Ga0501084_0063331 Ga0501084_0063331_1721_2350 209
183 3300059424 Ga0590075_102529 Ga0590075_102529_96_725 209
184 3300060353 Ga0501082_0020773 Ga0501082_0020773_4577_5206 209
185 3300061734 Ga0530510_0129223 Ga0530510_0129223_310_939 209
186 3300061734 Ga0530510_0795585 Ga0530510_0795585_75_704 209
187 3300005844 Ga0068862_100087371 Ga0068862_1000873712 210
188 3300006852 Ga0075433_10008518 Ga0075433_100085189 210
189 3300006871 Ga0075434_100031055 Ga0075434_1000310554 210
190 3300007076 Ga0075435_100023078 Ga0075435_1000230785 210
191 3300009553 Ga0105249_10545226 Ga0105249_105452262 210
192 3300013297 Ga0157378_10347283 Ga0157378_103472831 210
193 3300014326 Ga0157380_10119075 Ga0157380_101190752 210
194 3300028380 Ga0268265_10063522 Ga0268265_100635223 210
195 3300044673 Ga0453683_0042884 Ga0453683_0042884_1219_1857 210
196 3300046472 Ga0495580_0000545 Ga0495580_0000545_13831_14472 210
197 3300046664 Ga0495659_0077219 Ga0495659_0077219_388_1029 210
198 3300005546 Ga0070696_100301142 Ga0070696_1003011423 211
199 3300006846 Ga0075430_100145741 Ga0075430_1001457412 211
200 3300006852 Ga0075433_10353349 Ga0075433_103533492 211
201 3300006871 Ga0075434_100424331 Ga0075434_1004243312 211
202 3300006880 Ga0075429_100039263 Ga0075429_1000392632 211
203 3300009094 Ga0111539_10580813 Ga0111539_105808132 211
204 3300009147 Ga0114129_10000439 Ga0114129_1000043948 211
205 3300009147 Ga0114129_10099806 Ga0114129_100998064 211
206 3300009147 Ga0114129_10229024 Ga0114129_102290242 211
207 3300009147 Ga0114129_10378760 Ga0114129_103787602 211
208 3300009553 Ga0105249_10387817 Ga0105249_103878171 211
209 3300025938 Ga0207704_10275150 Ga0207704_102751502 211
210 3300025961 Ga0207712_10285044 Ga0207712_102850443 211
211 3300026118 Ga0207675_101203130 Ga0207675_1012031301 211
212 3300045051 Ga0451576_0451726 Ga0451576_0451726_120_767 211
213 3300049568 Ga0501031_0021370 Ga0501031_0021370_272_919 211
214 3300049570 Ga0501033_0046375 Ga0501033_0046375_276_923 211
215 3300049570 Ga0501033_0059811 Ga0501033_0059811_1720_2367 211
216 3300049572 Ga0501036_0002194 Ga0501036_0002194_2782_3429 211
217 3300049572 Ga0501036_0012994 Ga0501036_0012994_6201_6848 211
218 3300049573 Ga0501037_0184616 Ga0501037_0184616_142_789 211
219 3300049574 Ga0501038_0003015 Ga0501038_0003015_14687_15334 211
220 3300049574 Ga0501038_0032957 Ga0501038_0032957_3362_4009 211
221 3300049575 Ga0501039_0087764 Ga0501039_0087764_782_1429 211
222 3300049576 Ga0501040_0000517 Ga0501040_0000517_9755_10402 211
223 3300049576 Ga0501040_0005290 Ga0501040_0005290_5729_6376 211
224 3300049576 Ga0501040_0173624 Ga0501040_0173624_552_1205 211
225 3300049577 Ga0501041_0001305 Ga0501041_0001305_227_874 211
226 3300049577 Ga0501041_0026681 Ga0501041_0026681_2626_3279 211
227 3300049577 Ga0501041_0423468 Ga0501041_0423468_184_834 211
228 3300049578 Ga0501042_0000656 Ga0501042_0000656_15610_16257 211
229 3300049578 Ga0501042_0083867 Ga0501042_0083867_1600_2247 211
230 3300049578 Ga0501042_0157058 Ga0501042_0157058_121_774 211
231 3300049580 Ga0501046_0009018 Ga0501046_0009018_4484_5131 211
232 3300049582 Ga0501048_0001395 Ga0501048_0001395_2092_2739 211
233 3300049586 Ga0501070_0351514 Ga0501070_0351514_211_858 211
234 3300049587 Ga0501071_0000310 Ga0501071_0000310_1469_2116 211
235 3300049588 Ga0501072_0000642 Ga0501072_0000642_16422_17069 211
236 3300049588 Ga0501072_0091346 Ga0501072_0091346_51_698 211
237 3300049590 Ga0501074_0000460 Ga0501074_0000460_1487_2134 211
238 3300049591 Ga0501075_0000003 Ga0501075_0000003_94532_95179 211
239 3300049591 Ga0501075_0000200 Ga0501075_0000200_29532_30179 211
240 3300049591 Ga0501075_0090102 Ga0501075_0090102_287_934 211
241 3300049592 Ga0501076_0000010 Ga0501076_0000010_27197_27844 211
242 3300049592 Ga0501076_0000868 Ga0501076_0000868_1344_1991 211
243 3300049592 Ga0501076_0036622 Ga0501076_0036622_789_1442 211
244 3300049593 Ga0501077_0000171 Ga0501077_0000171_22295_22942 211
245 3300049741 Ga0501079_0011947 Ga0501079_0011947_2620_3267 211
246 3300049741 Ga0501079_0122282 Ga0501079_0122282_1271_1918 211
247 3300049742 Ga0501080_0036903 Ga0501080_0036903_250_897 211
248 3300049742 Ga0501080_0180659 Ga0501080_0180659_816_1463 211
249 3300049743 Ga0501081_0000019 Ga0501081_0000019_44472_45119 211
250 3300049743 Ga0501081_0004472 Ga0501081_0004472_2316_2963 211
251 3300049743 Ga0501081_0367940 Ga0501081_0367940_336_989 211
252 3300049744 Ga0501083_0068550 Ga0501083_0068550_294_941 211
253 3300049822 Ga0501035_0084820 Ga0501035_0084820_427_1074 211
254 3300049824 Ga0501045_0000013 Ga0501045_0000013_73102_73749 211
255 3300049824 Ga0501045_0489999 Ga0501045_0489999_196_843 211
256 3300050507 nmdc:mga05p37_176674_c1 nmdc:mga05p37_176674_c1_1224_1859 211
257 3300050507 nmdc:mga05p37_2058_c1 nmdc:mga05p37_2058_c1_10829_11476 211
258 3300050507 nmdc:mga05p37_227723_c1 nmdc:mga05p37_227723_c1_920_1627 211
259 3300050507 nmdc:mga05p37_685159_c1 nmdc:mga05p37_685159_c1_261_899 211
260 3300050508 nmdc:mga09592_472834_c1 nmdc:mga09592_472834_c1_247_894 211
261 3300050510 nmdc:mga06r32_106945_c1 nmdc:mga06r32_106945_c1_1201_1839 211
262 3300050511 nmdc:mga08y16_454772_c1 nmdc:mga08y16_454772_c1_602_1240 211
263 3300050512 nmdc:mga0n895_195215_c1 nmdc:mga0n895_195215_c1_1111_1749 211
264 3300050512 nmdc:mga0n895_557357_c1 nmdc:mga0n895_557357_c1_294_941 211
265 3300054114 Ga0501084_0000482 Ga0501084_0000482_7165_7812 211
266 3300054114 Ga0501084_0001427 Ga0501084_0001427_462_1109 211
267 3300054114 Ga0501084_0911705 Ga0501084_0911705_29_673 211
268 3300054114 Ga0501084_0923464 Ga0501084_0923464_47_694 211
269 3300060353 Ga0501082_0000752 Ga0501082_0000752_11980_12627 211
270 3300061734 Ga0530510_0000008 Ga0530510_0000008_106550_107197 211
271 3300061734 Ga0530510_0000706 Ga0530510_0000706_8418_9065 211
272 3300061734 Ga0530510_0019068 Ga0530510_0019068_1687_2334 211
273 3300061734 Ga0530510_0072266 Ga0530510_0072266_1006_1659 211
274 3300061734 Ga0530510_0702392 Ga0530510_0702392_64_708 211
275 3300005328 Ga0070676_10000511 Ga0070676_1000051113 212
276 3300005331 Ga0070670_100075781 Ga0070670_1000757813 212
277 3300005334 Ga0068869_100003089 Ga0068869_1000030897 212
278 3300005335 Ga0070666_10273608 Ga0070666_102736082 212
279 3300005336 Ga0070680_100077107 Ga0070680_1000771071 212
280 3300005337 Ga0070682_100002931 Ga0070682_1000029317 212
281 3300005338 Ga0068868_100063653 Ga0068868_1000636532 212
282 3300005339 Ga0070660_100002746 Ga0070660_1000027462 212
283 3300005340 Ga0070689_100058468 Ga0070689_1000584681 212
284 3300005341 Ga0070691_10010763 Ga0070691_100107632 212
285 3300005344 Ga0070661_100001190 Ga0070661_10000119013 212
286 3300005345 Ga0070692_10025020 Ga0070692_100250202 212
287 3300005353 Ga0070669_100275790 Ga0070669_1002757902 212
288 3300005354 Ga0070675_100282933 Ga0070675_1002829332 212
289 3300005364 Ga0070673_100027615 Ga0070673_1000276153 212
290 3300005366 Ga0070659_100004742 Ga0070659_1000047424 212
291 3300005406 Ga0070703_10013321 Ga0070703_100133211 212
292 3300005440 Ga0070705_100012575 Ga0070705_1000125754 212
293 3300005444 Ga0070694_100000116 Ga0070694_1000001162 212
294 3300005445 Ga0070708_100074445 Ga0070708_1000744455 212
295 3300005445 Ga0070708_100165213 Ga0070708_1001652132 212
296 3300005445 Ga0070708_100275140 Ga0070708_1002751402 212
297 3300005445 Ga0070708_100285388 Ga0070708_1002853882 212
298 3300005445 Ga0070708_100354137 Ga0070708_1003541372 212
299 3300005455 Ga0070663_100013766 Ga0070663_1000137665 212
300 3300005457 Ga0070662_100002383 Ga0070662_1000023833 212
301 3300005458 Ga0070681_10301354 Ga0070681_103013542 212
302 3300005459 Ga0068867_100001933 Ga0068867_10000193311 212
303 3300005467 Ga0070706_100027912 Ga0070706_1000279121 212
304 3300005467 Ga0070706_100590099 Ga0070706_1005900992 212
305 3300005468 Ga0070707_100028514 Ga0070707_1000285148 212
306 3300005468 Ga0070707_100062738 Ga0070707_1000627384 212
307 3300005518 Ga0070699_100291231 Ga0070699_1002912312 212
308 3300005518 Ga0070699_100470125 Ga0070699_1004701252 212
309 3300005530 Ga0070679_100049808 Ga0070679_1000498084 212
310 3300005535 Ga0070684_100299333 Ga0070684_1002993332 212
311 3300005539 Ga0068853_100003438 Ga0068853_1000034387 212
312 3300005545 Ga0070695_100018873 Ga0070695_1000188732 212
313 3300005546 Ga0070696_100002014 Ga0070696_1000020141 212
314 3300005563 Ga0068855_100282070 Ga0068855_1002820702 212
315 3300005614 Ga0068856_100111323 Ga0068856_1001113234 212
316 3300005617 Ga0068859_100054000 Ga0068859_1000540005 212
317 3300005618 Ga0068864_100041871 Ga0068864_1000418714 212
318 3300005719 Ga0068861_100041484 Ga0068861_1000414842 212
319 3300005840 Ga0068870_10008586 Ga0068870_100085863 212
320 3300005841 Ga0068863_100270582 Ga0068863_1002705821 212
321 3300006844 Ga0075428_100082923 Ga0075428_1000829238 212
322 3300006846 Ga0075430_100010977 Ga0075430_10001097710 212
323 3300006847 Ga0075431_100094219 Ga0075431_1000942191 212
324 3300006871 Ga0075434_100436357 Ga0075434_1004363572 212
325 3300006880 Ga0075429_100016852 Ga0075429_1000168524 212
326 3300006914 Ga0075436_100167064 Ga0075436_1001670642 212
327 3300006931 Ga0097620_100053998 Ga0097620_1000539982 212
328 3300007076 Ga0075435_100032795 Ga0075435_1000327952 212
329 3300009094 Ga0111539_10397398 Ga0111539_103973982 212
330 3300009147 Ga0114129_10001249 Ga0114129_100012493 212
331 3300009147 Ga0114129_10011311 Ga0114129_100113113 212
332 3300009147 Ga0114129_10064562 Ga0114129_100645626 212
333 3300009147 Ga0114129_10579419 Ga0114129_105794192 212
334 3300009174 Ga0105241_10000067 Ga0105241_1000006713 212
335 3300009553 Ga0105249_11173298 Ga0105249_111732981 212
336 3300013100 Ga0157373_10000398 Ga0157373_1000039831 212
337 3300013105 Ga0157369_10135236 Ga0157369_101352363 212
338 3300013307 Ga0157372_10027845 Ga0157372_100278451 212
339 3300013308 Ga0157375_10085411 Ga0157375_100854112 212
340 3300014745 Ga0157377_10178718 Ga0157377_101787182 212
341 3300022467 Ga0224712_10068158 Ga0224712_100681582 212
342 3300025885 Ga0207653_10003059 Ga0207653_100030594 212
343 3300025907 Ga0207645_10000406 Ga0207645_1000040627 212
344 3300025908 Ga0207643_10000439 Ga0207643_1000043922 212
345 3300025912 Ga0207707_10000124 Ga0207707_1000012413 212
346 3300025917 Ga0207660_10006409 Ga0207660_100064096 212
347 3300025919 Ga0207657_10000085 Ga0207657_100000856 212
348 3300025920 Ga0207649_10089428 Ga0207649_100894282 212
349 3300025921 Ga0207652_10000264 Ga0207652_1000026445 212
350 3300025922 Ga0207646_10003351 Ga0207646_1000335113 212
351 3300025922 Ga0207646_10012323 Ga0207646_100123234 212
352 3300025923 Ga0207681_10143897 Ga0207681_101438972 212
353 3300025925 Ga0207650_10120989 Ga0207650_101209892 212
354 3300025932 Ga0207690_10038431 Ga0207690_100384312 212
355 3300025933 Ga0207706_10003538 Ga0207706_1000353813 212
356 3300025936 Ga0207670_10245831 Ga0207670_102458312 212
357 3300025942 Ga0207689_10000579 Ga0207689_100005792 212
358 3300025949 Ga0207667_10101222 Ga0207667_101012222 212
359 3300025981 Ga0207640_10002946 Ga0207640_100029469 212
360 3300026023 Ga0207677_10404016 Ga0207677_104040162 212
361 3300026035 Ga0207703_10218884 Ga0207703_102188841 212
362 3300026041 Ga0207639_10117609 Ga0207639_101176094 212
363 3300026067 Ga0207678_10038916 Ga0207678_100389162 212
364 3300026088 Ga0207641_10022933 Ga0207641_100229335 212
365 3300026089 Ga0207648_10006511 Ga0207648_100065113 212
366 3300026095 Ga0207676_10005191 Ga0207676_100051916 212
367 3300026118 Ga0207675_100016892 Ga0207675_1000168927 212
368 3300028380 Ga0268265_10060192 Ga0268265_100601922 212
369 3300028381 Ga0268264_10085808 Ga0268264_100858085 212
370 3300034820 Ga0373959_0052868 Ga0373959_0052868_164_805 212
371 3300035121 Ga0373960_0007876 Ga0373960_0007876_1765_2406 212
372 3300042157 Ga0439458_0004698 Ga0439458_0004698_1411_2052 212
373 3300042438 Ga0439459_0022598 Ga0439459_0022598_183_824 212
374 3300042876 Ga0451577_0135248 Ga0451577_0135248_1503_2144 212
375 3300044673 Ga0453683_0010371 Ga0453683_0010371_2765_3451 212
376 3300045051 Ga0451576_0027403 Ga0451576_0027403_2741_3385 212
377 3300045051 Ga0451576_0046122 Ga0451576_0046122_2524_3165 212
378 3300048904 Ga0496101_0758302 Ga0496101_0758302_108_749 212
379 3300048905 Ga0496102_0110028 Ga0496102_0110028_343_984 212
380 3300049574 Ga0501038_0619721 Ga0501038_0619721_51_704 212
381 3300049575 Ga0501039_0221096 Ga0501039_0221096_42_695 212
382 3300049576 Ga0501040_0208081 Ga0501040_0208081_698_1351 212
383 3300049577 Ga0501041_0036506 Ga0501041_0036506_941_1594 212
384 3300049578 Ga0501042_0477895 Ga0501042_0477895_55_708 212
385 3300049582 Ga0501048_0057315 Ga0501048_0057315_1375_2028 212
386 3300049584 Ga0501068_0033284 Ga0501068_0033284_28_669 212
387 3300049588 Ga0501072_0406774 Ga0501072_0406774_337_990 212
388 3300050507 nmdc:mga05p37_34802_c1 nmdc:mga05p37_34802_c1_3819_4457 212
389 3300050507 nmdc:mga05p37_378021_c1 nmdc:mga05p37_378021_c1_494_1228 212
390 3300050507 nmdc:mga05p37_454833_c1 nmdc:mga05p37_454833_c1_260_901 212
391 3300050509 nmdc:mga0qj67_12237_c1 nmdc:mga0qj67_12237_c1_4170_4808 212
392 3300050510 nmdc:mga06r32_221871_c1 nmdc:mga06r32_221871_c1_1159_1797 212
393 3300050510 nmdc:mga06r32_777324_c1 nmdc:mga06r32_777324_c1_108_797 212
394 3300050511 nmdc:mga08y16_515123_c1 nmdc:mga08y16_515123_c1_26_667 212
395 3300050512 nmdc:mga0n895_254853_c1 nmdc:mga0n895_254853_c1_434_1168 212
396 3300050512 nmdc:mga0n895_55399_c1 nmdc:mga0n895_55399_c1_1681_2322 212
397 3300050513 nmdc:mga0rr50_40556_c1 nmdc:mga0rr50_40556_c1_468_1202 212
398 3300050513 nmdc:mga0rr50_46281_c1 nmdc:mga0rr50_46281_c1_2400_3041 212
399 3300050515 nmdc:mga0a205_161179_c1 nmdc:mga0a205_161179_c1_82_723 212
400 3300050515 nmdc:mga0a205_3408_c1 nmdc:mga0a205_3408_c1_4769_5503 212
401 3300050515 nmdc:mga0a205_536054_c1 nmdc:mga0a205_536054_c1_158_799 212
402 3300054114 Ga0501084_0523590 Ga0501084_0523590_325_978 212
403 3300060353 Ga0501082_0217974 Ga0501082_0217974_917_1570 212
404 3300061734 Ga0530510_0013201 Ga0530510_0013201_3576_4229 212
405 3300005444 Ga0070694_100000075 Ga0070694_10000007513 213
406 3300005444 Ga0070694_100008467 Ga0070694_1000084674 213
407 3300005444 Ga0070694_100017101 Ga0070694_1000171014 213
408 3300005445 Ga0070708_100297354 Ga0070708_1002973542 213
409 3300005445 Ga0070708_100305060 Ga0070708_1003050601 213
410 3300005445 Ga0070708_100733283 Ga0070708_1007332832 213
411 3300005458 Ga0070681_10551841 Ga0070681_105518412 213
412 3300005459 Ga0068867_100822340 Ga0068867_1008223401 213
413 3300005467 Ga0070706_100009685 Ga0070706_1000096855 213
414 3300005467 Ga0070706_100328797 Ga0070706_1003287971 213
415 3300005468 Ga0070707_100521327 Ga0070707_1005213271 213
416 3300005471 Ga0070698_100041498 Ga0070698_1000414984 213
417 3300005471 Ga0070698_100169228 Ga0070698_1001692282 213
418 3300005471 Ga0070698_100219241 Ga0070698_1002192412 213
419 3300005518 Ga0070699_100005568 Ga0070699_1000055689 213
420 3300005536 Ga0070697_100007110 Ga0070697_1000071107 213
421 3300005536 Ga0070697_100008056 Ga0070697_10000805611 213
422 3300005536 Ga0070697_100050339 Ga0070697_1000503395 213
423 3300005536 Ga0070697_100506022 Ga0070697_1005060221 213
424 3300005545 Ga0070695_100004280 Ga0070695_1000042804 213
425 3300005546 Ga0070696_100256293 Ga0070696_1002562932 213
426 3300005547 Ga0070693_100067378 Ga0070693_1000673783 213
427 3300005549 Ga0070704_100076771 Ga0070704_1000767712 213
428 3300005718 Ga0068866_10160244 Ga0068866_101602442 213
429 3300005719 Ga0068861_100120721 Ga0068861_1001207214 213
430 3300005844 Ga0068862_100003295 Ga0068862_10000329510 213
431 3300005937 Ga0081455_10024112 Ga0081455_100241125 213
432 3300006844 Ga0075428_100175935 Ga0075428_1001759352 213
433 3300006852 Ga0075433_10000423 Ga0075433_1000042315 213
434 3300006871 Ga0075434_100645475 Ga0075434_1006454752 213
435 3300007076 Ga0075435_100011334 Ga0075435_1000113344 213
436 3300007265 Ga0099794_10068353 Ga0099794_100683533 213
437 3300009147 Ga0114129_10178773 Ga0114129_101787734 213
438 3300009147 Ga0114129_10192638 Ga0114129_101926383 213
439 3300009176 Ga0105242_10412002 Ga0105242_104120022 213
440 3300013307 Ga0157372_10343757 Ga0157372_103437572 213
441 3300025885 Ga0207653_10110341 Ga0207653_101103411 213
442 3300025910 Ga0207684_10002380 Ga0207684_1000238015 213
443 3300025910 Ga0207684_10063810 Ga0207684_100638102 213
444 3300025910 Ga0207684_10097662 Ga0207684_100976624 213
445 3300025916 Ga0207663_10417759 Ga0207663_104177592 213
446 3300025922 Ga0207646_10016164 Ga0207646_100161648 213
447 3300025922 Ga0207646_10057844 Ga0207646_100578443 213
448 3300025922 Ga0207646_10103560 Ga0207646_101035602 213
449 3300025935 Ga0207709_10507766 Ga0207709_105077661 213
450 3300025942 Ga0207689_10008697 Ga0207689_100086976 213
451 3300026035 Ga0207703_10576259 Ga0207703_105762592 213
452 3300026089 Ga0207648_10806863 Ga0207648_108068631 213
453 3300026118 Ga0207675_100404853 Ga0207675_1004048533 213
454 3300027614 Ga0209970_1004248 Ga0209970_10042482 213
455 3300027665 Ga0209983_1000006 Ga0209983_100000619 213
456 3300027682 Ga0209971_1000053 Ga0209971_100005313 213
457 3300027695 Ga0209966_1000266 Ga0209966_100026613 213
458 3300027717 Ga0209998_10000083 Ga0209998_1000008328 213
459 3300027876 Ga0209974_10038511 Ga0209974_100385112 213
460 3300028380 Ga0268265_10202159 Ga0268265_102021593 213
461 3300031852 Ga0307410_10090357 Ga0307410_100903572 213
462 3300032005 Ga0307411_10197852 Ga0307411_101978522 213
463 3300042157 Ga0439458_0048494 Ga0439458_0048494_251_895 213
464 3300042461 Ga0439460_0009583 Ga0439460_0009583_1125_1769 213
465 3300042461 Ga0439460_0063668 Ga0439460_0063668_418_1062 213
466 3300042876 Ga0451577_0082703 Ga0451577_0082703_1318_1962 213
467 3300045051 Ga0451576_0008158 Ga0451576_0008158_7933_8577 213
468 3300045051 Ga0451576_0248820 Ga0451576_0248820_731_1399 213
469 3300046472 Ga0495580_0098535 Ga0495580_0098535_377_1021 213
470 3300049513 Ga0501290_016192 Ga0501290_016192_215_856 213
471 3300049570 Ga0501033_0077750 Ga0501033_0077750_1012_1656 213
472 3300049572 Ga0501036_0098851 Ga0501036_0098851_731_1375 213
473 3300049573 Ga0501037_0361501 Ga0501037_0361501_148_792 213
474 3300049574 Ga0501038_0076909 Ga0501038_0076909_1046_1690 213
475 3300049575 Ga0501039_0028341 Ga0501039_0028341_2543_3187 213
476 3300049576 Ga0501040_0003453 Ga0501040_0003453_8127_8771 213
477 3300049576 Ga0501040_0134478 Ga0501040_0134478_785_1426 213
478 3300049576 Ga0501040_0141777 Ga0501040_0141777_331_975 213
479 3300049577 Ga0501041_0005901 Ga0501041_0005901_4965_5609 213
480 3300049578 Ga0501042_0015940 Ga0501042_0015940_3017_3661 213
481 3300049578 Ga0501042_0387679 Ga0501042_0387679_322_963 213
482 3300049579 Ga0501043_0153575 Ga0501043_0153575_429_1073 213
483 3300049580 Ga0501046_0007755 Ga0501046_0007755_4682_5326 213
484 3300049581 Ga0501047_0020667 Ga0501047_0020667_467_1111 213
485 3300049582 Ga0501048_0010878 Ga0501048_0010878_2582_3226 213
486 3300049584 Ga0501068_0043910 Ga0501068_0043910_1801_2445 213
487 3300049585 Ga0501069_0132468 Ga0501069_0132468_459_1103 213
488 3300049587 Ga0501071_0219417 Ga0501071_0219417_508_1152 213
489 3300049588 Ga0501072_0082547 Ga0501072_0082547_959_1603 213
490 3300049588 Ga0501072_0272981 Ga0501072_0272981_167_811 213
491 3300049590 Ga0501074_0014360 Ga0501074_0014360_2528_3172 213
492 3300049590 Ga0501074_0142163 Ga0501074_0142163_373_1017 213
493 3300049591 Ga0501075_0049513 Ga0501075_0049513_1225_1869 213
494 3300049591 Ga0501075_0640867 Ga0501075_0640867_41_697 213
495 3300049592 Ga0501076_0028545 Ga0501076_0028545_1175_1819 213
496 3300049592 Ga0501076_0088158 Ga0501076_0088158_1334_1978 213
497 3300049592 Ga0501076_0115229 Ga0501076_0115229_17_658 213
498 3300049592 Ga0501076_0230981 Ga0501076_0230981_654_1298 213
499 3300049593 Ga0501077_0048521 Ga0501077_0048521_1318_1962 213
500 3300049593 Ga0501077_0076316 Ga0501077_0076316_713_1357 213
501 3300049741 Ga0501079_0001602 Ga0501079_0001602_15257_15901 213
502 3300049741 Ga0501079_0011807 Ga0501079_0011807_3734_4378 213
503 3300049741 Ga0501079_0159801 Ga0501079_0159801_579_1223 213
504 3300049741 Ga0501079_0430141 Ga0501079_0430141_270_926 213
505 3300049743 Ga0501081_0000618 Ga0501081_0000618_3219_3863 213
506 3300049743 Ga0501081_0006317 Ga0501081_0006317_6623_7267 213
507 3300049744 Ga0501083_0054764 Ga0501083_0054764_1076_1720 213
508 3300049822 Ga0501035_0051281 Ga0501035_0051281_2482_3126 213
509 3300049824 Ga0501045_0003706 Ga0501045_0003706_2866_3510 213
510 3300049824 Ga0501045_0085066 Ga0501045_0085066_1130_1774 213
511 3300049824 Ga0501045_0239822 Ga0501045_0239822_70_714 213
512 3300050507 nmdc:mga05p37_112684_c1 nmdc:mga05p37_112684_c1_1636_2280 213
513 3300050507 nmdc:mga05p37_364155_c1 nmdc:mga05p37_364155_c1_852_1496 213
514 3300050507 nmdc:mga05p37_91501_c1 nmdc:mga05p37_91501_c1_1235_1876 213
515 3300050512 nmdc:mga0n895_22977_c1 nmdc:mga0n895_22977_c1_4580_5224 213
516 3300050513 nmdc:mga0rr50_1027_c1 nmdc:mga0rr50_1027_c1_10143_10787 213
517 3300050515 nmdc:mga0a205_8240_c1 nmdc:mga0a205_8240_c1_503_1147 213
518 3300054114 Ga0501084_0037416 Ga0501084_0037416_2998_3642 213
519 3300054114 Ga0501084_0294431 Ga0501084_0294431_656_1300 213
520 3300060353 Ga0501082_0002328 Ga0501082_0002328_6895_7539 213
521 3300060353 Ga0501082_0005201 Ga0501082_0005201_9214_9858 213
522 3300061734 Ga0530510_0027979 Ga0530510_0027979_3349_3993 213
523 3300061734 Ga0530510_0068834 Ga0530510_0068834_1613_2257 213
524 3300004798 Ga0058859_11689533 Ga0058859_116895331 214
525 3300004801 Ga0058860_11955186 Ga0058860_119551861 214
526 3300005459 Ga0068867_100376735 Ga0068867_1003767352 214
527 3300005546 Ga0070696_100212415 Ga0070696_1002124151 214
528 3300005549 Ga0070704_100075391 Ga0070704_1000753912 214
529 3300005617 Ga0068859_100064852 Ga0068859_1000648524 214
530 3300005617 Ga0068859_100551621 Ga0068859_1005516212 214
531 3300005843 Ga0068860_100171965 Ga0068860_1001719654 214
532 3300006844 Ga0075428_100006097 Ga0075428_1000060979 214
533 3300006844 Ga0075428_100015425 Ga0075428_1000154254 214
534 3300006844 Ga0075428_100185254 Ga0075428_1001852542 214
535 3300006844 Ga0075428_100441458 Ga0075428_1004414583 214
536 3300006846 Ga0075430_100000647 Ga0075430_10000064714 214
537 3300006847 Ga0075431_100023269 Ga0075431_1000232693 214
538 3300006847 Ga0075431_100025646 Ga0075431_1000256468 214
539 3300006847 Ga0075431_100037293 Ga0075431_1000372933 214
540 3300006852 Ga0075433_10180433 Ga0075433_101804332 214
541 3300006852 Ga0075433_10310517 Ga0075433_103105172 214
542 3300006871 Ga0075434_100323918 Ga0075434_1003239182 214
543 3300006871 Ga0075434_100708748 Ga0075434_1007087482 214
544 3300006880 Ga0075429_100308265 Ga0075429_1003082652 214
545 3300006881 Ga0068865_100592421 Ga0068865_1005924211 214
546 3300006931 Ga0097620_100064850 Ga0097620_1000648502 214
547 3300006931 Ga0097620_100551577 Ga0097620_1005515772 214
548 3300007076 Ga0075435_100053454 Ga0075435_1000534542 214
549 3300009094 Ga0111539_10003950 Ga0111539_1000395011 214
550 3300009147 Ga0114129_10004586 Ga0114129_1000458611 214
551 3300009147 Ga0114129_10195056 Ga0114129_101950562 214
552 3300009147 Ga0114129_10281563 Ga0114129_102815632 214
553 3300009148 Ga0105243_10165077 Ga0105243_101650772 214
554 3300009174 Ga0105241_10089667 Ga0105241_100896672 214
555 3300013308 Ga0157375_10254035 Ga0157375_102540353 214
556 3300014326 Ga0157380_10228888 Ga0157380_102288883 214
557 3300014745 Ga0157377_10199201 Ga0157377_101992012 214
558 3300022467 Ga0224712_10291508 Ga0224712_102915081 214
559 3300025917 Ga0207660_10052397 Ga0207660_100523974 214
560 3300025923 Ga0207681_10461600 Ga0207681_104616001 214
561 3300025933 Ga0207706_10082314 Ga0207706_100823143 214
562 3300025940 Ga0207691_10037554 Ga0207691_100375544 214
563 3300026067 Ga0207678_10254989 Ga0207678_102549892 214
564 3300026088 Ga0207641_10388500 Ga0207641_103885002 214
565 3300026118 Ga0207675_100028417 Ga0207675_1000284172 214
566 3300027907 Ga0207428_10151472 Ga0207428_101514722 214
567 3300028381 Ga0268264_10070525 Ga0268264_100705254 214
568 3300032002 Ga0307416_101676821 Ga0307416_1016768211 214
569 3300032005 Ga0307411_10261695 Ga0307411_102616952 214
570 3300035090 Ga0373949_0134355 Ga0373949_0134355_25_669 214
571 3300035691 Ga0373931_0062357 Ga0373931_0062357_680_1324 214
572 3300037312 Ga0395899_0079906 Ga0395899_0079906_327_1001 214
573 3300037418 Ga0395900_0002001 Ga0395900_0002001_11233_11907 214
574 3300037466 Ga0395898_0018739 Ga0395898_0018739_746_1420 214
575 3300037471 Ga0395905_0215361 Ga0395905_0215361_253_897 214
576 3300038443 Ga0395901_0000506 Ga0395901_0000506_33350_34024 214
577 3300042437 Ga0439444_0017563 Ga0439444_0017563_443_1087 214
578 3300042876 Ga0451577_0384818 Ga0451577_0384818_13_657 214
579 3300046472 Ga0495580_0105561 Ga0495580_0105561_955_1602 214
580 3300046491 Ga0495584_0124715 Ga0495584_0124715_199_843 214
581 3300046684 Ga0495669_0126592 Ga0495669_0126592_59_745 214
582 3300046691 Ga0495670_0352483 Ga0495670_0352483_30_674 214
583 3300048905 Ga0496102_0018364 Ga0496102_0018364_2414_3058 214
584 3300048909 Ga0496106_0080046 Ga0496106_0080046_349_1086 214
585 3300048910 Ga0496107_0112497 Ga0496107_0112497_1023_1760 214
586 3300049515 Ga0501292_030173 Ga0501292_030173_44_688 214
587 3300049521 Ga0501298_075720 Ga0501298_075720_37_681 214
588 3300049522 Ga0501299_008100 Ga0501299_008100_544_1188 214
589 3300049574 Ga0501038_0210424 Ga0501038_0210424_411_1055 214
590 3300049574 Ga0501038_0598975 Ga0501038_0598975_89_733 214
591 3300049575 Ga0501039_0210846 Ga0501039_0210846_647_1291 214
592 3300049577 Ga0501041_0191823 Ga0501041_0191823_574_1218 214
593 3300049580 Ga0501046_0238810 Ga0501046_0238810_482_1126 214
594 3300049587 Ga0501071_0249706 Ga0501071_0249706_383_1027 214
595 3300049588 Ga0501072_0024337 Ga0501072_0024337_732_1376 214
596 3300049588 Ga0501072_0305032 Ga0501072_0305032_534_1178 214
597 3300049588 Ga0501072_0549280 Ga0501072_0549280_229_873 214
598 3300049591 Ga0501075_0626299 Ga0501075_0626299_84_728 214
599 3300049592 Ga0501076_0324836 Ga0501076_0324836_286_930 214
600 3300049742 Ga0501080_0280110 Ga0501080_0280110_510_1154 214
601 3300049742 Ga0501080_0281866 Ga0501080_0281866_425_1069 214
602 3300049743 Ga0501081_0272546 Ga0501081_0272546_333_977 214
603 3300049743 Ga0501081_0285936 Ga0501081_0285936_359_1006 214
604 3300050507 nmdc:mga05p37_108685_c1 nmdc:mga05p37_108685_c1_1103_1747 214
605 3300050507 nmdc:mga05p37_201989_c1 nmdc:mga05p37_201989_c1_276_920 214
606 3300050507 nmdc:mga05p37_4699_c1 nmdc:mga05p37_4699_c1_10256_10900 214
607 3300050509 nmdc:mga0qj67_211759_c1 nmdc:mga0qj67_211759_c1_93_800 214
608 3300050509 nmdc:mga0qj67_27387_c1 nmdc:mga0qj67_27387_c1_2816_3460 214
609 3300050510 nmdc:mga06r32_30838_c1 nmdc:mga06r32_30838_c1_158_802 214
610 3300050511 nmdc:mga08y16_23200_c1 nmdc:mga08y16_23200_c1_742_1386 214
611 3300050512 nmdc:mga0n895_369708_c1 nmdc:mga0n895_369708_c1_587_1231 214
612 3300050513 nmdc:mga0rr50_34273_c1 nmdc:mga0rr50_34273_c1_1704_2348 214
613 3300050515 nmdc:mga0a205_114774_c1 nmdc:mga0a205_114774_c1_1360_2004 214
614 3300050515 nmdc:mga0a205_97598_c1 nmdc:mga0a205_97598_c1_298_942 214
615 3300054114 Ga0501084_0091133 Ga0501084_0091133_69_713 214
616 3300054114 Ga0501084_0245288 Ga0501084_0245288_450_1094 214
617 3300054114 Ga0501084_1018091 Ga0501084_1018091_15_659 214
618 3300061734 Ga0530510_0055100 Ga0530510_0055100_676_1320 214
619 3300061734 Ga0530510_0102316 Ga0530510_0102316_546_1190 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

102

199

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s0d-assembly1.cif.gz_A h30 mnsod-3 mutant ii 0.9098 22 201
3c3s-assembly1.cif.gz_A role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase 0.9067 22 201
1zte-assembly1.cif.gz_A contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase 0.9064 22 201
1ap5-assembly1.cif.gz_A tyr34->phe mutant of human mitochondrial manganese superoxide dismutase 0.9042 22 201
1ja8-assembly1.cif.gz_A kinetic analysis of product inhibition in human manganese superoxide dismutase 0.9036 22 201
ID Description Score Start End Superfamily
3ak3B02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8948 92 202 3.55.40.20
1gn4D02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8888 93 201 3.55.40.20
af_O74379_99_220_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8886 103 201 3.55.40.20
af_A0A0R0EIY1_182_299_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8865 96 202 3.55.40.20
af_F4IB75_8_187_1.20.1260.60 Mainly Alpha;Up-down Bundle;Ferritin;Vacuolar protein sorting-associated protein Ist1 0.8849 26 84 1.20.1260.60
ID Description Score Start End GO Terms
AF-A0A533BKJ5-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9643 7 202 GO:0004784
GO:0046872
AF-A0A534TNM0-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9633 7 204 GO:0004784
GO:0046872
AF-E6PDX0-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9623 7 201 GO:0004784
GO:0046872
AF-A0A2V6Q6N3-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9614 1 214 GO:0004784
GO:0046872
GO:0051536
AF-A0A7C4VYZ7-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9611 14 205 GO:0004784
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map