F469831

General Info

Members Datasets Scaffolds Average Seq Length
619 296 615 350

Family's Representative Sequence

Representative Sequence 3300029282|Ga0311003_166887|Ga0311003_1668871
Length 416
Sequence MAFTTLGGGCGAASVRLVPQNRILGSNSKPFTGIILKKPQQVGPLPLHVRGSIASSPQKLFSPKAAAPKSGDSIRIAVLGASGYTGAEIVRFLANHPQFHIKVMTADRKAGEQFGSVFPHLRTLDLPKLVAIKDADFSDIDAVFCCLPHGTTQEIIKSLPRHLKIVDLSADFRLRDINEYAEWYGHSHRAPELQEEAVYGLTELQRDDIRNARLVANPGCYPTSIQLPLVPLVKAKLIKLTNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGITSHRHVPEIEQGLTDAAESKVTISFTPHLMCMKRGMQSTIYVELASGVTPRDLYEHLKYTYEDEEFVKLLHGSSAPHTSHVVGSNYCFMNVYEDRIPGRAIIISVIDNLVKGASGQALQNLNLMMGLPENMGLQYLPLFP

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
5 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300023556 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
92 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
95 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
96 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
98 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
102 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
103 3300023682 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
104 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
107 3300023689 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
108 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
170 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
173 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
174 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
175 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
176 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
180 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
181 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
190 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
191 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
215 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
223 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
224 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.91
Metatranscriptomes 12.44
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.81
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 12.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006556J51387_1011473 3300003479 Eukaryota 1672
2 Ga0070658_10000031 3300005327 Bacteria 153171
3 Ga0070658_10046994 3300005327 Bacteria 3493
4 Ga0070658_10172234 3300005327 Bacteria 1819
5 Ga0070683_100017049 3300005329 Bacteria 6410
6 Ga0070683_100084079 3300005329 Bacteria 2982
7 Ga0070683_100122865 3300005329 Bacteria 2453
8 Ga0070670_100000150 3300005331 Bacteria 64102
9 Ga0068869_100032869 3300005334 Bacteria 3659
10 Ga0068869_100043285 3300005334 Unclassified 3233
11 Ga0070666_10003473 3300005335 Bacteria 9549
12 Ga0070666_10181348 3300005335 Bacteria 1477
13 Ga0070680_100043532 3300005336 Bacteria 3647
14 Ga0068868_100000028 3300005338 Bacteria 78800
15 Ga0068868_100013770 3300005338 Bacteria 5943
16 Ga0068868_100265865 3300005338 Bacteria 1448
17 Ga0070669_100004094 3300005353 Bacteria 10564
18 Ga0070669_100083407 3300005353 Bacteria 2383
19 Ga0070674_100011652 3300005356 Bacteria 5360
20 Ga0070667_100026186 3300005367 Bacteria 4851
21 Ga0070709_10016682 3300005434 Bacteria 4198
22 Ga0070709_10023748 3300005434 Bacteria 3605
23 Ga0070709_10057517 3300005434 Bacteria 2463
24 Ga0070709_10058667 3300005434 Bacteria 2442
25 Ga0070713_100010196 3300005436 Bacteria 6779
26 Ga0070713_100065385 3300005436 Bacteria 3055
27 Ga0070713_100127647 3300005436 Bacteria 2239
28 Ga0070700_100001476 3300005441 Bacteria 11702
29 Ga0070694_100002182 3300005444 Bacteria 11593
30 Ga0070708_100001314 3300005445 Bacteria 19051
31 Ga0070708_100022493 3300005445 Bacteria 5348
32 Ga0070708_100052716 3300005445 Bacteria 3608
33 Ga0070708_100095262 3300005445 Bacteria 2717
34 Ga0070678_100355853 3300005456 Bacteria 1260
35 Ga0070681_10025507 3300005458 Bacteria 5945
36 Ga0070681_10059776 3300005458 Bacteria 3791
37 Ga0070681_10121591 3300005458 Bacteria 2545
38 Ga0070681_10412664 3300005458 Bacteria 1262
39 Ga0068867_100305274 3300005459 Bacteria 1313
40 Ga0070706_100023926 3300005467 Bacteria 5624
41 Ga0070707_100000212 3300005468 Bacteria 58073
42 Ga0070707_100008812 3300005468 Bacteria 9360
43 Ga0070707_100017858 3300005468 Bacteria 6670
44 Ga0070707_100059473 3300005468 Bacteria 3666
45 Ga0070707_100299199 3300005468 Bacteria 1563
46 Ga0070698_100013553 3300005471 Bacteria 8632
47 Ga0070699_100205394 3300005518 Bacteria 1752
48 Ga0070679_100035527 3300005530 Bacteria 4944
49 Ga0070679_100120828 3300005530 Bacteria 2604
50 Ga0070684_100073268 3300005535 Bacteria 3018
51 Ga0070697_100027109 3300005536 Bacteria 4582
52 Ga0070697_100048957 3300005536 Bacteria 3428
53 Ga0068853_100008821 3300005539 Bacteria 8111
54 Ga0070686_100037862 3300005544 Bacteria 2995
55 Ga0070665_100005701 3300005548 Bacteria 12783
56 Ga0070665_100032461 3300005548 Bacteria 5255
57 Ga0070704_100022666 3300005549 Bacteria 4089
58 Ga0070704_100084877 3300005549 Bacteria 2342
59 Ga0070704_100100026 3300005549 Bacteria 2182
60 Ga0070704_100160408 3300005549 Bacteria 1778
61 Ga0068855_100010762 3300005563 Bacteria 11042
62 Ga0068855_100082385 3300005563 Bacteria 3729
63 Ga0068855_100159601 3300005563 Bacteria 2560
64 Ga0068855_100192597 3300005563 Bacteria 2299
65 Ga0070664_100069911 3300005564 Bacteria 3005
66 Ga0070664_100174068 3300005564 Bacteria 1910
67 Ga0068857_100050661 3300005577 Bacteria 3683
68 Ga0068857_100095725 3300005577 Bacteria 2661
69 Ga0068854_100008184 3300005578 Bacteria 6707
70 Ga0068854_100009584 3300005578 Bacteria 6251
71 Ga0068854_100017695 3300005578 Bacteria 4773
72 Ga0068854_100309491 3300005578 Bacteria 1281
73 Ga0068856_100024922 3300005614 Bacteria 5829
74 Ga0068859_100000020 3300005617 Bacteria 247060
75 Ga0068859_100074968 3300005617 Bacteria 3423
76 Ga0068859_100435552 3300005617 Bacteria 1407
77 Ga0068866_10143341 3300005718 Bacteria 1374
78 Ga0068866_10175749 3300005718 Bacteria 1261
79 Ga0068863_100004416 3300005841 Bacteria 13868
80 Ga0068858_100017600 3300005842 Bacteria 6700
81 Ga0068862_100003559 3300005844 Bacteria 13333
82 Ga0081455_10195861 3300005937 Bacteria 1517
83 Ga0081455_10215603 3300005937 Bacteria 1427
84 Ga0081538_10029223 3300005981 Bacteria 3772
85 Ga0081539_10002036 3300005985 Bacteria 30449
86 Ga0070715_10056253 3300006163 Bacteria 1711
87 Ga0070716_100053321 3300006173 Bacteria 2306
88 Ga0097621_100000311 3300006237 Bacteria 32935
89 Ga0097621_100013066 3300006237 Bacteria 6175
90 Ga0097621_100021142 3300006237 Bacteria 5026
91 Ga0097621_100091017 3300006237 Bacteria 2553
92 Ga0097621_100105192 3300006237 Bacteria 2379
93 Ga0068871_100000337 3300006358 Bacteria 32470
94 Ga0068871_100020930 3300006358 Bacteria 5018
95 Ga0068871_100034122 3300006358 Bacteria 4035
96 Ga0068871_100108356 3300006358 Bacteria 2334
97 Ga0075428_100009648 3300006844 Bacteria 10719
98 Ga0075428_100160572 3300006844 Bacteria 2440
99 Ga0075430_100006967 3300006846 Bacteria 9530
100 Ga0075430_100307845 3300006846 Bacteria 1310
101 Ga0075431_100043392 3300006847 Bacteria 4641
102 Ga0075433_10050783 3300006852 Bacteria 3610
103 Ga0075429_100360010 3300006880 Bacteria 1274
104 Ga0068865_100108607 3300006881 Bacteria 2042
105 Ga0075436_100000019 3300006914 Bacteria 130535
106 Ga0075436_100005231 3300006914 Bacteria 8931
107 Ga0075436_100088435 3300006914 Bacteria 2152
108 Ga0097620_100000020 3300006931 Bacteria 247060
109 Ga0097620_100074969 3300006931 Bacteria 3423
110 Ga0075435_100027225 3300007076 Bacteria 4469
111 Ga0075435_100036063 3300007076 Bacteria 3928
112 Ga0099794_10124541 3300007265 Bacteria 1299
113 Ga0105240_10000709 3300009093 Bacteria 61057
114 Ga0105240_10001828 3300009093 Bacteria 35666
115 Ga0105240_10002450 3300009093 Bacteria 29855
116 Ga0105240_10024692 3300009093 Bacteria 7917
117 Ga0105240_10271050 3300009093 Bacteria 1954
118 Ga0105240_10286117 3300009093 Bacteria 1892
119 Ga0105240_10372065 3300009093 Bacteria 1615
120 Ga0105240_10816088 3300009093 Bacteria 1009
121 Ga0111539_10023461 3300009094 Bacteria 7581
122 Ga0111539_10585367 3300009094 Unclassified 1300
123 Ga0105245_10000006 3300009098 Bacteria 330960
124 Ga0105245_10041058 3300009098 Bacteria 4123
125 Ga0105245_10055670 3300009098 Bacteria 3553
126 Ga0114129_10009063 3300009147 Bacteria 14183
127 Ga0114129_10009389 3300009147 Bacteria 13944
128 Ga0114129_10121730 3300009147 Bacteria 3590
129 Ga0114129_10244860 3300009147 Bacteria 2409
130 Ga0105243_10019800 3300009148 Bacteria 5103
131 Ga0105243_10080782 3300009148 Bacteria 2653
132 Ga0105241_10017922 3300009174 Bacteria 5207
133 Ga0105242_10035151 3300009176 Bacteria 4018
134 Ga0105242_10046504 3300009176 Bacteria 3521
135 Ga0105242_10054735 3300009176 Bacteria 3262
136 Ga0105242_10055158 3300009176 Bacteria 3251
137 Ga0105242_10129387 3300009176 Bacteria 2177
138 Ga0105242_10235811 3300009176 Bacteria 1642
139 Ga0105242_10340141 3300009176 Bacteria 1383
140 Ga0105242_10399517 3300009176 Bacteria 1282
141 Ga0105248_10043934 3300009177 Bacteria 5012
142 Ga0105248_10284402 3300009177 Bacteria 1862
143 Ga0105248_10289128 3300009177 Bacteria 1846
144 Ga0105248_10349316 3300009177 Bacteria 1665
145 Ga0105248_10350601 3300009177 Bacteria 1662
146 Ga0105237_10016005 3300009545 Bacteria 7799
147 Ga0105237_10077379 3300009545 Bacteria 3316
148 Ga0105237_10344895 3300009545 Bacteria 1494
149 Ga0105238_10000005 3300009551 Bacteria 372840
150 Ga0105238_10000280 3300009551 Bacteria 56545
151 Ga0105238_10028945 3300009551 Bacteria 5642
152 Ga0105238_10046516 3300009551 Bacteria 4378
153 Ga0105249_10298886 3300009553 Bacteria 1614
154 Ga0099796_10042197 3300010159 Bacteria 1548
155 Ga0105239_10030322 3300010375 Bacteria 5945
156 Ga0105239_10319108 3300010375 Bacteria 1752
157 Ga0105246_10310124 3300011119 Unclassified 1278
158 Ga0157370_10011961 3300013104 Bacteria 9046
159 Ga0157370_10230790 3300013104 Bacteria 1713
160 Ga0157369_10013806 3300013105 Bacteria 9130
161 Ga0157374_10000006 3300013296 Bacteria 640284
162 Ga0157374_10024485 3300013296 Bacteria 5413
163 Ga0157374_10076596 3300013296 Bacteria 3163
164 Ga0157374_10417890 3300013296 Bacteria 1339
165 Ga0157378_10000392 3300013297 Bacteria 43135
166 Ga0157378_10000546 3300013297 Bacteria 35772
167 Ga0157378_10044854 3300013297 Bacteria 3927
168 Ga0157378_10130147 3300013297 Bacteria 2329
169 Ga0157378_10622048 3300013297 Bacteria 1093
170 Ga0163162_10712382 3300013306 Bacteria 1125
171 Ga0157375_10000020 3300013308 Bacteria 251840
172 Ga0157375_10001825 3300013308 Bacteria 18277
173 Ga0157375_10029787 3300013308 Bacteria 5138
174 Ga0163163_10004027 3300014325 Bacteria 12532
175 Ga0163163_10013311 3300014325 Bacteria 7528
176 Ga0163163_10300986 3300014325 Unclassified 1656
177 Ga0163163_10646770 3300014325 Bacteria 1121
178 Ga0157380_10010219 3300014326 Bacteria 6745
179 Ga0157380_10036868 3300014326 Bacteria 3786
180 Ga0157380_10041149 3300014326 Bacteria 3604
181 Ga0157377_10000003 3300014745 Bacteria 435133
182 Ga0157377_10000058 3300014745 Bacteria 86728
183 Ga0157379_10020283 3300014968 Bacteria 5877
184 Ga0157379_10235498 3300014968 Bacteria 1660
185 Ga0157376_10000003 3300014969 Bacteria 568634
186 Ga0157376_10046466 3300014969 Bacteria 3580
187 Ga0157376_10084219 3300014969 Bacteria 2737
188 Ga0206350_11627179 3300020080 Bacteria 1937
189 Ga0213872_10006403 3300021361 Bacteria 5918
190 Ga0213876_10000066 3300021384 Bacteria 126862
191 Ga0213875_10000007 3300021388 Bacteria 562717
192 Ga0213875_10000106 3300021388 Bacteria 95400
193 Ga0247519_103124 3300023556 Eukaryota 1679
194 Ga0247521_102742 3300023557 Eukaryota 1735
195 Ga0247526_102872 3300023558 Eukaryota 1663
196 Ga0247529_102722 3300023559 Eukaryota 1712
197 Ga0247514_104156 3300023560 Eukaryota 1729
198 Ga0247518_104073 3300023561 Eukaryota 1725
199 Ga0247516_103221 3300023562 Eukaryota 1847
200 Ga0247530_102387 3300023563 Eukaryota 1662
201 Ga0247515_103435 3300023564 Eukaryota 1774
202 Ga0247531_102643 3300023666 Eukaryota 1673
203 Ga0247525_102936 3300023668 Eukaryota 1722
204 Ga0247528_101855 3300023680 Eukaryota 1711
205 Ga0247513_102936 3300023682 Eukaryota 1724
206 Ga0247523_103185 3300023684 Eukaryota 1649
207 Ga0247520_102551 3300023686 Eukaryota 1770
208 Ga0247522_103035 3300023688 Eukaryota 1718
209 Ga0247517_102647 3300023689 Eukaryota 1856
210 Ga0247512_103865 3300023690 Eukaryota 1734
211 Ga0207680_10002204 3300025903 Bacteria 9099
212 Ga0207680_10046049 3300025903 Bacteria 2577
213 Ga0207685_10002870 3300025905 Bacteria 4061
214 Ga0207685_10028005 3300025905 Bacteria 1979
215 Ga0207699_10013707 3300025906 Bacteria 4158
216 Ga0207699_10271570 3300025906 Bacteria 1175
217 Ga0207684_10045746 3300025910 Bacteria 3712
218 Ga0207684_10082937 3300025910 Bacteria 2730
219 Ga0207654_10048879 3300025911 Bacteria 2423
220 Ga0207707_10042755 3300025912 Bacteria 3953
221 Ga0207707_10215493 3300025912 Bacteria 1672
222 Ga0207707_10228133 3300025912 Bacteria 1620
223 Ga0207695_10001011 3300025913 Bacteria 49697
224 Ga0207695_10006315 3300025913 Bacteria 15418
225 Ga0207695_10030423 3300025913 Bacteria 5942
226 Ga0207695_10169614 3300025913 Unclassified 2109
227 Ga0207671_10008147 3300025914 Bacteria 8941
228 Ga0207646_10000400 3300025922 Bacteria 58084
229 Ga0207646_10052648 3300025922 Bacteria 3643
230 Ga0207646_10084605 3300025922 Bacteria 2838
231 Ga0207646_10088820 3300025922 Bacteria 2766
232 Ga0207681_10011441 3300025923 Bacteria 5453
233 Ga0207681_10025476 3300025923 Bacteria 3805
234 Ga0207694_10000001 3300025924 Bacteria 4078485
235 Ga0207694_10001089 3300025924 Bacteria 23548
236 Ga0207694_10009910 3300025924 Bacteria 7189
237 Ga0207650_10000115 3300025925 Bacteria 105044
238 Ga0207659_10090601 3300025926 Bacteria 2283
239 Ga0207687_10000006 3300025927 Bacteria 641680
240 Ga0207687_10152484 3300025927 Bacteria 1765
241 Ga0207687_10192973 3300025927 Bacteria 1586
242 Ga0207700_10005799 3300025928 Bacteria 7418
243 Ga0207700_10031518 3300025928 Bacteria 3767
244 Ga0207700_10133268 3300025928 Bacteria 2032
245 Ga0207700_10133874 3300025928 Bacteria 2028
246 Ga0207700_10430126 3300025928 Unclassified 1161
247 Ga0207644_10238397 3300025931 Unclassified 1447
248 Ga0207686_10025778 3300025934 Bacteria 3424
249 Ga0207686_10068741 3300025934 Bacteria 2270
250 Ga0207686_10130428 3300025934 Bacteria 1723
251 Ga0207686_10328215 3300025934 Bacteria 1146
252 Ga0207709_10246936 3300025935 Bacteria 1301
253 Ga0207669_10006835 3300025937 Bacteria 5246
254 Ga0207704_10055508 3300025938 Bacteria 2421
255 Ga0207704_10068995 3300025938 Bacteria 2231
256 Ga0207691_10119865 3300025940 Bacteria 2333
257 Ga0207711_10019284 3300025941 Bacteria 5680
258 Ga0207711_10072826 3300025941 Bacteria 2985
259 Ga0207711_10119099 3300025941 Bacteria 2356
260 Ga0207711_10306079 3300025941 Bacteria 1467
261 Ga0207689_10029178 3300025942 Unclassified 4610
262 Ga0207689_10098455 3300025942 Bacteria 2403
263 Ga0207661_10000006 3300025944 Bacteria 537727
264 Ga0207661_10134858 3300025944 Bacteria 2119
265 Ga0207667_10010726 3300025949 Bacteria 10689
266 Ga0207667_10026193 3300025949 Bacteria 6374
267 Ga0207667_10061271 3300025949 Bacteria 3936
268 Ga0207658_10267203 3300025986 Bacteria 1460
269 Ga0207677_10000153 3300026023 Bacteria 55121
270 Ga0207677_10013946 3300026023 Bacteria 4674
271 Ga0207677_10019662 3300026023 Bacteria 4084
272 Ga0207677_10063496 3300026023 Bacteria 2568
273 Ga0207677_10106202 3300026023 Bacteria 2080
274 Ga0207703_10148414 3300026035 Bacteria 2042
275 Ga0207639_10030065 3300026041 Bacteria 3981
276 Ga0207678_10001896 3300026067 Bacteria 19082
277 Ga0207708_10009060 3300026075 Bacteria 7363
278 Ga0207708_10013355 3300026075 Bacteria 6135
279 Ga0207702_10018806 3300026078 Bacteria 5714
280 Ga0207702_10107075 3300026078 Bacteria 2478
281 Ga0207641_10009778 3300026088 Bacteria 7896
282 Ga0207648_10042300 3300026089 Bacteria 3999
283 Ga0207676_10013266 3300026095 Bacteria 5919
284 Ga0207674_10058553 3300026116 Bacteria 3902
285 Ga0207674_10250715 3300026116 Bacteria 1717
286 Ga0207675_100038552 3300026118 Bacteria 4460
287 Ga0207683_10217638 3300026121 Bacteria 1740
288 Ga0207428_10000486 3300027907 Bacteria 47460
289 Ga0207428_10003655 3300027907 Bacteria 14825
290 Ga0207428_10031154 3300027907 Bacteria 4405
291 Ga0207428_10069883 3300027907 Bacteria 2761
292 Ga0268266_10000835 3300028379 Bacteria 40250
293 Ga0268266_10002480 3300028379 Bacteria 19713
294 Ga0268266_10158828 3300028379 Bacteria 2044
295 Ga0268265_10005666 3300028380 Bacteria 8531
296 Ga0268264_10048107 3300028381 Bacteria 3547
297 Ga0265319_1011501 3300028563 Bacteria 3621
298 Ga0265318_10000347 3300028577 Bacteria 36774
299 Ga0265318_10014030 3300028577 Bacteria 3368
300 Ga0265318_10067830 3300028577 Bacteria 1324
301 Ga0265323_10001639 3300028653 Bacteria 10767
302 Ga0265323_10014205 3300028653 Bacteria 3160
303 Ga0265323_10016449 3300028653 Bacteria 2887
304 Ga0265338_10037679 3300028800 Bacteria 4596
305 Ga0265338_10081345 3300028800 Bacteria 2717
306 Ga0311003_166887 3300029282 Bacteria 1553
307 Ga0265324_10001058 3300029957 Bacteria 16723
308 Ga0307511_10000628 3300030521 Bacteria 37805
309 Ga0265330_10000718 3300031235 Bacteria 20901
310 Ga0265330_10001084 3300031235 Bacteria 16403
311 Ga0265330_10001195 3300031235 Bacteria 15396
312 Ga0265330_10001697 3300031235 Bacteria 12463
313 Ga0265330_10003679 3300031235 Bacteria 7960
314 Ga0265332_10000920 3300031238 Bacteria 17618
315 Ga0265332_10015406 3300031238 Bacteria 3374
316 Ga0265332_10036827 3300031238 Bacteria 2123
317 Ga0265328_10007066 3300031239 Bacteria 4703
318 Ga0265328_10041183 3300031239 Bacteria 1701
319 Ga0265320_10000726 3300031240 Bacteria 25199
320 Ga0265320_10003799 3300031240 Bacteria 10019
321 Ga0265325_10000903 3300031241 Bacteria 21441
322 Ga0265325_10024890 3300031241 Bacteria 3252
323 Ga0265325_10104286 3300031241 Bacteria 1385
324 Ga0265329_10000666 3300031242 Bacteria 17637
325 Ga0265329_10002112 3300031242 Bacteria 9220
326 Ga0265340_10002116 3300031247 Bacteria 11380
327 Ga0265339_10022601 3300031249 Bacteria 3643
328 Ga0265339_10026493 3300031249 Bacteria 3320
329 Ga0265331_10000019 3300031250 Bacteria 258837
330 Ga0265331_10001289 3300031250 Bacteria 18660
331 Ga0265331_10002335 3300031250 Bacteria 12894
332 Ga0265331_10025540 3300031250 Bacteria 2981
333 Ga0265331_10030086 3300031250 Bacteria 2705
334 Ga0265331_10063376 3300031250 Bacteria 1742
335 Ga0265331_10068780 3300031250 Bacteria 1660
336 Ga0265327_10000420 3300031251 Bacteria 77601
337 Ga0265316_10003160 3300031344 Bacteria 16764
338 Ga0265316_10005513 3300031344 Bacteria 12280
339 Ga0265316_10008129 3300031344 Bacteria 9770
340 Ga0265316_10009835 3300031344 Bacteria 8775
341 Ga0265316_10021159 3300031344 Bacteria 5518
342 Ga0265316_10025959 3300031344 Bacteria 4881
343 Ga0265316_10090391 3300031344 Bacteria 2336
344 Ga0265316_10137640 3300031344 Bacteria 1836
345 Ga0310116_103478 3300031591 Eukaryota 1620
346 Ga0310117_103307 3300031592 Eukaryota 1693
347 Ga0265313_10001693 3300031595 Bacteria 20343
348 Ga0265313_10003004 3300031595 Bacteria 14025
349 Ga0265313_10005305 3300031595 Bacteria 9533
350 Ga0265313_10008011 3300031595 Bacteria 7090
351 Ga0310103_105569 3300031614 Eukaryota 1672
352 Ga0310107_104984 3300031615 Eukaryota 1733
353 Ga0310108_103350 3300031633 Eukaryota 1778
354 Ga0310115_104372 3300031635 Eukaryota 1710
355 Ga0310113_103395 3300031636 Eukaryota 1751
356 Ga0316575_10004268 3300031665 Bacteria 5019
357 Ga0316575_10004767 3300031665 Bacteria 4787
358 Ga0316575_10008074 3300031665 Bacteria 3826
359 Ga0310105_103633 3300031666 Eukaryota 1731
360 Ga0310111_104370 3300031667 Eukaryota 1773
361 Ga0310114_103105 3300031678 Eukaryota 1664
362 Ga0310119_104453 3300031686 Eukaryota 1729
363 Ga0310101_104287 3300031690 Eukaryota 1719
364 Ga0316579_10000505 3300031691 Bacteria 12751
365 Ga0316579_10001795 3300031691 Bacteria 7907
366 Ga0316579_10042392 3300031691 Bacteria 2114
367 Ga0316579_10088854 3300031691 Bacteria 1475
368 Ga0265314_10000075 3300031711 Bacteria 147341
369 Ga0265314_10002010 3300031711 Bacteria 21589
370 Ga0265314_10002372 3300031711 Bacteria 19404
371 Ga0265314_10011671 3300031711 Bacteria 7228
372 Ga0265342_10000036 3300031712 Bacteria 142882
373 Ga0265342_10001387 3300031712 Bacteria 22662
374 Ga0265342_10006550 3300031712 Bacteria 8663
375 Ga0265342_10013145 3300031712 Bacteria 5568
376 Ga0316576_10000646 3300031727 Bacteria 16869
377 Ga0316576_10013873 3300031727 Bacteria 5370
378 Ga0316576_10014391 3300031727 Bacteria 5287
379 Ga0316576_10025226 3300031727 Bacteria 4160
380 Ga0316576_10085253 3300031727 Bacteria 2348
381 Ga0316576_10196212 3300031727 Bacteria 1521
382 Ga0316578_10000138 3300031728 Bacteria 18681
383 Ga0316578_10002792 3300031728 Bacteria 7788
384 Ga0316578_10012025 3300031728 Bacteria 4555
385 Ga0316578_10034400 3300031728 Bacteria 2909
386 Ga0316577_10000619 3300031733 Bacteria 14703
387 Ga0316577_10031429 3300031733 Bacteria 2966
388 Ga0316044_103932 3300031810 Eukaryota 1844
389 Ga0316045_107597 3300031815 Eukaryota 1336
390 Ga0316042_105845 3300031816 Eukaryota 1784
391 Ga0307413_10010359 3300031824 Bacteria 4518
392 Ga0316043_105265 3300031828 Eukaryota 1845
393 Ga0307410_10076337 3300031852 Bacteria 2339
394 Ga0307411_10205028 3300032005 Bacteria 1518
395 Ga0316585_10001681 3300032137 Bacteria 5872
396 Ga0316580_10000109 3300032139 Bacteria 15261
397 Ga0316593_10000214 3300032168 Bacteria 9231
398 Ga0316593_10000891 3300032168 Bacteria 6089
399 Ga0316593_10001595 3300032168 Bacteria 5058
400 Ga0316593_10002198 3300032168 Bacteria 4560
401 Ga0316593_10002464 3300032168 Bacteria 4400
402 Ga0316593_10002612 3300032168 Bacteria 4313
403 Ga0316593_10002718 3300032168 Bacteria 4261
404 Ga0316593_10002806 3300032168 Bacteria 4217
405 Ga0316593_10002911 3300032168 Bacteria 4158
406 Ga0316593_10013592 3300032168 Bacteria 2413
407 Ga0316593_10014224 3300032168 Bacteria 2370
408 Ga0316593_10015004 3300032168 Bacteria 2323
409 Ga0316593_10049495 3300032168 Bacteria 1417
410 Ga0316592_1000598 3300033524 Bacteria 5204
411 Ga0316592_1001089 3300033524 Bacteria 4238
412 Ga0316592_1001125 3300033524 Bacteria 4189
413 Ga0316592_1002859 3300033524 Bacteria 3038
414 Ga0316592_1006374 3300033524 Bacteria 2270
415 Ga0316586_1002792 3300033527 Bacteria 2220
416 Ga0316588_1000277 3300033528 Bacteria 6330
417 Ga0316588_1000863 3300033528 Bacteria 4613
418 Ga0316588_1007063 3300033528 Bacteria 2269
419 Ga0316588_1008669 3300033528 Bacteria 2100
420 Ga0316588_1011486 3300033528 Bacteria 1890
421 Ga0316587_1003084 3300033529 Bacteria 2300
422 Ga0316587_1003135 3300033529 Bacteria 2287
423 Ga0316587_1003987 3300033529 Bacteria 2114
424 Ga0316596_1000225 3300033541 Bacteria 8518
425 Ga0316596_1000831 3300033541 Bacteria 5743
426 Ga0316596_1001071 3300033541 Bacteria 5302
427 Ga0316596_1001094 3300033541 Bacteria 5271
428 Ga0316596_1004419 3300033541 Bacteria 3153
429 Ga0316596_1004697 3300033541 Bacteria 3082
430 Ga0316596_1014144 3300033541 Bacteria 1976
431 Ga0373932_0000055 3300035112 Bacteria 27399
432 Ga0373946_0002592 3300035171 Bacteria 6390
433 Ga0373955_0113004 3300035172 Bacteria 1572
434 Ga0316574_0000468 3300035398 Bacteria 16332
435 Ga0316574_0030927 3300035398 Bacteria 3245
436 Ga0316574_0031449 3300035398 Bacteria 3219
437 Ga0316574_0031477 3300035398 Bacteria 3217
438 Ga0373924_0037024 3300035410 Bacteria 1984
439 Ga0373935_0020269 3300035692 Bacteria 4061
440 Ga0373927_0053330 3300035695 Unclassified 2616
441 Ga0373933_0031292 3300035724 Bacteria 3087
442 Ga0373947_0054811 3300035725 Bacteria 2407
443 Ga0373937_0004297 3300036401 Bacteria 12074
444 Ga0373937_0045671 3300036401 Bacteria 4003
445 Ga0373937_0088535 3300036401 Unclassified 2866
446 Ga0373937_0160694 3300036401 Bacteria 2106
447 Ga0372808_005429 3300036459 Eukaryota 1681
448 Ga0310109_005480 3300036534 Eukaryota 1626
449 Ga0310110_006088 3300036535 Eukaryota 1749
450 Ga0316582_0000060 3300036647 Bacteria 27489
451 Ga0316582_0125968 3300036647 Bacteria 1717
452 Ga0316582_0178068 3300036647 Bacteria 1446
453 Ga0316584_0003005 3300036712 Bacteria 10859
454 Ga0316584_0010119 3300036712 Bacteria 6579
455 Ga0316584_0038308 3300036712 Bacteria 3566
456 Ga0316584_0161767 3300036712 Bacteria 1663
457 Ga0395899_0005070 3300037312 Bacteria 10249
458 Ga0395899_0137742 3300037312 Bacteria 1739
459 Ga0436364_0737248 3300037853 Bacteria 154680
460 Ga0436364_1071411 3300037853 Bacteria 28160
461 Ga0395901_0204732 3300038443 Bacteria 2068
462 Ga0395901_0303232 3300038443 Bacteria 1656
463 Ga0400490_07674 3300038726 Bacteria 4689
464 Ga0400490_13033 3300038726 Bacteria 1565
465 Ga0400483_057130 3300039062 Bacteria 2685
466 Ga0400487_14277 3300039110 Bacteria 29430
467 Ga0400487_30204 3300039110 Bacteria 1445
468 Ga0436365_0285258 3300039437 Bacteria 125381
469 Ga0436365_0316969 3300039437 Bacteria 1339
470 Ga0436365_1560237 3300039437 Bacteria 1206
471 Ga0436360_0074223 3300039438 Bacteria 1387
472 Ga0436362_0290872 3300039453 Bacteria 21554
473 Ga0451808_23863 3300041464 Eukaryota 1279
474 Ga0439460_0009618 3300042461 Bacteria 2457
475 Ga0451577_0001329 3300042876 Bacteria 33659
476 Ga0451577_0031390 3300042876 Bacteria 4793
477 Ga0451577_0083955 3300042876 Bacteria 2842
478 Ga0451577_0174771 3300042876 Bacteria 1935
479 Ga0451577_0328222 3300042876 Bacteria 1388
480 Ga0453684_0000006 3300044712 Bacteria 1364191
481 Ga0453684_0000031 3300044712 Bacteria 752632
482 Ga0453684_0000040 3300044712 Bacteria 690210
483 Ga0453684_0000443 3300044712 Bacteria 168617
484 Ga0453684_0004682 3300044712 Bacteria 28347
485 Ga0453684_0008845 3300044712 Bacteria 17849
486 Ga0453684_0020635 3300044712 Bacteria 9917
487 Ga0453684_0047639 3300044712 Bacteria 5681
488 Ga0453684_0051285 3300044712 Bacteria 5412
489 Ga0453684_0061007 3300044712 Bacteria 4844
490 Ga0453684_0086333 3300044712 Bacteria 3894
491 Ga0453684_0117756 3300044712 Bacteria 3214
492 Ga0453684_0221511 3300044712 Bacteria 2191
493 Ga0466970_0027199 3300044765 Bacteria 3000
494 Ga0451576_0000444 3300045051 Bacteria 94213
495 Ga0451576_0001947 3300045051 Bacteria 32995
496 Ga0451576_0008389 3300045051 Bacteria 12131
497 Ga0451576_0052813 3300045051 Bacteria 4259
498 Ga0466967_0191703 3300045976 Bacteria 1932
499 Ga0495629_0430314 3300046459 Bacteria 895
500 Ga0495580_0189672 3300046472 Bacteria 1418
501 Ga0495639_0131470 3300046475 Bacteria 1199
502 Ga0495594_0038846 3300046499 Bacteria 2601
503 Ga0495628_0115124 3300046516 Bacteria 2065
504 Ga0495613_0014285 3300046689 Bacteria 5893
505 Ga0495581_0071720 3300047315 Bacteria 2004
506 Ga0495679_008345 3300047446 Bacteria 4220
507 Ga0496100_0077705 3300048903 Bacteria 2232
508 Ga0496101_0000685 3300048904 Bacteria 20428
509 Ga0496110_0001960 3300048913 Bacteria 15284
510 Ga0496114_0000504 3300048917 Bacteria 28590
511 Ga0496116_0000473 3300048919 Bacteria 55659
512 Ga0496116_0011173 3300048919 Bacteria 7460
513 Ga0496117_0000161 3300048920 Bacteria 141379
514 Ga0496119_0000042 3300048922 Bacteria 200701
515 Ga0496119_0068224 3300048922 Bacteria 2094
516 Ga0496120_0000083 3300048923 Bacteria 157876
517 Ga0496120_0002573 3300048923 Bacteria 18078
518 Ga0496120_0002667 3300048923 Bacteria 17583
519 Ga0496120_0097456 3300048923 Bacteria 1560
520 Ga0496122_0000012 3300048925 Bacteria 526837
521 Ga0496122_0000143 3300048925 Bacteria 168086
522 Ga0496122_0031007 3300048925 Bacteria 4461
523 Ga0496123_0001574 3300048926 Bacteria 31186
524 Ga0496123_0004362 3300048926 Bacteria 14953
525 Ga0496124_0034437 3300048927 Bacteria 4445
526 Ga0496125_0000010 3300048928 Bacteria 671167
527 Ga0496125_0044489 3300048928 Bacteria 3754
528 Ga0496126_0000008 3300048929 Bacteria 781752
529 Ga0496126_0000091 3300048929 Bacteria 209427
530 Ga0496126_0000211 3300048929 Bacteria 129943
531 Ga0496126_0000461 3300048929 Bacteria 80907
532 Ga0496126_0077610 3300048929 Bacteria 2944
533 Ga0496126_0103372 3300048929 Bacteria 2489
534 Ga0496126_0194040 3300048929 Bacteria 1718
535 Ga0501033_0040199 3300049570 Bacteria 3492
536 Ga0501033_0064824 3300049570 Bacteria 2688
537 Ga0501034_0008338 3300049571 Bacteria 10964
538 Ga0501034_0016341 3300049571 Bacteria 7616
539 Ga0501034_0020427 3300049571 Bacteria 6762
540 Ga0501034_0025878 3300049571 Bacteria 5976
541 Ga0501034_0123689 3300049571 Bacteria 2573
542 Ga0501037_0013024 3300049573 Bacteria 6132
543 Ga0501038_0190991 3300049574 Unclassified 1648
544 Ga0501038_0269703 3300049574 Bacteria 1342
545 Ga0501039_0075705 3300049575 Bacteria 2616
546 Ga0501039_0245589 3300049575 Bacteria 1408
547 Ga0501040_0064347 3300049576 Bacteria 2525
548 Ga0501043_0158977 3300049579 Bacteria 1766
549 Ga0501046_0000037 3300049580 Bacteria 159431
550 Ga0501046_0017699 3300049580 Bacteria 5944
551 Ga0501046_0067503 3300049580 Bacteria 2785
552 Ga0501046_0238754 3300049580 Unclassified 1341
553 Ga0501046_0274392 3300049580 Bacteria 1236
554 Ga0501047_0009603 3300049581 Bacteria 9146
555 Ga0501047_0011106 3300049581 Bacteria 8524
556 Ga0501047_0012186 3300049581 Bacteria 8139
557 Ga0501047_0136512 3300049581 Unclassified 2333
558 Ga0501047_0345080 3300049581 Unclassified 1326
559 Ga0501047_0371387 3300049581 Bacteria 1265
560 Ga0501067_0121998 3300049583 Bacteria 1450
561 Ga0501069_0068051 3300049585 Bacteria 1993
562 Ga0501070_0001559 3300049586 Bacteria 20381
563 Ga0501070_0008616 3300049586 Bacteria 8626
564 Ga0501070_0033085 3300049586 Bacteria 4325
565 Ga0501071_0007295 3300049587 Bacteria 7239
566 Ga0501071_0015020 3300049587 Bacteria 5308
567 Ga0501071_0145197 3300049587 Bacteria 1768
568 Ga0501072_0015283 3300049588 Bacteria 5885
569 Ga0501073_0008905 3300049589 Bacteria 7417
570 Ga0501073_0050679 3300049589 Bacteria 2909
571 Ga0501074_0288167 3300049590 Bacteria 1167
572 Ga0501075_0040114 3300049591 Bacteria 3505
573 Ga0501075_0112808 3300049591 Bacteria 2067
574 Ga0501079_0181947 3300049741 Bacteria 1640
575 Ga0501080_0182497 3300049742 Bacteria 1930
576 Ga0501080_0283637 3300049742 Bacteria 1505
577 Ga0501081_0042837 3300049743 Bacteria 3103
578 Ga0501035_0062267 3300049822 Bacteria 3320
579 Ga0501044_0001456 3300049823 Bacteria 27781
580 Ga0501044_0007831 3300049823 Bacteria 11744
581 Ga0501044_0008147 3300049823 Bacteria 11499
582 Ga0501044_0011204 3300049823 Bacteria 9724
583 Ga0501044_0021481 3300049823 Bacteria 6883
584 Ga0501044_0069608 3300049823 Bacteria 3582
585 Ga0501044_0187234 3300049823 Bacteria 2034
586 Ga0501044_0247975 3300049823 Bacteria 1723
587 nmdc:mga05p37_30065_c1 3300050507 Bacteria 6629
588 nmdc:mga05p37_99915_c1 3300050507 Bacteria 3573
589 nmdc:mga0qj67_10476_c1 3300050509 Bacteria 6925
590 nmdc:mga0qj67_122431_c1 3300050509 Archaea 2104
591 nmdc:mga0qj67_296941_c1 3300050509 Unclassified 1309
592 nmdc:mga06r32_38774_c1 3300050510 Bacteria 4517
593 nmdc:mga08y16_123166_c1 3300050511 Bacteria 2698
594 nmdc:mga08y16_148615_c1 3300050511 Bacteria 2436
595 nmdc:mga08y16_5843_c1 3300050511 Bacteria 12897
596 nmdc:mga08y16_6667_c1 3300050511 Bacteria 12111
597 nmdc:mga0n895_117899_c1 3300050512 Bacteria 2674
598 nmdc:mga0n895_53041_c1 3300050512 Bacteria 3982
599 nmdc:mga0rr50_84970_c1 3300050513 Bacteria 2451
600 nmdc:mga08x19_191_c1 3300050514 Bacteria 48247
601 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
602 nmdc:mga0a205_12338_c1 3300050515 Bacteria 7904
603 nmdc:mga0a205_34810_c1 3300050515 Bacteria 4833
604 Ga0495619_0324326 3300053085 Bacteria 1066
605 Ga0500646_0023522 3300053090 Bacteria 1653
606 Ga0500647_0032015 3300053091 Bacteria 2504
607 Ga0500556_0008031 3300053104 Bacteria 3035
608 Ga0500562_000318 3300053108 Bacteria 11718
609 Ga0500595_003547 3300053119 Bacteria 7249
610 Ga0500568_0000362 3300053139 Bacteria 35157
611 Ga0590075_015137 3300059424 Bacteria 1892
612 Ga0587072_006742 3300059643 Eukaryota 1759
613 Ga0587071_007502 3300060344 Eukaryota 1741
614 Ga0501082_0039733 3300060353 Bacteria 4059
615 Ga0501082_0226141 3300060353 Bacteria 1628

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10031518 Ga0207700_100315182 271
2 3300046459 Ga0495629_0430314 Ga0495629_0430314_24_872 275
3 3300009093 Ga0105240_10816088 Ga0105240_108160881 276
4 3300013297 Ga0157378_10622048 Ga0157378_106220481 276
5 3300049574 Ga0501038_0190991 Ga0501038_0190991_743_1627 278
6 3300049590 Ga0501074_0288167 Ga0501074_0288167_260_1144 278
7 3300009176 Ga0105242_10399517 Ga0105242_103995172 279
8 3300039437 Ga0436365_0316969 Ga0436365_0316969_417_1328 290
9 3300035398 Ga0316574_0031449 Ga0316574_0031449_2250_3158 294
10 3300005434 Ga0070709_10016682 Ga0070709_100166823 309
11 3300025906 Ga0207699_10013707 Ga0207699_100137074 309
12 3300025928 Ga0207700_10133268 Ga0207700_101332682 309
13 3300005563 Ga0068855_100010762 Ga0068855_1000107624 310
14 3300009093 Ga0105240_10000709 Ga0105240_1000070944 310
15 3300013104 Ga0157370_10011961 Ga0157370_100119618 310
16 3300025913 Ga0207695_10030423 Ga0207695_100304237 310
17 3300025949 Ga0207667_10010726 Ga0207667_100107262 310
18 3300031711 Ga0265314_10011671 Ga0265314_100116715 310
19 3300005434 Ga0070709_10023748 Ga0070709_100237483 311
20 3300050513 nmdc:mga0rr50_84970_c1 nmdc:mga0rr50_84970_c1_475_1452 312
21 3300049742 Ga0501080_0283637 Ga0501080_0283637_21_1007 313
22 3300036401 Ga0373937_0045671 Ga0373937_0045671_2437_3420 314
23 3300005445 Ga0070708_100022493 Ga0070708_1000224932 316
24 3300005536 Ga0070697_100048957 Ga0070697_1000489573 316
25 3300025942 Ga0207689_10098455 Ga0207689_100984553 317
26 3300005335 Ga0070666_10003473 Ga0070666_100034732 318
27 3300005338 Ga0068868_100265865 Ga0068868_1002658652 318
28 3300005367 Ga0070667_100026186 Ga0070667_1000261864 318
29 3300006844 Ga0075428_100009648 Ga0075428_1000096486 318
30 3300009094 Ga0111539_10023461 Ga0111539_100234612 318
31 3300009098 Ga0105245_10055670 Ga0105245_100556702 318
32 3300009176 Ga0105242_10054735 Ga0105242_100547352 318
33 3300009176 Ga0105242_10055158 Ga0105242_100551583 318
34 3300009545 Ga0105237_10344895 Ga0105237_103448952 318
35 3300013104 Ga0157370_10230790 Ga0157370_102307902 318
36 3300013296 Ga0157374_10024485 Ga0157374_100244853 318
37 3300014325 Ga0163163_10013311 Ga0163163_100133111 318
38 3300014969 Ga0157376_10046466 Ga0157376_100464662 318
39 3300025903 Ga0207680_10002204 Ga0207680_1000220411 318
40 3300025927 Ga0207687_10192973 Ga0207687_101929732 318
41 3300025934 Ga0207686_10025778 Ga0207686_100257784 318
42 3300025934 Ga0207686_10068741 Ga0207686_100687412 318
43 3300025941 Ga0207711_10119099 Ga0207711_101190992 318
44 3300025986 Ga0207658_10267203 Ga0207658_102672032 318
45 3300026023 Ga0207677_10106202 Ga0207677_101062021 318
46 3300026121 Ga0207683_10217638 Ga0207683_102176381 318
47 3300027907 Ga0207428_10003655 Ga0207428_100036555 318
48 3300028379 Ga0268266_10158828 Ga0268266_101588281 318
49 3300031711 Ga0265314_10002010 Ga0265314_1000201019 318
50 3300046472 Ga0495580_0189672 Ga0495580_0189672_63_1067 318
51 3300049570 Ga0501033_0064824 Ga0501033_0064824_33_1052 318
52 3300049574 Ga0501038_0269703 Ga0501038_0269703_145_1164 318
53 3300049580 Ga0501046_0274392 Ga0501046_0274392_145_1164 318
54 3300049581 Ga0501047_0009603 Ga0501047_0009603_5067_6086 318
55 3300049581 Ga0501047_0345080 Ga0501047_0345080_260_1282 318
56 3300049586 Ga0501070_0008616 Ga0501070_0008616_3191_4210 318
57 3300049822 Ga0501035_0062267 Ga0501035_0062267_1098_2120 318
58 3300049823 Ga0501044_0007831 Ga0501044_0007831_1309_2331 318
59 3300049823 Ga0501044_0008147 Ga0501044_0008147_7050_8072 318
60 3300049823 Ga0501044_0021481 Ga0501044_0021481_382_1401 318
61 3300050511 nmdc:mga08y16_6667_c1 nmdc:mga08y16_6667_c1_6753_7754 318
62 3300053085 Ga0495619_0324326 Ga0495619_0324326_23_1027 318
63 3300059424 Ga0590075_015137 Ga0590075_015137_721_1710 318
64 3300005329 Ga0070683_100084079 Ga0070683_1000840793 319
65 3300005334 Ga0068869_100043285 Ga0068869_1000432853 319
66 3300005718 Ga0068866_10175749 Ga0068866_101757491 319
67 3300009176 Ga0105242_10035151 Ga0105242_100351513 319
68 3300010375 Ga0105239_10319108 Ga0105239_103191082 319
69 3300025942 Ga0207689_10029178 Ga0207689_100291783 319
70 3300031344 Ga0265316_10008129 Ga0265316_100081293 319
71 3300031344 Ga0265316_10025959 Ga0265316_100259594 319
72 3300035695 Ga0373927_0053330 Ga0373927_0053330_1398_2405 319
73 3300038443 Ga0395901_0204732 Ga0395901_0204732_267_1289 319
74 3300053139 Ga0500568_0000362 Ga0500568_0000362_22547_23554 319
75 3300005549 Ga0070704_100022666 Ga0070704_1000226664 320
76 3300005617 Ga0068859_100000020 Ga0068859_10000002081 320
77 3300006931 Ga0097620_100000020 Ga0097620_10000002081 320
78 3300009176 Ga0105242_10129387 Ga0105242_101293872 320
79 3300009177 Ga0105248_10349316 Ga0105248_103493162 320
80 3300035725 Ga0373947_0054811 Ga0373947_0054811_330_1346 320
81 3300036401 Ga0373937_0004297 Ga0373937_0004297_7319_8335 320
82 3300048903 Ga0496100_0077705 Ga0496100_0077705_102_1112 320
83 3300048904 Ga0496101_0000685 Ga0496101_0000685_115_1125 320
84 3300048917 Ga0496114_0000504 Ga0496114_0000504_13977_14987 320
85 3300009148 Ga0105243_10019800 Ga0105243_100198004 321
86 3300009553 Ga0105249_10298886 Ga0105249_102988861 321
87 3300026023 Ga0207677_10063496 Ga0207677_100634962 321
88 3300046499 Ga0495594_0038846 Ga0495594_0038846_913_1935 321
89 3300049589 Ga0501073_0008905 Ga0501073_0008905_6014_7000 321
90 3300049742 Ga0501080_0182497 Ga0501080_0182497_655_1641 321
91 3300005327 Ga0070658_10046994 Ga0070658_100469942 322
92 3300005335 Ga0070666_10181348 Ga0070666_101813482 322
93 3300005338 Ga0068868_100013770 Ga0068868_1000137702 322
94 3300005548 Ga0070665_100032461 Ga0070665_1000324614 322
95 3300005563 Ga0068855_100082385 Ga0068855_1000823853 322
96 3300005564 Ga0070664_100069911 Ga0070664_1000699114 322
97 3300005577 Ga0068857_100050661 Ga0068857_1000506612 322
98 3300005614 Ga0068856_100024922 Ga0068856_1000249224 322
99 3300005617 Ga0068859_100074968 Ga0068859_1000749684 322
100 3300005841 Ga0068863_100004416 Ga0068863_1000044165 322
101 3300005842 Ga0068858_100017600 Ga0068858_1000176005 322
102 3300006237 Ga0097621_100021142 Ga0097621_1000211423 322
103 3300006237 Ga0097621_100105192 Ga0097621_1001051922 322
104 3300006358 Ga0068871_100020930 Ga0068871_1000209302 322
105 3300006931 Ga0097620_100074969 Ga0097620_1000749692 322
106 3300009148 Ga0105243_10080782 Ga0105243_100807823 322
107 3300009174 Ga0105241_10017922 Ga0105241_100179222 322
108 3300009176 Ga0105242_10046504 Ga0105242_100465043 322
109 3300009176 Ga0105242_10235811 Ga0105242_102358111 322
110 3300009177 Ga0105248_10043934 Ga0105248_100439344 322
111 3300009177 Ga0105248_10350601 Ga0105248_103506011 322
112 3300009545 Ga0105237_10077379 Ga0105237_100773793 322
113 3300009551 Ga0105238_10028945 Ga0105238_100289454 322
114 3300009551 Ga0105238_10046516 Ga0105238_100465163 322
115 3300010375 Ga0105239_10030322 Ga0105239_100303223 322
116 3300013308 Ga0157375_10029787 Ga0157375_100297873 322
117 3300014325 Ga0163163_10004027 Ga0163163_1000402712 322
118 3300014325 Ga0163163_10646770 Ga0163163_106467701 322
119 3300014968 Ga0157379_10020283 Ga0157379_100202834 322
120 3300025903 Ga0207680_10046049 Ga0207680_100460493 322
121 3300025906 Ga0207699_10271570 Ga0207699_102715701 322
122 3300025911 Ga0207654_10048879 Ga0207654_100488792 322
123 3300025924 Ga0207694_10009910 Ga0207694_100099105 322
124 3300025931 Ga0207644_10238397 Ga0207644_102383972 322
125 3300025934 Ga0207686_10328215 Ga0207686_103282151 322
126 3300025941 Ga0207711_10072826 Ga0207711_100728263 322
127 3300025941 Ga0207711_10306079 Ga0207711_103060791 322
128 3300025949 Ga0207667_10061271 Ga0207667_100612714 322
129 3300026023 Ga0207677_10013946 Ga0207677_100139464 322
130 3300026035 Ga0207703_10148414 Ga0207703_101484142 322
131 3300026078 Ga0207702_10018806 Ga0207702_100188061 322
132 3300026088 Ga0207641_10009778 Ga0207641_100097783 322
133 3300026095 Ga0207676_10013266 Ga0207676_100132661 322
134 3300026116 Ga0207674_10058553 Ga0207674_100585533 322
135 3300006914 Ga0075436_100000019 Ga0075436_10000001996 323
136 3300014745 Ga0157377_10000058 Ga0157377_1000005818 323
137 3300035112 Ga0373932_0000055 Ga0373932_0000055_5143_6147 323
138 3300042876 Ga0451577_0174771 Ga0451577_0174771_440_1483 323
139 3300044712 Ga0453684_0061007 Ga0453684_0061007_1999_3018 323
140 3300044712 Ga0453684_0117756 Ga0453684_0117756_1981_3024 323
141 3300049575 Ga0501039_0075705 Ga0501039_0075705_113_1153 323
142 3300049588 Ga0501072_0015283 Ga0501072_0015283_4712_5752 323
143 3300050514 nmdc:mga08x19_1_c1 nmdc:mga08x19_1_c1_1644653_1645666 323
144 3300005436 Ga0070713_100010196 Ga0070713_1000101967 324
145 3300005536 Ga0070697_100027109 Ga0070697_1000271094 324
146 3300005617 Ga0068859_100435552 Ga0068859_1004355522 324
147 3300009093 Ga0105240_10024692 Ga0105240_100246925 324
148 3300010159 Ga0099796_10042197 Ga0099796_100421972 324
149 3300025913 Ga0207695_10169614 Ga0207695_101696142 324
150 3300025928 Ga0207700_10005799 Ga0207700_100057994 324
151 3300031250 Ga0265331_10002335 Ga0265331_1000233511 324
152 3300031344 Ga0265316_10021159 Ga0265316_100211594 324
153 3300035724 Ga0373933_0031292 Ga0373933_0031292_1355_2389 324
154 3300036401 Ga0373937_0088535 Ga0373937_0088535_1578_2612 324
155 3300046689 Ga0495613_0014285 Ga0495613_0014285_273_1307 324
156 3300047315 Ga0495581_0071720 Ga0495581_0071720_155_1189 324
157 3300050514 nmdc:mga08x19_191_c1 nmdc:mga08x19_191_c1_31733_32749 324
158 3300005329 Ga0070683_100017049 Ga0070683_1000170491 325
159 3300005331 Ga0070670_100000150 Ga0070670_10000015015 325
160 3300005338 Ga0068868_100000028 Ga0068868_10000002856 325
161 3300005444 Ga0070694_100002182 Ga0070694_1000021829 325
162 3300005578 Ga0068854_100008184 Ga0068854_1000081843 325
163 3300005578 Ga0068854_100017695 Ga0068854_1000176953 325
164 3300005937 Ga0081455_10215603 Ga0081455_102156032 325
165 3300005985 Ga0081539_10002036 Ga0081539_1000203622 325
166 3300006846 Ga0075430_100006967 Ga0075430_1000069679 325
167 3300009098 Ga0105245_10000006 Ga0105245_10000006265 325
168 3300009551 Ga0105238_10000005 Ga0105238_10000005260 325
169 3300011119 Ga0105246_10310124 Ga0105246_103101241 325
170 3300013105 Ga0157369_10013806 Ga0157369_100138062 325
171 3300013296 Ga0157374_10000006 Ga0157374_10000006498 325
172 3300013297 Ga0157378_10000392 Ga0157378_1000039218 325
173 3300013297 Ga0157378_10000546 Ga0157378_1000054633 325
174 3300013308 Ga0157375_10000020 Ga0157375_1000002028 325
175 3300013308 Ga0157375_10001825 Ga0157375_100018254 325
176 3300014325 Ga0163163_10300986 Ga0163163_103009862 325
177 3300014745 Ga0157377_10000003 Ga0157377_1000000378 325
178 3300014969 Ga0157376_10000003 Ga0157376_10000003407 325
179 3300021384 Ga0213876_10000066 Ga0213876_1000006693 325
180 3300025924 Ga0207694_10000001 Ga0207694_100000012897 325
181 3300025925 Ga0207650_10000115 Ga0207650_1000011539 325
182 3300025927 Ga0207687_10000006 Ga0207687_10000006174 325
183 3300025944 Ga0207661_10000006 Ga0207661_10000006296 325
184 3300026023 Ga0207677_10000153 Ga0207677_1000015316 325
185 3300030521 Ga0307511_10000628 Ga0307511_1000062823 325
186 3300031665 Ga0316575_10004268 Ga0316575_100042682 325
187 3300039437 Ga0436365_0285258 Ga0436365_0285258_93284_94336 325
188 3300039453 Ga0436362_0290872 Ga0436362_0290872_2060_3112 325
189 3300044712 Ga0453684_0020635 Ga0453684_0020635_143_1150 325
190 3300047446 Ga0495679_008345 Ga0495679_008345_1796_2821 325
191 3300050509 nmdc:mga0qj67_10476_c1 nmdc:mga0qj67_10476_c1_4509_5546 325
192 3300050510 nmdc:mga06r32_38774_c1 nmdc:mga06r32_38774_c1_2727_3764 325
193 3300005445 Ga0070708_100001314 Ga0070708_10000131414 326
194 3300005468 Ga0070707_100000212 Ga0070707_10000021237 326
195 3300005468 Ga0070707_100059473 Ga0070707_1000594731 326
196 3300005468 Ga0070707_100299199 Ga0070707_1002991992 326
197 3300005518 Ga0070699_100205394 Ga0070699_1002053941 326
198 3300025922 Ga0207646_10000400 Ga0207646_1000040036 326
199 3300005327 Ga0070658_10172234 Ga0070658_101722341 327
200 3300005458 Ga0070681_10412664 Ga0070681_104126641 327
201 3300005468 Ga0070707_100008812 Ga0070707_1000088124 327
202 3300005530 Ga0070679_100120828 Ga0070679_1001208282 327
203 3300005563 Ga0068855_100159601 Ga0068855_1001596012 327
204 3300009093 Ga0105240_10271050 Ga0105240_102710502 327
205 3300021388 Ga0213875_10000106 Ga0213875_1000010682 327
206 3300025912 Ga0207707_10215493 Ga0207707_102154932 327
207 3300025922 Ga0207646_10088820 Ga0207646_100888203 327
208 3300025949 Ga0207667_10026193 Ga0207667_100261933 327
209 3300026067 Ga0207678_10001896 Ga0207678_1000189615 327
210 3300037853 Ga0436364_0737248 Ga0436364_0737248_137812_138816 327
211 3300005353 Ga0070669_100004094 Ga0070669_1000040948 328
212 3300006914 Ga0075436_100088435 Ga0075436_1000884352 328
213 3300007076 Ga0075435_100036063 Ga0075435_1000360632 328
214 3300007265 Ga0099794_10124541 Ga0099794_101245411 328
215 3300009147 Ga0114129_10009063 Ga0114129_100090631 328
216 3300025923 Ga0207681_10011441 Ga0207681_100114412 328
217 3300025940 Ga0207691_10119865 Ga0207691_101198652 328
218 3300028379 Ga0268266_10000835 Ga0268266_1000083515 328
219 3300028653 Ga0265323_10001639 Ga0265323_100016397 328
220 3300028800 Ga0265338_10081345 Ga0265338_100813452 328
221 3300031238 Ga0265332_10015406 Ga0265332_100154062 328
222 3300031241 Ga0265325_10000903 Ga0265325_1000090310 328
223 3300031247 Ga0265340_10002116 Ga0265340_1000211611 328
224 3300031249 Ga0265339_10022601 Ga0265339_100226012 328
225 3300031250 Ga0265331_10025540 Ga0265331_100255402 328
226 3300031344 Ga0265316_10009835 Ga0265316_100098354 328
227 3300031711 Ga0265314_10000075 Ga0265314_1000007583 328
228 3300031712 Ga0265342_10000036 Ga0265342_1000003692 328
229 3300032168 Ga0316593_10002198 Ga0316593_100021983 328
230 3300032168 Ga0316593_10002806 Ga0316593_100028065 328
231 3300033541 Ga0316596_1001094 Ga0316596_10010946 328
232 3300044712 Ga0453684_0086333 Ga0453684_0086333_1807_2889 328
233 3300049570 Ga0501033_0040199 Ga0501033_0040199_1444_2451 328
234 3300049571 Ga0501034_0016341 Ga0501034_0016341_2920_3927 328
235 3300049579 Ga0501043_0158977 Ga0501043_0158977_513_1520 328
236 3300049580 Ga0501046_0067503 Ga0501046_0067503_1309_2316 328
237 3300049581 Ga0501047_0011106 Ga0501047_0011106_5462_6469 328
238 3300049581 Ga0501047_0371387 Ga0501047_0371387_16_1023 328
239 3300049586 Ga0501070_0001559 Ga0501070_0001559_6733_7740 328
240 3300049823 Ga0501044_0069608 Ga0501044_0069608_2358_3365 328
241 3300049823 Ga0501044_0187234 Ga0501044_0187234_690_1697 328
242 3300050507 nmdc:mga05p37_30065_c1 nmdc:mga05p37_30065_c1_461_1519 328
243 3300050512 nmdc:mga0n895_117899_c1 nmdc:mga0n895_117899_c1_561_1619 328
244 3300050515 nmdc:mga0a205_12338_c1 nmdc:mga0a205_12338_c1_3978_5036 328
245 3300005327 Ga0070658_10000031 Ga0070658_1000003166 329
246 3300005937 Ga0081455_10195861 Ga0081455_101958612 329
247 3300014968 Ga0157379_10235498 Ga0157379_102354982 329
248 3300020080 Ga0206350_11627179 Ga0206350_116271792 329
249 3300049571 Ga0501034_0008338 Ga0501034_0008338_1281_2318 329
250 3300049576 Ga0501040_0064347 Ga0501040_0064347_23_1060 329
251 3300049581 Ga0501047_0012186 Ga0501047_0012186_2395_3432 329
252 3300049585 Ga0501069_0068051 Ga0501069_0068051_828_1844 329
253 3300049587 Ga0501071_0145197 Ga0501071_0145197_576_1592 329
254 3300049589 Ga0501073_0050679 Ga0501073_0050679_183_1199 329
255 3300049591 Ga0501075_0112808 Ga0501075_0112808_151_1188 329
256 3300049741 Ga0501079_0181947 Ga0501079_0181947_475_1491 329
257 3300049743 Ga0501081_0042837 Ga0501081_0042837_191_1228 329
258 3300049823 Ga0501044_0011204 Ga0501044_0011204_3647_4684 329
259 3300053104 Ga0500556_0008031 Ga0500556_0008031_1737_2789 329
260 3300006237 Ga0097621_100000311 Ga0097621_10000031111 330
261 3300006358 Ga0068871_100000337 Ga0068871_10000033725 330
262 3300006914 Ga0075436_100005231 Ga0075436_1000052313 330
263 3300028653 Ga0265323_10014205 Ga0265323_100142052 330
264 3300028653 Ga0265323_10016449 Ga0265323_100164492 330
265 3300028800 Ga0265338_10037679 Ga0265338_100376792 330
266 3300031235 Ga0265330_10000718 Ga0265330_100007185 330
267 3300031235 Ga0265330_10001195 Ga0265330_100011954 330
268 3300031235 Ga0265330_10001697 Ga0265330_100016977 330
269 3300031235 Ga0265330_10003679 Ga0265330_100036794 330
270 3300031238 Ga0265332_10036827 Ga0265332_100368273 330
271 3300031239 Ga0265328_10041183 Ga0265328_100411832 330
272 3300031242 Ga0265329_10000666 Ga0265329_100006662 330
273 3300031250 Ga0265331_10063376 Ga0265331_100633762 330
274 3300031344 Ga0265316_10005513 Ga0265316_100055135 330
275 3300031344 Ga0265316_10090391 Ga0265316_100903912 330
276 3300031344 Ga0265316_10137640 Ga0265316_101376402 330
277 3300031712 Ga0265342_10001387 Ga0265342_1000138717 330
278 3300031712 Ga0265342_10006550 Ga0265342_100065504 330
279 3300044765 Ga0466970_0027199 Ga0466970_0027199_1186_2217 330
280 3300046475 Ga0495639_0131470 Ga0495639_0131470_49_1086 330
281 3300005329 Ga0070683_100122865 Ga0070683_1001228651 331
282 3300005436 Ga0070713_100065385 Ga0070713_1000653853 331
283 3300005436 Ga0070713_100127647 Ga0070713_1001276473 331
284 3300005535 Ga0070684_100073268 Ga0070684_1000732682 331
285 3300025928 Ga0207700_10133874 Ga0207700_101338743 331
286 3300025944 Ga0207661_10134858 Ga0207661_101348583 331
287 3300027907 Ga0207428_10000486 Ga0207428_1000048621 331
288 3300028563 Ga0265319_1011501 Ga0265319_10115011 331
289 3300028577 Ga0265318_10000347 Ga0265318_1000034719 331
290 3300028577 Ga0265318_10014030 Ga0265318_100140302 331
291 3300031235 Ga0265330_10001084 Ga0265330_100010843 331
292 3300031238 Ga0265332_10000920 Ga0265332_100009205 331
293 3300031239 Ga0265328_10007066 Ga0265328_100070662 331
294 3300031240 Ga0265320_10000726 Ga0265320_100007263 331
295 3300031241 Ga0265325_10024890 Ga0265325_100248902 331
296 3300031242 Ga0265329_10002112 Ga0265329_100021128 331
297 3300031249 Ga0265339_10026493 Ga0265339_100264932 331
298 3300031250 Ga0265331_10001289 Ga0265331_100012895 331
299 3300031344 Ga0265316_10003160 Ga0265316_100031603 331
300 3300031595 Ga0265313_10008011 Ga0265313_100080112 331
301 3300031712 Ga0265342_10013145 Ga0265342_100131452 331
302 3300033529 Ga0316587_1003135 Ga0316587_10031353 331
303 3300035171 Ga0373946_0002592 Ga0373946_0002592_1066_2112 331
304 3300035410 Ga0373924_0037024 Ga0373924_0037024_357_1403 331
305 3300035692 Ga0373935_0020269 Ga0373935_0020269_946_1992 331
306 3300036401 Ga0373937_0160694 Ga0373937_0160694_889_1935 331
307 3300050511 nmdc:mga08y16_5843_c1 nmdc:mga08y16_5843_c1_6745_7806 331
308 iso_pu_bacteria 2511231119 2511699025 331
309 iso_pu_bacteria 2540341094 2540606256 331
310 iso_pu_bacteria 3006879489 3006880276 331
311 3300005578 Ga0068854_100009584 Ga0068854_1000095843 332
312 3300006880 Ga0075429_100360010 Ga0075429_1003600101 332
313 3300009147 Ga0114129_10244860 Ga0114129_102448601 332
314 3300025935 Ga0207709_10246936 Ga0207709_102469362 332
315 3300027907 Ga0207428_10031154 Ga0207428_100311542 332
316 3300031727 Ga0316576_10014391 Ga0316576_100143914 332
317 3300031824 Ga0307413_10010359 Ga0307413_100103594 332
318 3300035172 Ga0373955_0113004 Ga0373955_0113004_129_1193 332
319 3300045051 Ga0451576_0008389 Ga0451576_0008389_4042_5139 332
320 3300046516 Ga0495628_0115124 Ga0495628_0115124_805_1869 332
321 3300048929 Ga0496126_0000091 Ga0496126_0000091_39287_40435 332
322 3300049587 Ga0501071_0007295 Ga0501071_0007295_2732_3760 332
323 3300049591 Ga0501075_0040114 Ga0501075_0040114_745_1773 332
324 3300050511 nmdc:mga08y16_148615_c1 nmdc:mga08y16_148615_c1_768_1814 332
325 3300060353 Ga0501082_0226141 Ga0501082_0226141_205_1233 332
326 3300005981 Ga0081538_10029223 Ga0081538_100292233 333
327 3300031250 Ga0265331_10068780 Ga0265331_100687803 333
328 3300006846 Ga0075430_100307845 Ga0075430_1003078452 334
329 3300026075 Ga0207708_10009060 Ga0207708_100090602 334
330 3300031852 Ga0307410_10076337 Ga0307410_100763372 334
331 3300050509 nmdc:mga0qj67_296941_c1 nmdc:mga0qj67_296941_c1_159_1214 334
332 3300005334 Ga0068869_100032869 Ga0068869_1000328693 335
333 3300005434 Ga0070709_10058667 Ga0070709_100586672 335
334 3300005441 Ga0070700_100001476 Ga0070700_1000014767 335
335 3300005456 Ga0070678_100355853 Ga0070678_1003558531 335
336 3300005458 Ga0070681_10059776 Ga0070681_100597761 335
337 3300005539 Ga0068853_100008821 Ga0068853_1000088214 335
338 3300005549 Ga0070704_100100026 Ga0070704_1001000261 335
339 3300005549 Ga0070704_100160408 Ga0070704_1001604082 335
340 3300005563 Ga0068855_100192597 Ga0068855_1001925973 335
341 3300005564 Ga0070664_100174068 Ga0070664_1001740682 335
342 3300005577 Ga0068857_100095725 Ga0068857_1000957254 335
343 3300006173 Ga0070716_100053321 Ga0070716_1000533213 335
344 3300006844 Ga0075428_100160572 Ga0075428_1001605722 335
345 3300006847 Ga0075431_100043392 Ga0075431_1000433922 335
346 3300009094 Ga0111539_10585367 Ga0111539_105853671 335
347 3300009177 Ga0105248_10289128 Ga0105248_102891282 335
348 3300009545 Ga0105237_10016005 Ga0105237_100160055 335
349 3300013296 Ga0157374_10076596 Ga0157374_100765963 335
350 3300013297 Ga0157378_10044854 Ga0157378_100448542 335
351 3300013297 Ga0157378_10130147 Ga0157378_101301471 335
352 3300013306 Ga0163162_10712382 Ga0163162_107123821 335
353 3300014326 Ga0157380_10036868 Ga0157380_100368683 335
354 3300021361 Ga0213872_10006403 Ga0213872_100064034 335
355 3300025912 Ga0207707_10042755 Ga0207707_100427551 335
356 3300025914 Ga0207671_10008147 Ga0207671_100081475 335
357 3300026041 Ga0207639_10030065 Ga0207639_100300652 335
358 3300026075 Ga0207708_10013355 Ga0207708_100133552 335
359 3300026116 Ga0207674_10250715 Ga0207674_102507152 335
360 3300027907 Ga0207428_10069883 Ga0207428_100698833 335
361 3300031691 Ga0316579_10001795 Ga0316579_100017958 335
362 3300038726 Ga0400490_07674 Ga0400490_07674_2827_3855 335
363 3300038726 Ga0400490_13033 Ga0400490_13033_209_1237 335
364 3300039062 Ga0400483_057130 Ga0400483_057130_65_1093 335
365 3300049580 Ga0501046_0017699 Ga0501046_0017699_2853_3881 335
366 3300050511 nmdc:mga08y16_123166_c1 nmdc:mga08y16_123166_c1_1259_2314 335
367 3300053090 Ga0500646_0023522 Ga0500646_0023522_93_1148 335
368 3300028577 Ga0265318_10067830 Ga0265318_100678301 336
369 3300031691 Ga0316579_10042392 Ga0316579_100423922 336
370 3300031728 Ga0316578_10012025 Ga0316578_100120251 336
371 3300032168 Ga0316593_10000214 Ga0316593_100002147 336
372 3300032168 Ga0316593_10002464 Ga0316593_100024646 336
373 3300032168 Ga0316593_10002612 Ga0316593_100026127 336
374 3300032168 Ga0316593_10013592 Ga0316593_100135923 336
375 3300033524 Ga0316592_1002859 Ga0316592_10028594 336
376 3300033527 Ga0316586_1002792 Ga0316586_10027922 336
377 3300033541 Ga0316596_1004419 Ga0316596_10044192 336
378 3300036647 Ga0316582_0125968 Ga0316582_0125968_119_1153 336
379 3300036647 Ga0316582_0178068 Ga0316582_0178068_108_1139 336
380 3300005544 Ga0070686_100037862 Ga0070686_1000378623 337
381 3300006237 Ga0097621_100091017 Ga0097621_1000910173 337
382 3300006358 Ga0068871_100034122 Ga0068871_1000341225 337
383 3300006881 Ga0068865_100108607 Ga0068865_1001086072 337
384 3300009098 Ga0105245_10041058 Ga0105245_100410585 337
385 3300009176 Ga0105242_10340141 Ga0105242_103401412 337
386 3300014969 Ga0157376_10084219 Ga0157376_100842193 337
387 3300025927 Ga0207687_10152484 Ga0207687_101524842 337
388 3300025928 Ga0207700_10430126 Ga0207700_104301261 337
389 3300025938 Ga0207704_10055508 Ga0207704_100555083 337
390 3300025941 Ga0207711_10019284 Ga0207711_100192842 337
391 3300026023 Ga0207677_10019662 Ga0207677_100196625 337
392 3300026089 Ga0207648_10042300 Ga0207648_100423003 337
393 3300028381 Ga0268264_10048107 Ga0268264_100481073 337
394 3300031665 Ga0316575_10004767 Ga0316575_100047673 337
395 3300031691 Ga0316579_10000505 Ga0316579_1000050511 337
396 3300031727 Ga0316576_10000646 Ga0316576_1000064615 337
397 3300031728 Ga0316578_10000138 Ga0316578_1000013814 337
398 3300031733 Ga0316577_10000619 Ga0316577_100006194 337
399 3300032137 Ga0316585_10001681 Ga0316585_100016814 337
400 3300032139 Ga0316580_10000109 Ga0316580_100001094 337
401 3300032168 Ga0316593_10000891 Ga0316593_100008914 337
402 3300033524 Ga0316592_1000598 Ga0316592_10005984 337
403 3300033528 Ga0316588_1000277 Ga0316588_10002775 337
404 3300033529 Ga0316587_1003084 Ga0316587_10030841 337
405 3300033541 Ga0316596_1000225 Ga0316596_10002254 337
406 3300035398 Ga0316574_0000468 Ga0316574_0000468_12546_13589 337
407 3300036647 Ga0316582_0000060 Ga0316582_0000060_23735_24778 337
408 3300036712 Ga0316584_0010119 Ga0316584_0010119_2744_3787 337
409 3300045976 Ga0466967_0191703 Ga0466967_0191703_241_1329 337
410 3300049573 Ga0501037_0013024 Ga0501037_0013024_2271_3359 337
411 3300049581 Ga0501047_0136512 Ga0501047_0136512_64_1152 337
412 3300049823 Ga0501044_0001456 Ga0501044_0001456_17670_18758 337
413 3300025910 Ga0207684_10082937 Ga0207684_100829372 338
414 3300031665 Ga0316575_10008074 Ga0316575_100080743 338
415 3300031691 Ga0316579_10088854 Ga0316579_100888542 338
416 3300031727 Ga0316576_10013873 Ga0316576_100138733 338
417 3300031727 Ga0316576_10025226 Ga0316576_100252262 338
418 3300031727 Ga0316576_10085253 Ga0316576_100852533 338
419 3300031727 Ga0316576_10196212 Ga0316576_101962122 338
420 3300031728 Ga0316578_10002792 Ga0316578_100027925 338
421 3300031728 Ga0316578_10034400 Ga0316578_100344002 338
422 3300031733 Ga0316577_10031429 Ga0316577_100314292 338
423 3300032168 Ga0316593_10001595 Ga0316593_100015953 338
424 3300032168 Ga0316593_10002911 Ga0316593_100029115 338
425 3300032168 Ga0316593_10015004 Ga0316593_100150042 338
426 3300032168 Ga0316593_10049495 Ga0316593_100494952 338
427 3300033524 Ga0316592_1001089 Ga0316592_10010895 338
428 3300033524 Ga0316592_1001125 Ga0316592_10011253 338
429 3300033524 Ga0316592_1006374 Ga0316592_10063742 338
430 3300033528 Ga0316588_1000863 Ga0316588_10008634 338
431 3300033528 Ga0316588_1007063 Ga0316588_10070633 338
432 3300033528 Ga0316588_1008669 Ga0316588_10086693 338
433 3300033528 Ga0316588_1011486 Ga0316588_10114862 338
434 3300033529 Ga0316587_1003987 Ga0316587_10039872 338
435 3300033541 Ga0316596_1000831 Ga0316596_10008315 338
436 3300033541 Ga0316596_1001071 Ga0316596_10010713 338
437 3300033541 Ga0316596_1004697 Ga0316596_10046972 338
438 3300033541 Ga0316596_1014144 Ga0316596_10141442 338
439 3300035398 Ga0316574_0030927 Ga0316574_0030927_909_1946 338
440 3300035398 Ga0316574_0031477 Ga0316574_0031477_1492_2535 338
441 3300036712 Ga0316584_0003005 Ga0316584_0003005_612_1649 338
442 3300036712 Ga0316584_0038308 Ga0316584_0038308_530_1579 338
443 3300036712 Ga0316584_0161767 Ga0316584_0161767_592_1629 338
444 3300039110 Ga0400487_14277 Ga0400487_14277_27411_28448 338
445 3300039110 Ga0400487_30204 Ga0400487_30204_51_1091 338
446 3300042876 Ga0451577_0001329 Ga0451577_0001329_13385_14428 338
447 3300042876 Ga0451577_0031390 Ga0451577_0031390_889_1932 338
448 3300042876 Ga0451577_0083955 Ga0451577_0083955_1514_2551 338
449 3300042876 Ga0451577_0328222 Ga0451577_0328222_43_1083 338
450 3300044712 Ga0453684_0000443 Ga0453684_0000443_45291_46334 338
451 3300044712 Ga0453684_0008845 Ga0453684_0008845_14004_15044 338
452 3300044712 Ga0453684_0051285 Ga0453684_0051285_212_1252 338
453 3300044712 Ga0453684_0221511 Ga0453684_0221511_229_1272 338
454 3300045051 Ga0451576_0001947 Ga0451576_0001947_16712_17749 338
455 3300049571 Ga0501034_0025878 Ga0501034_0025878_752_1819 338
456 3300005459 Ga0068867_100305274 Ga0068867_1003052741 339
457 3300048923 Ga0496120_0097456 Ga0496120_0097456_10_1050 339
458 3300048925 Ga0496122_0000143 Ga0496122_0000143_135999_137039 339
459 3300048928 Ga0496125_0044489 Ga0496125_0044489_1787_2827 339
460 3300048929 Ga0496126_0000211 Ga0496126_0000211_30970_32010 339
461 3300049580 Ga0501046_0238754 Ga0501046_0238754_121_1188 339
462 3300049587 Ga0501071_0015020 Ga0501071_0015020_893_1960 339
463 3300050509 nmdc:mga0qj67_122431_c1 nmdc:mga0qj67_122431_c1_1012_2085 339
464 3300005445 Ga0070708_100052716 Ga0070708_1000527162 340
465 3300005445 Ga0070708_100095262 Ga0070708_1000952622 340
466 3300005467 Ga0070706_100023926 Ga0070706_1000239263 340
467 3300005468 Ga0070707_100017858 Ga0070707_1000178582 340
468 3300005471 Ga0070698_100013553 Ga0070698_1000135531 340
469 3300007076 Ga0075435_100027225 Ga0075435_1000272254 340
470 3300009147 Ga0114129_10009389 Ga0114129_100093894 340
471 3300014326 Ga0157380_10041149 Ga0157380_100411493 340
472 3300025910 Ga0207684_10045746 Ga0207684_100457463 340
473 3300025922 Ga0207646_10052648 Ga0207646_100526482 340
474 3300025922 Ga0207646_10084605 Ga0207646_100846052 340
475 3300025926 Ga0207659_10090601 Ga0207659_100906012 340
476 3300037312 Ga0395899_0005070 Ga0395899_0005070_6280_7332 340
477 3300042461 Ga0439460_0009618 Ga0439460_0009618_1149_2192 340
478 3300006852 Ga0075433_10050783 Ga0075433_100507832 341
479 3300009147 Ga0114129_10121730 Ga0114129_101217303 341
480 3300048919 Ga0496116_0000473 Ga0496116_0000473_51640_52686 341
481 3300048919 Ga0496116_0011173 Ga0496116_0011173_3443_4489 341
482 3300048920 Ga0496117_0000161 Ga0496117_0000161_46948_47994 341
483 3300048922 Ga0496119_0000042 Ga0496119_0000042_68968_70014 341
484 3300048922 Ga0496119_0068224 Ga0496119_0068224_42_1088 341
485 3300048923 Ga0496120_0000083 Ga0496120_0000083_73037_74083 341
486 3300048923 Ga0496120_0002667 Ga0496120_0002667_2213_3259 341
487 3300048925 Ga0496122_0031007 Ga0496122_0031007_2199_3245 341
488 3300048926 Ga0496123_0001574 Ga0496123_0001574_10230_11276 341
489 3300048927 Ga0496124_0034437 Ga0496124_0034437_3174_4220 341
490 3300048928 Ga0496125_0000010 Ga0496125_0000010_552565_553611 341
491 3300048929 Ga0496126_0000461 Ga0496126_0000461_40344_41390 341
492 3300048929 Ga0496126_0077610 Ga0496126_0077610_1829_2875 341
493 3300048929 Ga0496126_0103372 Ga0496126_0103372_1374_2420 341
494 3300048929 Ga0496126_0194040 Ga0496126_0194040_42_1088 341
495 3300050507 nmdc:mga05p37_99915_c1 nmdc:mga05p37_99915_c1_1115_2164 341
496 3300050512 nmdc:mga0n895_53041_c1 nmdc:mga0n895_53041_c1_1156_2205 341
497 3300050515 nmdc:mga0a205_34810_c1 nmdc:mga0a205_34810_c1_3740_4789 341
498 3300006237 Ga0097621_100013066 Ga0097621_1000130666 342
499 3300006358 Ga0068871_100108356 Ga0068871_1001083563 342
500 3300025905 Ga0207685_10002870 Ga0207685_100028703 342
501 3300025934 Ga0207686_10130428 Ga0207686_101304282 342
502 3300038443 Ga0395901_0303232 Ga0395901_0303232_159_1187 342
503 3300005458 Ga0070681_10025507 Ga0070681_100255073 343
504 3300005530 Ga0070679_100035527 Ga0070679_1000355272 343
505 3300009093 Ga0105240_10286117 Ga0105240_102861171 345
506 3300049580 Ga0501046_0000037 Ga0501046_0000037_7842_8930 345
507 3300060353 Ga0501082_0039733 Ga0501082_0039733_33_1127 345
508 3300009177 Ga0105248_10284402 Ga0105248_102844022 346
509 3300029957 Ga0265324_10001058 Ga0265324_1000105817 346
510 3300031240 Ga0265320_10003799 Ga0265320_100037995 346
511 3300031241 Ga0265325_10104286 Ga0265325_101042862 346
512 3300031250 Ga0265331_10000019 Ga0265331_1000001965 346
513 3300031251 Ga0265327_10000420 Ga0265327_1000042092 346
514 3300031595 Ga0265313_10001693 Ga0265313_100016934 346
515 3300031595 Ga0265313_10005305 Ga0265313_100053056 346
516 3300031711 Ga0265314_10002372 Ga0265314_100023726 346
517 3300044712 Ga0453684_0000006 Ga0453684_0000006_299822_300862 346
518 3300044712 Ga0453684_0000031 Ga0453684_0000031_101045_102085 346
519 3300044712 Ga0453684_0047639 Ga0453684_0047639_973_2013 346
520 3300045051 Ga0451576_0000444 Ga0451576_0000444_14584_15624 346
521 3300045051 Ga0451576_0052813 Ga0451576_0052813_2952_3992 346
522 3300005336 Ga0070680_100043532 Ga0070680_1000435322 347
523 3300005434 Ga0070709_10057517 Ga0070709_100575172 347
524 3300006163 Ga0070715_10056253 Ga0070715_100562532 347
525 3300009093 Ga0105240_10001828 Ga0105240_100018284 347
526 3300009093 Ga0105240_10002450 Ga0105240_100024503 347
527 3300021388 Ga0213875_10000007 Ga0213875_10000007223 347
528 3300025905 Ga0207685_10028005 Ga0207685_100280052 347
529 3300025913 Ga0207695_10001011 Ga0207695_1000101139 347
530 3300025913 Ga0207695_10006315 Ga0207695_1000631515 347
531 3300037853 Ga0436364_1071411 Ga0436364_1071411_9953_11011 347
532 3300039437 Ga0436365_1560237 Ga0436365_1560237_118_1176 347
533 3300048923 Ga0496120_0002573 Ga0496120_0002573_1336_2400 347
534 3300005353 Ga0070669_100083407 Ga0070669_1000834071 348
535 3300005356 Ga0070674_100011652 Ga0070674_1000116524 348
536 3300005718 Ga0068866_10143341 Ga0068866_101433411 348
537 3300005844 Ga0068862_100003559 Ga0068862_1000035595 348
538 3300014326 Ga0157380_10010219 Ga0157380_100102193 348
539 3300025923 Ga0207681_10025476 Ga0207681_100254764 348
540 3300025937 Ga0207669_10006835 Ga0207669_100068354 348
541 3300025938 Ga0207704_10068995 Ga0207704_100689953 348
542 3300026118 Ga0207675_100038552 Ga0207675_1000385523 348
543 3300028380 Ga0268265_10005666 Ga0268265_100056667 348
544 3300032168 Ga0316593_10002718 Ga0316593_100027182 348
545 3300049575 Ga0501039_0245589 Ga0501039_0245589_19_1155 348
546 iso_pu_bacteria 2524023250 2524613334 348
547 3300005548 Ga0070665_100005701 Ga0070665_1000057014 349
548 3300025924 Ga0207694_10001089 Ga0207694_1000108926 349
549 3300028379 Ga0268266_10002480 Ga0268266_1000248013 349
550 3300031250 Ga0265331_10030086 Ga0265331_100300862 349
551 3300031595 Ga0265313_10003004 Ga0265313_100030049 349
552 3300048913 Ga0496110_0001960 Ga0496110_0001960_11741_12817 349
553 3300049823 Ga0501044_0247975 Ga0501044_0247975_418_1467 349
554 3300053091 Ga0500647_0032015 Ga0500647_0032015_491_1540 349
555 3300053108 Ga0500562_000318 Ga0500562_000318_3721_4773 349
556 3300005458 Ga0070681_10121591 Ga0070681_101215913 350
557 3300005549 Ga0070704_100084877 Ga0070704_1000848772 350
558 3300005578 Ga0068854_100309491 Ga0068854_1003094911 350
559 3300009093 Ga0105240_10372065 Ga0105240_103720651 350
560 3300009551 Ga0105238_10000280 Ga0105238_1000028053 350
561 3300025912 Ga0207707_10228133 Ga0207707_102281331 350
562 3300026078 Ga0207702_10107075 Ga0207702_101070752 350
563 3300032005 Ga0307411_10205028 Ga0307411_102050281 350
564 3300036459 Ga0372808_005429 Ga0372808_005429_282_1334 350
565 3300036534 Ga0310109_005480 Ga0310109_005480_178_1230 350
566 3300036535 Ga0310110_006088 Ga0310110_006088_399_1451 350
567 3300037312 Ga0395899_0137742 Ga0395899_0137742_518_1570 350
568 3300039438 Ga0436360_0074223 Ga0436360_0074223_189_1241 350
569 3300044712 Ga0453684_0004682 Ga0453684_0004682_13089_14141 350
570 3300049583 Ga0501067_0121998 Ga0501067_0121998_65_1117 350
571 3300049586 Ga0501070_0033085 Ga0501070_0033085_137_1189 350
572 3300053119 Ga0500595_003547 Ga0500595_003547_6186_7238 350
573 3300032168 Ga0316593_10014224 Ga0316593_100142241 353
574 3300044712 Ga0453684_0000040 Ga0453684_0000040_213465_214571 355
575 3300048925 Ga0496122_0000012 Ga0496122_0000012_170062_171153 356
576 3300048926 Ga0496123_0004362 Ga0496123_0004362_13111_14202 356
577 3300048929 Ga0496126_0000008 Ga0496126_0000008_170057_171148 356
578 3300049571 Ga0501034_0123689 Ga0501034_0123689_249_1343 359
579 3300013296 Ga0157374_10417890 Ga0157374_104178901 371
580 3300049571 Ga0501034_0020427 Ga0501034_0020427_2736_4040 373
581 3300023556 Ga0247519_103124 Ga0247519_1031241 395
582 3300023557 Ga0247521_102742 Ga0247521_1027421 395
583 3300023558 Ga0247526_102872 Ga0247526_1028721 395
584 3300023559 Ga0247529_102722 Ga0247529_1027221 395
585 3300023560 Ga0247514_104156 Ga0247514_1041562 395
586 3300023561 Ga0247518_104073 Ga0247518_1040732 395
587 3300023562 Ga0247516_103221 Ga0247516_1032211 395
588 3300023563 Ga0247530_102387 Ga0247530_1023871 395
589 3300023564 Ga0247515_103435 Ga0247515_1034351 395
590 3300023666 Ga0247531_102643 Ga0247531_1026431 395
591 3300023668 Ga0247525_102936 Ga0247525_1029361 395
592 3300023680 Ga0247528_101855 Ga0247528_1018551 395
593 3300023682 Ga0247513_102936 Ga0247513_1029361 395
594 3300023684 Ga0247523_103185 Ga0247523_1031851 395
595 3300023686 Ga0247520_102551 Ga0247520_1025512 395
596 3300023688 Ga0247522_103035 Ga0247522_1030351 395
597 3300023689 Ga0247517_102647 Ga0247517_1026472 395
598 3300023690 Ga0247512_103865 Ga0247512_1038651 395
599 3300029282 Ga0311003_166887 Ga0311003_1668871 395
600 3300031591 Ga0310116_103478 Ga0310116_1034781 395
601 3300031592 Ga0310117_103307 Ga0310117_1033071 395
602 3300031614 Ga0310103_105569 Ga0310103_1055691 395
603 3300031615 Ga0310107_104984 Ga0310107_1049842 395
604 3300031633 Ga0310108_103350 Ga0310108_1033502 395
605 3300031635 Ga0310115_104372 Ga0310115_1043722 395
606 3300031636 Ga0310113_103395 Ga0310113_1033952 395
607 3300031666 Ga0310105_103633 Ga0310105_1036331 395
608 3300031667 Ga0310111_104370 Ga0310111_1043701 395
609 3300031678 Ga0310114_103105 Ga0310114_1031051 395
610 3300031686 Ga0310119_104453 Ga0310119_1044531 395
611 3300031690 Ga0310101_104287 Ga0310101_1042871 395
612 3300031810 Ga0316044_103932 Ga0316044_1039321 395
613 3300031815 Ga0316045_107597 Ga0316045_1075971 395
614 3300031816 Ga0316042_105845 Ga0316042_1058451 395
615 3300031828 Ga0316043_105265 Ga0316043_1052651 395
616 3300041464 Ga0451808_23863 Ga0451808_23863_21_1268 395
617 3300059643 Ga0587072_006742 Ga0587072_006742_332_1579 396
618 3300060344 Ga0587071_007502 Ga0587071_007502_314_1561 396
619 3300003479 Ga0006556J51387_1011473 Ga0006556J51387_10114731 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

220

384

1

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

75

212

0.98

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

229

387

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9926 57 401
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9897 57 401
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9854 54 401
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9826 54 401
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9657 59 395
ID Description Score Start End Superfamily
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9992 59 202 3.40.50.720
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.999 203 369 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9931 203 369 3.30.360.10
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9923 59 202 3.40.50.720
2cvoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9917 57 202 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2P2MPN0-F1-model_v4 Uncharacterized protein MANES_15G144000 1.001 258 401
AF-A0A484LE06-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 1.001 298 401
AF-R7UBN4-F1-model_v4 Uncharacterized protein 0.9995 286 401
AF-A0A699IMB6-F1-model_v4 Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic 0.9987 252 401
AF-A0A2R6R1R0-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9973 209 401

Feature Viewer

pLDDT pTM Quality
87.16 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map