F469747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 618 | 303 | 615 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100199410|Ga0307416_1001994102 |
| Length | 352 |
| Sequence | MSGEFRYAAGTARADRGFRAASAVRRQRLFHTTHPFELRAPVADVLRGELRRDEPMSRHVSWRAGGSVDRAYWPADLADLQAFLRTLAAGEPVYFVGLGSNLLVRDAGLRGTVVFTHWALRNLSLVRSDGSEGLVSADVGVASPKVARFAALHDLGGAEFLAGIPGTIGGALAMNAGCYGGETWNVVREVTTIDRRGHLRCRTLADYHIAYRTVLLRTGHSGAALRSSTDFDEWFVSALLAFPRGEGAQARQKIRELLAKRIASQPLGEPNAGSVFRNPTGAYAARLIEDCGLKGRAIGGALISPKHANFIVNTGTATAADIEGLIELAQTAVRHKFGVDLEREVRIIGEPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 3 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 4 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 167 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 181 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 182 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 183 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 197 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 198 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 199 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 200 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 201 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 202 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 203 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 204 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 205 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 206 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 207 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 208 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 209 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 210 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 211 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 212 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 213 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 214 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 294 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.32 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.56 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 91.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055528_1012294 | 3300003790 | Bacteria | 3333 |
| 2 | Ga0070658_10035065 | 3300005327 | Bacteria | 4039 |
| 3 | Ga0070658_10102091 | 3300005327 | Bacteria | 2371 |
| 4 | Ga0070683_100012665 | 3300005329 | Bacteria | 7334 |
| 5 | Ga0070690_100000076 | 3300005330 | Bacteria | 48076 |
| 6 | Ga0070690_100025287 | 3300005330 | Bacteria | 3656 |
| 7 | Ga0070690_100115885 | 3300005330 | Bacteria | 1793 |
| 8 | Ga0070670_100027026 | 3300005331 | Bacteria | 4936 |
| 9 | Ga0070670_100062463 | 3300005331 | Bacteria | 3198 |
| 10 | Ga0070670_100068420 | 3300005331 | Bacteria | 3048 |
| 11 | Ga0070670_100149502 | 3300005331 | Bacteria | 2021 |
| 12 | Ga0068869_100001183 | 3300005334 | Bacteria | 15316 |
| 13 | Ga0070680_100215823 | 3300005336 | Bacteria | 1619 |
| 14 | Ga0070682_100099701 | 3300005337 | Bacteria | 1916 |
| 15 | Ga0070682_100101595 | 3300005337 | Bacteria | 1899 |
| 16 | Ga0068868_100020949 | 3300005338 | Bacteria | 4921 |
| 17 | Ga0070689_100057420 | 3300005340 | Bacteria | 3021 |
| 18 | Ga0070691_10009987 | 3300005341 | Bacteria | 4325 |
| 19 | Ga0070692_10009953 | 3300005345 | Bacteria | 4308 |
| 20 | Ga0070692_10040114 | 3300005345 | Bacteria | 2393 |
| 21 | Ga0070692_10048341 | 3300005345 | Bacteria | 2204 |
| 22 | Ga0070668_100021585 | 3300005347 | Bacteria | 4865 |
| 23 | Ga0070669_100474669 | 3300005353 | Bacteria | 1034 |
| 24 | Ga0070675_100008831 | 3300005354 | Bacteria | 7831 |
| 25 | Ga0070675_100032974 | 3300005354 | Bacteria | 4195 |
| 26 | Ga0070675_100043292 | 3300005354 | Bacteria | 3679 |
| 27 | Ga0070675_100121825 | 3300005354 | Bacteria | 2216 |
| 28 | Ga0070671_100014257 | 3300005355 | Bacteria | 6418 |
| 29 | Ga0070674_100033003 | 3300005356 | Bacteria | 3442 |
| 30 | Ga0070674_100068374 | 3300005356 | Bacteria | 2502 |
| 31 | Ga0070673_100023681 | 3300005364 | Bacteria | 4490 |
| 32 | Ga0070673_100024005 | 3300005364 | Bacteria | 4463 |
| 33 | Ga0070673_100238362 | 3300005364 | Bacteria | 1580 |
| 34 | Ga0070673_100429253 | 3300005364 | Bacteria | 1186 |
| 35 | Ga0070688_100032478 | 3300005365 | Bacteria | 3147 |
| 36 | Ga0070688_100133370 | 3300005365 | Bacteria | 1679 |
| 37 | Ga0070667_100119626 | 3300005367 | Bacteria | 2290 |
| 38 | Ga0070667_100122397 | 3300005367 | Bacteria | 2264 |
| 39 | Ga0070710_10202560 | 3300005437 | Bacteria | 1254 |
| 40 | Ga0070705_100017235 | 3300005440 | Bacteria | 3767 |
| 41 | Ga0070705_100075661 | 3300005440 | Bacteria | 2050 |
| 42 | Ga0070700_100000705 | 3300005441 | Bacteria | 16467 |
| 43 | Ga0070700_100002345 | 3300005441 | Bacteria | 9640 |
| 44 | Ga0070700_100045966 | 3300005441 | Bacteria | 2695 |
| 45 | Ga0070700_100083418 | 3300005441 | Bacteria | 2069 |
| 46 | Ga0070694_100139802 | 3300005444 | Bacteria | 1757 |
| 47 | Ga0070708_100063688 | 3300005445 | Bacteria | 3301 |
| 48 | Ga0070678_100018527 | 3300005456 | Bacteria | 4514 |
| 49 | Ga0070678_100193976 | 3300005456 | Bacteria | 1672 |
| 50 | Ga0070681_10015927 | 3300005458 | Bacteria | 7497 |
| 51 | Ga0068867_100001930 | 3300005459 | Bacteria | 14446 |
| 52 | Ga0068867_100394950 | 3300005459 | Bacteria | 1165 |
| 53 | Ga0070685_10140292 | 3300005466 | Bacteria | 1521 |
| 54 | Ga0070706_100030901 | 3300005467 | Bacteria | 4937 |
| 55 | Ga0070706_100045752 | 3300005467 | Bacteria | 4041 |
| 56 | Ga0070707_100044998 | 3300005468 | Bacteria | 4225 |
| 57 | Ga0070707_100271266 | 3300005468 | Bacteria | 1649 |
| 58 | Ga0070679_100101483 | 3300005530 | Bacteria | 2864 |
| 59 | Ga0070684_100118465 | 3300005535 | Bacteria | 2380 |
| 60 | Ga0070697_100070303 | 3300005536 | Bacteria | 2869 |
| 61 | Ga0070672_100019521 | 3300005543 | Bacteria | 4921 |
| 62 | Ga0070672_100048035 | 3300005543 | Bacteria | 3314 |
| 63 | Ga0070672_100311018 | 3300005543 | Bacteria | 1337 |
| 64 | Ga0070686_100000265 | 3300005544 | Bacteria | 35750 |
| 65 | Ga0070686_100130774 | 3300005544 | Bacteria | 1735 |
| 66 | Ga0070695_100073553 | 3300005545 | Bacteria | 2244 |
| 67 | Ga0070695_100102368 | 3300005545 | Bacteria | 1931 |
| 68 | Ga0070696_100003280 | 3300005546 | Bacteria | 10798 |
| 69 | Ga0070696_100118951 | 3300005546 | Bacteria | 1910 |
| 70 | Ga0070696_100131444 | 3300005546 | Bacteria | 1821 |
| 71 | Ga0070693_100002947 | 3300005547 | Bacteria | 7870 |
| 72 | Ga0070693_100139513 | 3300005547 | Bacteria | 1524 |
| 73 | Ga0070665_100431051 | 3300005548 | Bacteria | 1327 |
| 74 | Ga0070704_100033256 | 3300005549 | Bacteria | 3484 |
| 75 | Ga0070704_100077445 | 3300005549 | Bacteria | 2436 |
| 76 | Ga0070704_100094529 | 3300005549 | Bacteria | 2236 |
| 77 | Ga0068855_100178181 | 3300005563 | Bacteria | 2404 |
| 78 | Ga0070664_100013378 | 3300005564 | Bacteria | 6684 |
| 79 | Ga0070664_100557376 | 3300005564 | Bacteria | 1060 |
| 80 | Ga0068857_100021288 | 3300005577 | Bacteria | 5708 |
| 81 | Ga0068857_100310186 | 3300005577 | Bacteria | 1455 |
| 82 | Ga0068854_100011816 | 3300005578 | Bacteria | 5701 |
| 83 | Ga0068856_100031048 | 3300005614 | Bacteria | 5226 |
| 84 | Ga0068856_100111428 | 3300005614 | Bacteria | 2734 |
| 85 | Ga0068856_100435235 | 3300005614 | Bacteria | 1332 |
| 86 | Ga0068856_100603926 | 3300005614 | Unclassified | 1118 |
| 87 | Ga0070702_100000223 | 3300005615 | Bacteria | 19138 |
| 88 | Ga0070702_100019642 | 3300005615 | Bacteria | 3529 |
| 89 | Ga0070702_100223467 | 3300005615 | Bacteria | 1261 |
| 90 | Ga0068852_100028714 | 3300005616 | Bacteria | 4558 |
| 91 | Ga0068859_100262650 | 3300005617 | Bacteria | 1818 |
| 92 | Ga0068864_100103489 | 3300005618 | Bacteria | 2528 |
| 93 | Ga0068864_100117562 | 3300005618 | Bacteria | 2373 |
| 94 | Ga0068866_10004753 | 3300005718 | Bacteria | 5572 |
| 95 | Ga0068866_10077607 | 3300005718 | Bacteria | 1774 |
| 96 | Ga0068861_100008407 | 3300005719 | Bacteria | 7106 |
| 97 | Ga0068861_100041588 | 3300005719 | Bacteria | 3443 |
| 98 | Ga0068870_10001641 | 3300005840 | Bacteria | 9131 |
| 99 | Ga0068870_10089532 | 3300005840 | Bacteria | 1718 |
| 100 | Ga0068863_100149228 | 3300005841 | Bacteria | 2237 |
| 101 | Ga0068858_100011872 | 3300005842 | Bacteria | 8210 |
| 102 | Ga0068858_100103666 | 3300005842 | Bacteria | 2654 |
| 103 | Ga0068860_100004675 | 3300005843 | Bacteria | 13979 |
| 104 | Ga0068860_100256154 | 3300005843 | Bacteria | 1705 |
| 105 | Ga0068862_100021899 | 3300005844 | Bacteria | 5344 |
| 106 | Ga0068862_100033885 | 3300005844 | Bacteria | 4320 |
| 107 | Ga0075365_10018477 | 3300006038 | Bacteria | 4288 |
| 108 | Ga0075364_10001278 | 3300006051 | Bacteria | 13546 |
| 109 | Ga0075366_10018719 | 3300006195 | Bacteria | 4000 |
| 110 | Ga0075366_10064545 | 3300006195 | Bacteria | 2177 |
| 111 | Ga0097621_100010998 | 3300006237 | Bacteria | 6648 |
| 112 | Ga0097621_100028581 | 3300006237 | Bacteria | 4395 |
| 113 | Ga0068871_100021904 | 3300006358 | Bacteria | 4921 |
| 114 | Ga0075428_100002171 | 3300006844 | Bacteria | 21224 |
| 115 | Ga0075428_100025570 | 3300006844 | Bacteria | 6536 |
| 116 | Ga0075428_100167105 | 3300006844 | Bacteria | 2386 |
| 117 | Ga0075428_100671135 | 3300006844 | Bacteria | 1105 |
| 118 | Ga0075430_100003777 | 3300006846 | Bacteria | 12727 |
| 119 | Ga0075430_100005026 | 3300006846 | Bacteria | 11132 |
| 120 | Ga0075430_100040114 | 3300006846 | Bacteria | 3963 |
| 121 | Ga0075430_100438995 | 3300006846 | Bacteria | 1077 |
| 122 | Ga0075431_100035341 | 3300006847 | Bacteria | 5144 |
| 123 | Ga0075431_100087601 | 3300006847 | Bacteria | 3213 |
| 124 | Ga0075431_100137356 | 3300006847 | Bacteria | 2521 |
| 125 | Ga0075433_10004587 | 3300006852 | Bacteria | 10778 |
| 126 | Ga0075433_10019169 | 3300006852 | Bacteria | 5694 |
| 127 | Ga0075434_100003639 | 3300006871 | Bacteria | 13765 |
| 128 | Ga0075434_100004275 | 3300006871 | Bacteria | 12815 |
| 129 | Ga0075429_100001915 | 3300006880 | Bacteria | 17264 |
| 130 | Ga0068865_100008518 | 3300006881 | Bacteria | 6340 |
| 131 | Ga0075436_100012672 | 3300006914 | Bacteria | 5778 |
| 132 | Ga0097620_100262646 | 3300006931 | Bacteria | 1818 |
| 133 | Ga0075435_100001061 | 3300007076 | Bacteria | 17462 |
| 134 | Ga0075435_100004540 | 3300007076 | Bacteria | 9543 |
| 135 | Ga0075435_100133649 | 3300007076 | Bacteria | 2077 |
| 136 | Ga0105240_10006007 | 3300009093 | Bacteria | 17950 |
| 137 | Ga0105240_10081963 | 3300009093 | Bacteria | 3963 |
| 138 | Ga0111539_10000086 | 3300009094 | Bacteria | 95435 |
| 139 | Ga0111539_10013931 | 3300009094 | Bacteria | 10052 |
| 140 | Ga0111539_10018745 | 3300009094 | Bacteria | 8566 |
| 141 | Ga0111539_10160775 | 3300009094 | Bacteria | 2627 |
| 142 | Ga0105245_10259015 | 3300009098 | Bacteria | 1692 |
| 143 | Ga0114129_10023925 | 3300009147 | Bacteria | 8656 |
| 144 | Ga0114129_10101196 | 3300009147 | Bacteria | 3987 |
| 145 | Ga0105243_10001212 | 3300009148 | Bacteria | 23228 |
| 146 | Ga0105243_10001642 | 3300009148 | Bacteria | 19442 |
| 147 | Ga0105243_10066704 | 3300009148 | Bacteria | 2895 |
| 148 | Ga0105241_10028848 | 3300009174 | Bacteria | 4135 |
| 149 | Ga0105242_10012243 | 3300009176 | Bacteria | 6602 |
| 150 | Ga0105242_10049194 | 3300009176 | Bacteria | 3430 |
| 151 | Ga0105248_10000708 | 3300009177 | Bacteria | 37708 |
| 152 | Ga0105248_10154918 | 3300009177 | Bacteria | 2586 |
| 153 | Ga0105248_10183810 | 3300009177 | Bacteria | 2356 |
| 154 | Ga0105248_10231822 | 3300009177 | Bacteria | 2079 |
| 155 | Ga0105237_10182942 | 3300009545 | Bacteria | 2096 |
| 156 | Ga0105238_10387186 | 3300009551 | Bacteria | 1390 |
| 157 | Ga0105249_10009025 | 3300009553 | Bacteria | 8714 |
| 158 | Ga0105239_10041689 | 3300010375 | Bacteria | 5030 |
| 159 | Ga0105239_10185672 | 3300010375 | Bacteria | 2327 |
| 160 | Ga0157373_10355026 | 3300013100 | Bacteria | 1046 |
| 161 | Ga0157370_10031088 | 3300013104 | Bacteria | 5226 |
| 162 | Ga0157374_10066870 | 3300013296 | Bacteria | 3378 |
| 163 | Ga0157378_10003052 | 3300013297 | Bacteria | 14881 |
| 164 | Ga0157378_10017616 | 3300013297 | Bacteria | 6271 |
| 165 | Ga0157378_10098287 | 3300013297 | Bacteria | 2669 |
| 166 | Ga0157378_10464226 | 3300013297 | Bacteria | 1259 |
| 167 | Ga0163162_10102026 | 3300013306 | Bacteria | 2962 |
| 168 | Ga0157375_10120164 | 3300013308 | Bacteria | 2736 |
| 169 | Ga0157375_10164114 | 3300013308 | Bacteria | 2365 |
| 170 | Ga0157375_10374040 | 3300013308 | Bacteria | 1591 |
| 171 | Ga0157380_10000239 | 3300014326 | Bacteria | 33002 |
| 172 | Ga0157380_10002571 | 3300014326 | Bacteria | 12263 |
| 173 | Ga0157380_10023775 | 3300014326 | Bacteria | 4627 |
| 174 | Ga0157380_10091646 | 3300014326 | Bacteria | 2509 |
| 175 | Ga0157377_10019158 | 3300014745 | Bacteria | 3573 |
| 176 | Ga0157377_10113491 | 3300014745 | Bacteria | 1632 |
| 177 | Ga0157379_10009289 | 3300014968 | Bacteria | 8562 |
| 178 | Ga0157379_10228899 | 3300014968 | Bacteria | 1685 |
| 179 | Ga0157376_10017293 | 3300014969 | Bacteria | 5494 |
| 180 | Ga0157376_10278826 | 3300014969 | Bacteria | 1573 |
| 181 | Ga0209565_1000118 | 3300025263 | Bacteria | 113196 |
| 182 | Ga0209673_1005966 | 3300025273 | Bacteria | 5997 |
| 183 | Ga0209675_1011319 | 3300025291 | Bacteria | 2967 |
| 184 | Ga0209564_1028479 | 3300025295 | Bacteria | 1785 |
| 185 | Ga0209758_1003035 | 3300025297 | Bacteria | 15994 |
| 186 | Ga0209256_1004006 | 3300025299 | Bacteria | 9641 |
| 187 | Ga0207682_10001431 | 3300025893 | Bacteria | 11015 |
| 188 | Ga0207692_10161134 | 3300025898 | Bacteria | 1293 |
| 189 | Ga0207642_10001872 | 3300025899 | Bacteria | 6486 |
| 190 | Ga0207642_10015483 | 3300025899 | Bacteria | 2843 |
| 191 | Ga0207642_10154562 | 3300025899 | Bacteria | 1225 |
| 192 | Ga0207688_10172229 | 3300025901 | Bacteria | 1287 |
| 193 | Ga0207645_10013350 | 3300025907 | Bacteria | 5538 |
| 194 | Ga0207645_10038280 | 3300025907 | Bacteria | 3076 |
| 195 | Ga0207645_10131657 | 3300025907 | Unclassified | 1628 |
| 196 | Ga0207643_10005300 | 3300025908 | Bacteria | 6901 |
| 197 | Ga0207643_10009949 | 3300025908 | Bacteria | 5110 |
| 198 | Ga0207643_10063874 | 3300025908 | Bacteria | 2106 |
| 199 | Ga0207695_10043211 | 3300025913 | Bacteria | 4804 |
| 200 | Ga0207671_10037932 | 3300025914 | Bacteria | 3572 |
| 201 | Ga0207660_10014287 | 3300025917 | Bacteria | 5218 |
| 202 | Ga0207660_10189609 | 3300025917 | Bacteria | 1600 |
| 203 | Ga0207662_10020600 | 3300025918 | Bacteria | 3763 |
| 204 | Ga0207649_10296882 | 3300025920 | Unclassified | 1180 |
| 205 | Ga0207652_10145235 | 3300025921 | Bacteria | 2123 |
| 206 | Ga0207646_10085831 | 3300025922 | Bacteria | 2815 |
| 207 | Ga0207646_10217100 | 3300025922 | Bacteria | 1728 |
| 208 | Ga0207681_10114150 | 3300025923 | Bacteria | 1970 |
| 209 | Ga0207650_10028033 | 3300025925 | Bacteria | 4035 |
| 210 | Ga0207650_10043232 | 3300025925 | Bacteria | 3306 |
| 211 | Ga0207659_10005742 | 3300025926 | Bacteria | 7557 |
| 212 | Ga0207659_10014558 | 3300025926 | Bacteria | 5078 |
| 213 | Ga0207659_10022463 | 3300025926 | Bacteria | 4200 |
| 214 | Ga0207659_10254611 | 3300025926 | Bacteria | 1426 |
| 215 | Ga0207687_10003109 | 3300025927 | Bacteria | 11254 |
| 216 | Ga0207644_10015784 | 3300025931 | Bacteria | 5077 |
| 217 | Ga0207706_10005160 | 3300025933 | Bacteria | 12189 |
| 218 | Ga0207686_10000084 | 3300025934 | Bacteria | 79402 |
| 219 | Ga0207709_10000907 | 3300025935 | Bacteria | 22294 |
| 220 | Ga0207709_10037283 | 3300025935 | Bacteria | 2888 |
| 221 | Ga0207709_10049069 | 3300025935 | Bacteria | 2575 |
| 222 | Ga0207670_10045451 | 3300025936 | Bacteria | 2911 |
| 223 | Ga0207670_10117165 | 3300025936 | Bacteria | 1930 |
| 224 | Ga0207669_10003396 | 3300025937 | Bacteria | 6885 |
| 225 | Ga0207669_10062580 | 3300025937 | Bacteria | 2293 |
| 226 | Ga0207669_10257834 | 3300025937 | Bacteria | 1302 |
| 227 | Ga0207669_10498724 | 3300025937 | Bacteria | 974 |
| 228 | Ga0207704_10002137 | 3300025938 | Bacteria | 8864 |
| 229 | Ga0207704_10003021 | 3300025938 | Bacteria | 7608 |
| 230 | Ga0207665_10038437 | 3300025939 | Bacteria | 3187 |
| 231 | Ga0207691_10004579 | 3300025940 | Bacteria | 13389 |
| 232 | Ga0207691_10075807 | 3300025940 | Bacteria | 3032 |
| 233 | Ga0207711_10000275 | 3300025941 | Bacteria | 55533 |
| 234 | Ga0207711_10195609 | 3300025941 | Bacteria | 1844 |
| 235 | Ga0207689_10000775 | 3300025942 | Bacteria | 30666 |
| 236 | Ga0207689_10003287 | 3300025942 | Bacteria | 14814 |
| 237 | Ga0207679_10173521 | 3300025945 | Bacteria | 1777 |
| 238 | Ga0207679_10450745 | 3300025945 | Bacteria | 1141 |
| 239 | Ga0207667_10294144 | 3300025949 | Bacteria | 1659 |
| 240 | Ga0207651_10015342 | 3300025960 | Bacteria | 4450 |
| 241 | Ga0207651_10165121 | 3300025960 | Bacteria | 1740 |
| 242 | Ga0207712_10020708 | 3300025961 | Bacteria | 4310 |
| 243 | Ga0207668_10011273 | 3300025972 | Bacteria | 5426 |
| 244 | Ga0207658_10294528 | 3300025986 | Bacteria | 1396 |
| 245 | Ga0207677_10027935 | 3300026023 | Bacteria | 3562 |
| 246 | Ga0207677_10285085 | 3300026023 | Bacteria | 1357 |
| 247 | Ga0207703_10135966 | 3300026035 | Bacteria | 2128 |
| 248 | Ga0207703_10316807 | 3300026035 | Bacteria | 1427 |
| 249 | Ga0207708_10000049 | 3300026075 | Bacteria | 114743 |
| 250 | Ga0207708_10007913 | 3300026075 | Bacteria | 7880 |
| 251 | Ga0207708_10027893 | 3300026075 | Bacteria | 4275 |
| 252 | Ga0207702_10038243 | 3300026078 | Bacteria | 4019 |
| 253 | Ga0207641_10079123 | 3300026088 | Bacteria | 2849 |
| 254 | Ga0207641_10114174 | 3300026088 | Bacteria | 2399 |
| 255 | Ga0207641_10119036 | 3300026088 | Bacteria | 2353 |
| 256 | Ga0207641_10146334 | 3300026088 | Bacteria | 2137 |
| 257 | Ga0207648_10000161 | 3300026089 | Bacteria | 69095 |
| 258 | Ga0207648_10000685 | 3300026089 | Bacteria | 37956 |
| 259 | Ga0207648_10080379 | 3300026089 | Bacteria | 2844 |
| 260 | Ga0207676_10029498 | 3300026095 | Bacteria | 4109 |
| 261 | Ga0207676_10072396 | 3300026095 | Bacteria | 2770 |
| 262 | Ga0207676_10154865 | 3300026095 | Bacteria | 1978 |
| 263 | Ga0207674_10063890 | 3300026116 | Bacteria | 3714 |
| 264 | Ga0207674_10120210 | 3300026116 | Bacteria | 2595 |
| 265 | Ga0207675_100000176 | 3300026118 | Bacteria | 57464 |
| 266 | Ga0207675_100001627 | 3300026118 | Bacteria | 22493 |
| 267 | Ga0207675_100060162 | 3300026118 | Bacteria | 3546 |
| 268 | Ga0207675_100089106 | 3300026118 | Bacteria | 2899 |
| 269 | Ga0207683_10021380 | 3300026121 | Bacteria | 5539 |
| 270 | Ga0207683_10067076 | 3300026121 | Bacteria | 3165 |
| 271 | Ga0209969_1001703 | 3300027360 | Bacteria | 3033 |
| 272 | Ga0209967_1013482 | 3300027364 | Bacteria | 1160 |
| 273 | Ga0209995_1006296 | 3300027471 | Bacteria | 1907 |
| 274 | Ga0209983_1007102 | 3300027665 | Bacteria | 2299 |
| 275 | Ga0209974_10000936 | 3300027876 | Bacteria | 10190 |
| 276 | Ga0207428_10002137 | 3300027907 | Bacteria | 19863 |
| 277 | Ga0207428_10023773 | 3300027907 | Bacteria | 5148 |
| 278 | Ga0207428_10028032 | 3300027907 | Bacteria | 4682 |
| 279 | Ga0207428_10078762 | 3300027907 | Bacteria | 2578 |
| 280 | Ga0207428_10118734 | 3300027907 | Bacteria | 2029 |
| 281 | Ga0268265_10019951 | 3300028380 | Bacteria | 4669 |
| 282 | Ga0268264_10103536 | 3300028381 | Bacteria | 2479 |
| 283 | Ga0268264_10132489 | 3300028381 | Bacteria | 2212 |
| 284 | Ga0265318_10012165 | 3300028577 | Unclassified | 3672 |
| 285 | Ga0307515_10030334 | 3300028794 | Bacteria | 9086 |
| 286 | Ga0307515_10144953 | 3300028794 | Bacteria | 2522 |
| 287 | Ga0265338_10008351 | 3300028800 | Bacteria | 12591 |
| 288 | Ga0265332_10001273 | 3300031238 | Bacteria | 14416 |
| 289 | Ga0265320_10026713 | 3300031240 | Bacteria | 3018 |
| 290 | Ga0265325_10001423 | 3300031241 | Bacteria | 16843 |
| 291 | Ga0265331_10011560 | 3300031250 | Unclassified | 4829 |
| 292 | Ga0265327_10098126 | 3300031251 | Unclassified | 1418 |
| 293 | Ga0265316_10016456 | 3300031344 | Bacteria | 6412 |
| 294 | Ga0265316_10069578 | 3300031344 | Bacteria | 2716 |
| 295 | Ga0307408_100014642 | 3300031548 | Bacteria | 5210 |
| 296 | Ga0316575_10001516 | 3300031665 | Bacteria | 7512 |
| 297 | Ga0316575_10036209 | 3300031665 | Unclassified | 1941 |
| 298 | Ga0316579_10001580 | 3300031691 | Bacteria | 8310 |
| 299 | Ga0316579_10008236 | 3300031691 | Bacteria | 4339 |
| 300 | Ga0316579_10077111 | 3300031691 | Bacteria | 1584 |
| 301 | Ga0265314_10055950 | 3300031711 | Bacteria | 2718 |
| 302 | Ga0265314_10067021 | 3300031711 | Bacteria | 2420 |
| 303 | Ga0265342_10009110 | 3300031712 | Bacteria | 7033 |
| 304 | Ga0265342_10089153 | 3300031712 | Bacteria | 1770 |
| 305 | Ga0316576_10002899 | 3300031727 | Bacteria | 9906 |
| 306 | Ga0316576_10008864 | 3300031727 | Bacteria | 6454 |
| 307 | Ga0316576_10087459 | 3300031727 | Bacteria | 2319 |
| 308 | Ga0316576_10100552 | 3300031727 | Bacteria | 2161 |
| 309 | Ga0316576_10209952 | 3300031727 | Unclassified | 1466 |
| 310 | Ga0316576_10232041 | 3300031727 | Bacteria | 1387 |
| 311 | Ga0316578_10001999 | 3300031728 | Bacteria | 8666 |
| 312 | Ga0316578_10020422 | 3300031728 | Bacteria | 3660 |
| 313 | Ga0316578_10109446 | 3300031728 | Bacteria | 1659 |
| 314 | Ga0316578_10159531 | 3300031728 | Bacteria | 1359 |
| 315 | Ga0307405_10083559 | 3300031731 | Bacteria | 2093 |
| 316 | Ga0316577_10014282 | 3300031733 | Bacteria | 4358 |
| 317 | Ga0316577_10016050 | 3300031733 | Bacteria | 4123 |
| 318 | Ga0316577_10031697 | 3300031733 | Bacteria | 2953 |
| 319 | Ga0316577_10052487 | 3300031733 | Bacteria | 2275 |
| 320 | Ga0316577_10053887 | 3300031733 | Bacteria | 2245 |
| 321 | Ga0316577_10115910 | 3300031733 | Bacteria | 1504 |
| 322 | Ga0307406_10092107 | 3300031901 | Bacteria | 2043 |
| 323 | Ga0307412_10048384 | 3300031911 | Bacteria | 2796 |
| 324 | Ga0307409_100200714 | 3300031995 | Bacteria | 1784 |
| 325 | Ga0307409_100282776 | 3300031995 | Bacteria | 1534 |
| 326 | Ga0307409_100436890 | 3300031995 | Bacteria | 1260 |
| 327 | Ga0307416_100006774 | 3300032002 | Bacteria | 7203 |
| 328 | Ga0307416_100151523 | 3300032002 | Bacteria | 2127 |
| 329 | Ga0307416_100199410 | 3300032002 | Bacteria | 1897 |
| 330 | Ga0307411_10011806 | 3300032005 | Bacteria | 4734 |
| 331 | Ga0307411_10161194 | 3300032005 | Bacteria | 1680 |
| 332 | Ga0307411_10296216 | 3300032005 | Bacteria | 1295 |
| 333 | Ga0307411_10328667 | 3300032005 | Bacteria | 1238 |
| 334 | Ga0307411_10345751 | 3300032005 | Bacteria | 1210 |
| 335 | Ga0307415_100113001 | 3300032126 | Bacteria | 2019 |
| 336 | Ga0307415_100149195 | 3300032126 | Bacteria | 1797 |
| 337 | Ga0316583_10001066 | 3300032133 | Bacteria | 8894 |
| 338 | Ga0316583_10004374 | 3300032133 | Bacteria | 5039 |
| 339 | Ga0316583_10008776 | 3300032133 | Bacteria | 3647 |
| 340 | Ga0316583_10015240 | 3300032133 | Bacteria | 2766 |
| 341 | Ga0316583_10030788 | 3300032133 | Bacteria | 1910 |
| 342 | Ga0316583_10081129 | 3300032133 | Bacteria | 1133 |
| 343 | Ga0316585_10009731 | 3300032137 | Unclassified | 2813 |
| 344 | Ga0316580_10020218 | 3300032139 | Bacteria | 2050 |
| 345 | Ga0316593_10002825 | 3300032168 | Bacteria | 4203 |
| 346 | Ga0316593_10002881 | 3300032168 | Bacteria | 4175 |
| 347 | Ga0373923_0013566 | 3300035111 | Bacteria | 3040 |
| 348 | Ga0373923_0138226 | 3300035111 | Unclassified | 1100 |
| 349 | Ga0373953_0007906 | 3300035117 | Bacteria | 3586 |
| 350 | Ga0373956_0012993 | 3300035119 | Bacteria | 3460 |
| 351 | Ga0373956_0025548 | 3300035119 | Unclassified | 2554 |
| 352 | Ga0373955_0031365 | 3300035172 | Bacteria | 2783 |
| 353 | Ga0316574_0002385 | 3300035398 | Bacteria | 9403 |
| 354 | Ga0316574_0002874 | 3300035398 | Bacteria | 8753 |
| 355 | Ga0316574_0025058 | 3300035398 | Bacteria | 3577 |
| 356 | Ga0316574_0026162 | 3300035398 | Bacteria | 3508 |
| 357 | Ga0316574_0028738 | 3300035398 | Bacteria | 3355 |
| 358 | Ga0316574_0074536 | 3300035398 | Bacteria | 2148 |
| 359 | Ga0316574_0167093 | 3300035398 | Bacteria | 1417 |
| 360 | Ga0316574_0187481 | 3300035398 | Bacteria | 1330 |
| 361 | Ga0316574_0214679 | 3300035398 | Bacteria | 1234 |
| 362 | Ga0373924_0019685 | 3300035410 | Bacteria | 2616 |
| 363 | Ga0373927_0004693 | 3300035695 | Bacteria | 9529 |
| 364 | Ga0373933_0015584 | 3300035724 | Bacteria | 4238 |
| 365 | Ga0373937_0000668 | 3300036401 | Bacteria | 29873 |
| 366 | Ga0373937_0009654 | 3300036401 | Bacteria | 8403 |
| 367 | Ga0316582_0007784 | 3300036647 | Bacteria | 5726 |
| 368 | Ga0316582_0019293 | 3300036647 | Bacteria | 3988 |
| 369 | Ga0316582_0027003 | 3300036647 | Bacteria | 3462 |
| 370 | Ga0316582_0039999 | 3300036647 | Bacteria | 2923 |
| 371 | Ga0316582_0111367 | 3300036647 | Bacteria | 1822 |
| 372 | Ga0316582_0148580 | 3300036647 | Bacteria | 1583 |
| 373 | Ga0316582_0184910 | 3300036647 | Bacteria | 1418 |
| 374 | Ga0316582_0242418 | 3300036647 | Bacteria | 1235 |
| 375 | Ga0316584_0003275 | 3300036712 | Bacteria | 10479 |
| 376 | Ga0316584_0010804 | 3300036712 | Bacteria | 6394 |
| 377 | Ga0316584_0012319 | 3300036712 | Bacteria | 6028 |
| 378 | Ga0316584_0016764 | 3300036712 | Bacteria | 5256 |
| 379 | Ga0316584_0031988 | 3300036712 | Bacteria | 3892 |
| 380 | Ga0316584_0134158 | 3300036712 | Bacteria | 1849 |
| 381 | Ga0316584_0161087 | 3300036712 | Bacteria | 1667 |
| 382 | Ga0395900_0115098 | 3300037418 | Bacteria | 2760 |
| 383 | Ga0316581_0000808 | 3300037588 | Bacteria | 6505 |
| 384 | Ga0400484_37647 | 3300038725 | Bacteria | 17784 |
| 385 | Ga0400490_32525 | 3300038726 | Bacteria | 20877 |
| 386 | Ga0400490_38419 | 3300038726 | Bacteria | 9426 |
| 387 | Ga0400490_43208 | 3300038726 | Bacteria | 40847 |
| 388 | Ga0400490_55439 | 3300038726 | Bacteria | 3460 |
| 389 | Ga0400485_09840 | 3300038735 | Bacteria | 7784 |
| 390 | Ga0400485_10846 | 3300038735 | Bacteria | 1138 |
| 391 | Ga0400488_07274 | 3300038741 | Bacteria | 3041 |
| 392 | Ga0400488_41421 | 3300038741 | Bacteria | 5384 |
| 393 | Ga0400488_48288 | 3300038741 | Bacteria | 12907 |
| 394 | Ga0400486_02595 | 3300038742 | Bacteria | 12059 |
| 395 | Ga0400486_20354 | 3300038742 | Bacteria | 2759 |
| 396 | Ga0400489_07775 | 3300039093 | Bacteria | 14176 |
| 397 | Ga0400487_25647 | 3300039110 | Bacteria | 4526 |
| 398 | Ga0400487_25849 | 3300039110 | Bacteria | 10824 |
| 399 | Ga0400487_57417 | 3300039110 | Bacteria | 26138 |
| 400 | Ga0400487_61740 | 3300039110 | Bacteria | 26986 |
| 401 | Ga0439453_0000865 | 3300041408 | Bacteria | 3612 |
| 402 | Ga0451853_2575282 | 3300041512 | Bacteria | 1399 |
| 403 | Ga0439433_0009624 | 3300041999 | Bacteria | 2109 |
| 404 | Ga0439441_003981 | 3300042001 | Bacteria | 2213 |
| 405 | Ga0450920_000110 | 3300042122 | Bacteria | 10927 |
| 406 | Ga0450923_000591 | 3300042125 | Bacteria | 4140 |
| 407 | Ga0450894_002633 | 3300042131 | Bacteria | 2390 |
| 408 | Ga0450898_000237 | 3300042134 | Bacteria | 6024 |
| 409 | Ga0450906_005635 | 3300042145 | Bacteria | 2562 |
| 410 | Ga0450907_019164 | 3300042146 | Bacteria | 1147 |
| 411 | Ga0450910_003509 | 3300042147 | Bacteria | 2083 |
| 412 | Ga0439446_0002077 | 3300042156 | Bacteria | 4759 |
| 413 | Ga0439434_0071387 | 3300042435 | Bacteria | 1093 |
| 414 | Ga0439435_0000394 | 3300042436 | Bacteria | 6765 |
| 415 | Ga0439444_0000160 | 3300042437 | Bacteria | 6043 |
| 416 | Ga0439460_0002399 | 3300042461 | Bacteria | 4516 |
| 417 | Ga0450916_007895 | 3300042530 | Bacteria | 1285 |
| 418 | Ga0450918_002623 | 3300042531 | Bacteria | 3394 |
| 419 | Ga0451577_0000071 | 3300042876 | Bacteria | 238560 |
| 420 | Ga0451577_0065607 | 3300042876 | Bacteria | 3238 |
| 421 | Ga0451577_0249359 | 3300042876 | Bacteria | 1607 |
| 422 | Ga0453684_0000537 | 3300044712 | Bacteria | 144017 |
| 423 | Ga0453684_0001268 | 3300044712 | Bacteria | 75704 |
| 424 | Ga0453684_0002379 | 3300044712 | Bacteria | 45928 |
| 425 | Ga0453684_0115550 | 3300044712 | Bacteria | 3251 |
| 426 | Ga0453684_0193002 | 3300044712 | Bacteria | 2381 |
| 427 | Ga0453684_0249949 | 3300044712 | Bacteria | 2037 |
| 428 | Ga0451576_0000217 | 3300045051 | Bacteria | 142222 |
| 429 | Ga0451576_0147652 | 3300045051 | Bacteria | 2452 |
| 430 | Ga0451576_0188958 | 3300045051 | Bacteria | 2151 |
| 431 | Ga0451576_0336463 | 3300045051 | Bacteria | 1580 |
| 432 | Ga0495590_0001780 | 3300046457 | Bacteria | 9143 |
| 433 | Ga0495638_0000892 | 3300046460 | Bacteria | 30611 |
| 434 | Ga0495638_0008830 | 3300046460 | Bacteria | 7117 |
| 435 | Ga0495605_0048452 | 3300046474 | Bacteria | 2080 |
| 436 | Ga0495610_0000407 | 3300046512 | Bacteria | 44093 |
| 437 | Ga0495610_0001778 | 3300046512 | Bacteria | 18835 |
| 438 | Ga0495628_0257321 | 3300046516 | Bacteria | 1302 |
| 439 | Ga0495631_0003596 | 3300046518 | Bacteria | 8455 |
| 440 | Ga0495644_0142771 | 3300046523 | Bacteria | 915 |
| 441 | Ga0495648_0001177 | 3300046524 | Bacteria | 26427 |
| 442 | Ga0495642_0069074 | 3300046528 | Bacteria | 1475 |
| 443 | Ga0495598_0002296 | 3300046537 | Bacteria | 3933 |
| 444 | Ga0495621_0062333 | 3300046539 | Bacteria | 1357 |
| 445 | Ga0495668_0010032 | 3300046616 | Bacteria | 5765 |
| 446 | Ga0495669_0023691 | 3300046684 | Bacteria | 2674 |
| 447 | Ga0495674_0158518 | 3300047319 | Bacteria | 1895 |
| 448 | Ga0495680_0064527 | 3300047322 | Bacteria | 2808 |
| 449 | Ga0495673_0001249 | 3300047469 | Bacteria | 21005 |
| 450 | Ga0495686_0001819 | 3300047472 | Bacteria | 21511 |
| 451 | Ga0495686_0005522 | 3300047472 | Bacteria | 9949 |
| 452 | Ga0496101_0084845 | 3300048904 | Bacteria | 2346 |
| 453 | Ga0496102_0165113 | 3300048905 | Bacteria | 2083 |
| 454 | Ga0496106_0088640 | 3300048909 | Bacteria | 2385 |
| 455 | Ga0496106_0160068 | 3300048909 | Bacteria | 1780 |
| 456 | Ga0496108_0062533 | 3300048911 | Bacteria | 3135 |
| 457 | Ga0496108_0206956 | 3300048911 | Bacteria | 1703 |
| 458 | Ga0496109_0248166 | 3300048912 | Bacteria | 1676 |
| 459 | Ga0496109_0367633 | 3300048912 | Unclassified | 1359 |
| 460 | Ga0496111_0172291 | 3300048914 | Bacteria | 1608 |
| 461 | Ga0495678_002267 | 3300049459 | Bacteria | 13345 |
| 462 | Ga0501031_0019378 | 3300049568 | Bacteria | 4433 |
| 463 | Ga0501031_0033825 | 3300049568 | Bacteria | 3337 |
| 464 | Ga0501032_0001200 | 3300049569 | Bacteria | 20717 |
| 465 | Ga0501032_0058320 | 3300049569 | Bacteria | 2592 |
| 466 | Ga0501033_0000188 | 3300049570 | Bacteria | 59295 |
| 467 | Ga0501033_0003912 | 3300049570 | Bacteria | 12095 |
| 468 | Ga0501033_0141060 | 3300049570 | Bacteria | 1742 |
| 469 | Ga0501033_0233720 | 3300049570 | Bacteria | 1305 |
| 470 | Ga0501034_0008488 | 3300049571 | Bacteria | 10849 |
| 471 | Ga0501034_0009000 | 3300049571 | Bacteria | 10485 |
| 472 | Ga0501034_0051333 | 3300049571 | Bacteria | 4159 |
| 473 | Ga0501034_0084666 | 3300049571 | Bacteria | 3172 |
| 474 | Ga0501036_0000718 | 3300049572 | Bacteria | 24523 |
| 475 | Ga0501036_0001240 | 3300049572 | Bacteria | 19516 |
| 476 | Ga0501036_0042686 | 3300049572 | Bacteria | 3839 |
| 477 | Ga0501037_0010203 | 3300049573 | Bacteria | 6891 |
| 478 | Ga0501037_0029768 | 3300049573 | Bacteria | 4034 |
| 479 | Ga0501037_0066120 | 3300049573 | Bacteria | 2634 |
| 480 | Ga0501037_0353728 | 3300049573 | Bacteria | 1013 |
| 481 | Ga0501038_0003652 | 3300049574 | Bacteria | 14338 |
| 482 | Ga0501038_0004503 | 3300049574 | Bacteria | 12960 |
| 483 | Ga0501038_0007525 | 3300049574 | Bacteria | 10040 |
| 484 | Ga0501038_0016271 | 3300049574 | Bacteria | 6744 |
| 485 | Ga0501038_0083584 | 3300049574 | Bacteria | 2687 |
| 486 | Ga0501038_0148251 | 3300049574 | Bacteria | 1914 |
| 487 | Ga0501038_0175769 | 3300049574 | Bacteria | 1730 |
| 488 | Ga0501038_0176266 | 3300049574 | Bacteria | 1728 |
| 489 | Ga0501039_0002522 | 3300049575 | Bacteria | 13654 |
| 490 | Ga0501039_0062889 | 3300049575 | Bacteria | 2876 |
| 491 | Ga0501040_0001755 | 3300049576 | Bacteria | 13937 |
| 492 | Ga0501040_0028480 | 3300049576 | Bacteria | 3766 |
| 493 | Ga0501040_0040177 | 3300049576 | Bacteria | 3183 |
| 494 | Ga0501040_0043196 | 3300049576 | Bacteria | 3072 |
| 495 | Ga0501040_0105258 | 3300049576 | Bacteria | 1971 |
| 496 | Ga0501040_0233824 | 3300049576 | Bacteria | 1309 |
| 497 | Ga0501041_0000472 | 3300049577 | Bacteria | 20445 |
| 498 | Ga0501041_0006644 | 3300049577 | Bacteria | 6774 |
| 499 | Ga0501041_0026044 | 3300049577 | Bacteria | 3515 |
| 500 | Ga0501041_0150407 | 3300049577 | Bacteria | 1453 |
| 501 | Ga0501042_0001285 | 3300049578 | Bacteria | 14606 |
| 502 | Ga0501042_0068128 | 3300049578 | Bacteria | 2544 |
| 503 | Ga0501042_0073672 | 3300049578 | Bacteria | 2443 |
| 504 | Ga0501042_0188964 | 3300049578 | Bacteria | 1486 |
| 505 | Ga0501042_0207865 | 3300049578 | Bacteria | 1411 |
| 506 | Ga0501043_0014939 | 3300049579 | Bacteria | 6080 |
| 507 | Ga0501043_0032065 | 3300049579 | Bacteria | 4130 |
| 508 | Ga0501043_0212082 | 3300049579 | Bacteria | 1501 |
| 509 | Ga0501046_0001072 | 3300049580 | Bacteria | 26824 |
| 510 | Ga0501046_0045909 | 3300049580 | Bacteria | 3468 |
| 511 | Ga0501046_0134212 | 3300049580 | Bacteria | 1876 |
| 512 | Ga0501046_0443344 | 3300049580 | Bacteria | 934 |
| 513 | Ga0501047_0000478 | 3300049581 | Bacteria | 43581 |
| 514 | Ga0501047_0129236 | 3300049581 | Bacteria | 2406 |
| 515 | Ga0501048_0000076 | 3300049582 | Bacteria | 51144 |
| 516 | Ga0501048_0178273 | 3300049582 | Bacteria | 1506 |
| 517 | Ga0501068_0000767 | 3300049584 | Bacteria | 16533 |
| 518 | Ga0501068_0004342 | 3300049584 | Bacteria | 7709 |
| 519 | Ga0501068_0076595 | 3300049584 | Bacteria | 2047 |
| 520 | Ga0501068_0202072 | 3300049584 | Bacteria | 1260 |
| 521 | Ga0501069_0010284 | 3300049585 | Bacteria | 4953 |
| 522 | Ga0501069_0066608 | 3300049585 | Bacteria | 2014 |
| 523 | Ga0501070_0003106 | 3300049586 | Bacteria | 14461 |
| 524 | Ga0501070_0007205 | 3300049586 | Bacteria | 9439 |
| 525 | Ga0501070_0110702 | 3300049586 | Bacteria | 2269 |
| 526 | Ga0501071_0007357 | 3300049587 | Bacteria | 7221 |
| 527 | Ga0501071_0033865 | 3300049587 | Bacteria | 3632 |
| 528 | Ga0501071_0049039 | 3300049587 | Bacteria | 3038 |
| 529 | Ga0501071_0060117 | 3300049587 | Bacteria | 2750 |
| 530 | Ga0501072_0000201 | 3300049588 | Bacteria | 43540 |
| 531 | Ga0501072_0000279 | 3300049588 | Bacteria | 36892 |
| 532 | Ga0501072_0027819 | 3300049588 | Bacteria | 4411 |
| 533 | Ga0501072_0221329 | 3300049588 | Bacteria | 1508 |
| 534 | Ga0501072_0264708 | 3300049588 | Bacteria | 1368 |
| 535 | Ga0501073_0002463 | 3300049589 | Bacteria | 13830 |
| 536 | Ga0501073_0023099 | 3300049589 | Bacteria | 4470 |
| 537 | Ga0501073_0072600 | 3300049589 | Bacteria | 2397 |
| 538 | Ga0501074_0184703 | 3300049590 | Bacteria | 1487 |
| 539 | Ga0501075_0000544 | 3300049591 | Bacteria | 22874 |
| 540 | Ga0501075_0020429 | 3300049591 | Bacteria | 4818 |
| 541 | Ga0501075_0104559 | 3300049591 | Bacteria | 2152 |
| 542 | Ga0501076_0002059 | 3300049592 | Bacteria | 13777 |
| 543 | Ga0501076_0034768 | 3300049592 | Bacteria | 3941 |
| 544 | Ga0501076_0101622 | 3300049592 | Bacteria | 2317 |
| 545 | Ga0501077_0000940 | 3300049593 | Bacteria | 17566 |
| 546 | Ga0501077_0002116 | 3300049593 | Bacteria | 11982 |
| 547 | Ga0501209_008906 | 3300049656 | Bacteria | 2002 |
| 548 | Ga0501079_0001239 | 3300049741 | Bacteria | 17879 |
| 549 | Ga0501079_0166823 | 3300049741 | Bacteria | 1717 |
| 550 | Ga0501079_0172039 | 3300049741 | Bacteria | 1689 |
| 551 | Ga0501080_0000762 | 3300049742 | Bacteria | 26133 |
| 552 | Ga0501080_0004833 | 3300049742 | Bacteria | 12017 |
| 553 | Ga0501080_0023689 | 3300049742 | Bacteria | 5688 |
| 554 | Ga0501080_0044112 | 3300049742 | Bacteria | 4151 |
| 555 | Ga0501080_0077819 | 3300049742 | Bacteria | 3085 |
| 556 | Ga0501080_0179319 | 3300049742 | Bacteria | 1950 |
| 557 | Ga0501081_0002121 | 3300049743 | Bacteria | 12402 |
| 558 | Ga0501081_0009584 | 3300049743 | Bacteria | 6314 |
| 559 | Ga0501081_0064701 | 3300049743 | Bacteria | 2540 |
| 560 | Ga0501083_0033937 | 3300049744 | Bacteria | 3491 |
| 561 | Ga0501035_0001470 | 3300049822 | Bacteria | 24148 |
| 562 | Ga0501035_0003336 | 3300049822 | Bacteria | 15379 |
| 563 | Ga0501035_0150267 | 3300049822 | Bacteria | 2022 |
| 564 | Ga0501035_0185186 | 3300049822 | Bacteria | 1792 |
| 565 | Ga0501044_0000700 | 3300049823 | Bacteria | 40445 |
| 566 | Ga0501044_0045596 | 3300049823 | Bacteria | 4542 |
| 567 | Ga0501044_0074650 | 3300049823 | Bacteria | 3444 |
| 568 | Ga0501044_0146252 | 3300049823 | Bacteria | 2348 |
| 569 | Ga0501044_0309784 | 3300049823 | Bacteria | 1506 |
| 570 | Ga0501045_0002586 | 3300049824 | Bacteria | 12350 |
| 571 | Ga0501045_0062927 | 3300049824 | Bacteria | 2723 |
| 572 | Ga0501045_0201612 | 3300049824 | Bacteria | 1482 |
| 573 | Ga0501045_0319791 | 3300049824 | Bacteria | 1155 |
| 574 | nmdc:mga00v17_1575_c1 | 3300050491 | Bacteria | 11912 |
| 575 | nmdc:mga0yw44_392_c1 | 3300050492 | Bacteria | 4352 |
| 576 | nmdc:mga0k408_93752_c1 | 3300050493 | Bacteria | 1765 |
| 577 | nmdc:mga09592_117642_c1 | 3300050508 | Bacteria | 2281 |
| 578 | nmdc:mga09592_1308_c1 | 3300050508 | Bacteria | 19998 |
| 579 | nmdc:mga09592_77022_c1 | 3300050508 | Bacteria | 2837 |
| 580 | nmdc:mga0qj67_143552_c1 | 3300050509 | Bacteria | 1936 |
| 581 | nmdc:mga0qj67_360_c1 | 3300050509 | Bacteria | 31452 |
| 582 | nmdc:mga0qj67_386637_c1 | 3300050509 | Bacteria | 1130 |
| 583 | nmdc:mga06r32_192035_c1 | 3300050510 | Bacteria | 2029 |
| 584 | nmdc:mga06r32_262486_c1 | 3300050510 | Bacteria | 1715 |
| 585 | nmdc:mga06r32_264289_c1 | 3300050510 | Bacteria | 1708 |
| 586 | nmdc:mga08y16_109867_c1 | 3300050511 | Bacteria | 2871 |
| 587 | nmdc:mga08y16_111384_c1 | 3300050511 | Bacteria | 2849 |
| 588 | nmdc:mga08y16_15235_c1 | 3300050511 | Bacteria | 8086 |
| 589 | nmdc:mga08y16_37268_c1 | 3300050511 | Bacteria | 5108 |
| 590 | nmdc:mga08y16_53073_c2 | 3300050511 | Bacteria | 3713 |
| 591 | nmdc:mga08y16_55056_c1 | 3300050511 | Bacteria | 4158 |
| 592 | nmdc:mga0n895_458_c1 | 3300050512 | Bacteria | 27351 |
| 593 | nmdc:mga0n895_6386_c1 | 3300050512 | Bacteria | 10006 |
| 594 | nmdc:mga0rr50_4092_c1 | 3300050513 | Bacteria | 8514 |
| 595 | nmdc:mga08x19_47094_c1 | 3300050514 | Bacteria | 2759 |
| 596 | nmdc:mga0a205_13158_c1 | 3300050515 | Bacteria | 7687 |
| 597 | Ga0500578_0000023 | 3300053086 | Bacteria | 153470 |
| 598 | Ga0500644_0000174 | 3300053088 | Bacteria | 41140 |
| 599 | Ga0500554_003204 | 3300053102 | Bacteria | 3318 |
| 600 | Ga0500562_000505 | 3300053108 | Bacteria | 9492 |
| 601 | Ga0500594_0000416 | 3300053118 | Bacteria | 9441 |
| 602 | Ga0500658_0003039 | 3300053134 | Bacteria | 6430 |
| 603 | Ga0500564_000227 | 3300053138 | Bacteria | 15612 |
| 604 | Ga0500622_0002375 | 3300053156 | Bacteria | 13641 |
| 605 | Ga0501084_0011394 | 3300054114 | Bacteria | 7362 |
| 606 | Ga0501084_0021886 | 3300054114 | Bacteria | 5332 |
| 607 | Ga0501084_0026938 | 3300054114 | Bacteria | 4802 |
| 608 | Ga0501084_0043239 | 3300054114 | Bacteria | 3769 |
| 609 | Ga0501082_0003857 | 3300060353 | Bacteria | 13106 |
| 610 | Ga0501082_0004025 | 3300060353 | Bacteria | 12826 |
| 611 | Ga0501082_0069873 | 3300060353 | Bacteria | 3024 |
| 612 | Ga0501082_0207889 | 3300060353 | Bacteria | 1703 |
| 613 | Ga0501082_0674745 | 3300060353 | Bacteria | 904 |
| 614 | Ga0530510_0003587 | 3300061734 | Bacteria | 10683 |
| 615 | Ga0530510_0339582 | 3300061734 | Bacteria | 1127 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10355026 | Ga0157373_103550262 | 224 |
| 2 | 3300047319 | Ga0495674_0158518 | Ga0495674_0158518_60_785 | 239 |
| 3 | 3300049588 | Ga0501072_0221329 | Ga0501072_0221329_20_757 | 244 |
| 4 | 3300049592 | Ga0501076_0034768 | Ga0501076_0034768_17_754 | 244 |
| 5 | 3300060353 | Ga0501082_0674745 | Ga0501082_0674745_151_888 | 244 |
| 6 | 3300046523 | Ga0495644_0142771 | Ga0495644_0142771_67_831 | 246 |
| 7 | 3300049823 | Ga0501044_0309784 | Ga0501044_0309784_746_1495 | 248 |
| 8 | 3300049578 | Ga0501042_0188964 | Ga0501042_0188964_165_941 | 254 |
| 9 | 3300049570 | Ga0501033_0233720 | Ga0501033_0233720_512_1291 | 258 |
| 10 | 3300049576 | Ga0501040_0043196 | Ga0501040_0043196_12_791 | 258 |
| 11 | 3300049742 | Ga0501080_0044112 | Ga0501080_0044112_17_796 | 258 |
| 12 | 3300035111 | Ga0373923_0138226 | Ga0373923_0138226_290_1090 | 259 |
| 13 | 3300009177 | Ga0105248_10000708 | Ga0105248_100007084 | 267 |
| 14 | 3300025941 | Ga0207711_10000275 | Ga0207711_100002754 | 267 |
| 15 | 3300010375 | Ga0105239_10185672 | Ga0105239_101856722 | 269 |
| 16 | 3300049580 | Ga0501046_0443344 | Ga0501046_0443344_28_846 | 271 |
| 17 | 3300009093 | Ga0105240_10081963 | Ga0105240_100819632 | 275 |
| 18 | 3300013104 | Ga0157370_10031088 | Ga0157370_100310885 | 275 |
| 19 | 3300049570 | Ga0501033_0141060 | Ga0501033_0141060_32_952 | 275 |
| 20 | 3300005364 | Ga0070673_100429253 | Ga0070673_1004292532 | 277 |
| 21 | 3300025937 | Ga0207669_10498724 | Ga0207669_104987241 | 277 |
| 22 | 3300025945 | Ga0207679_10450745 | Ga0207679_104507452 | 277 |
| 23 | 3300048909 | Ga0496106_0088640 | Ga0496106_0088640_1257_2129 | 277 |
| 24 | 3300005549 | Ga0070704_100033256 | Ga0070704_1000332562 | 278 |
| 25 | 3300041512 | Ga0451853_2575282 | Ga0451853_2575282_232_1119 | 278 |
| 26 | 3300039110 | Ga0400487_57417 | Ga0400487_57417_13610_14452 | 279 |
| 27 | 3300049590 | Ga0501074_0184703 | Ga0501074_0184703_629_1471 | 279 |
| 28 | 3300050510 | nmdc:mga06r32_262486_c1 | nmdc:mga06r32_262486_c1_34_936 | 279 |
| 29 | 3300049573 | Ga0501037_0353728 | Ga0501037_0353728_22_882 | 280 |
| 30 | 3300042435 | Ga0439434_0071387 | Ga0439434_0071387_17_874 | 284 |
| 31 | 3300046537 | Ga0495598_0002296 | Ga0495598_0002296_504_1382 | 285 |
| 32 | 3300049570 | Ga0501033_0003912 | Ga0501033_0003912_5251_6129 | 285 |
| 33 | 3300049571 | Ga0501034_0051333 | Ga0501034_0051333_14_892 | 285 |
| 34 | 3300049572 | Ga0501036_0001240 | Ga0501036_0001240_5960_6838 | 285 |
| 35 | 3300049573 | Ga0501037_0010203 | Ga0501037_0010203_1204_2082 | 285 |
| 36 | 3300049574 | Ga0501038_0007525 | Ga0501038_0007525_5070_5948 | 285 |
| 37 | 3300049575 | Ga0501039_0002522 | Ga0501039_0002522_8160_9038 | 285 |
| 38 | 3300049576 | Ga0501040_0001755 | Ga0501040_0001755_5963_6841 | 285 |
| 39 | 3300049576 | Ga0501040_0105258 | Ga0501040_0105258_1019_1897 | 285 |
| 40 | 3300049577 | Ga0501041_0000472 | Ga0501041_0000472_12586_13464 | 285 |
| 41 | 3300049578 | Ga0501042_0001285 | Ga0501042_0001285_1906_2784 | 285 |
| 42 | 3300049579 | Ga0501043_0032065 | Ga0501043_0032065_1840_2718 | 285 |
| 43 | 3300049580 | Ga0501046_0001072 | Ga0501046_0001072_1938_2816 | 285 |
| 44 | 3300049582 | Ga0501048_0000076 | Ga0501048_0000076_26259_27137 | 285 |
| 45 | 3300049584 | Ga0501068_0004342 | Ga0501068_0004342_1719_2597 | 285 |
| 46 | 3300049587 | Ga0501071_0060117 | Ga0501071_0060117_1291_2169 | 285 |
| 47 | 3300049588 | Ga0501072_0000201 | Ga0501072_0000201_3214_4092 | 285 |
| 48 | 3300049589 | Ga0501073_0072600 | Ga0501073_0072600_1174_2052 | 285 |
| 49 | 3300049591 | Ga0501075_0000544 | Ga0501075_0000544_7435_8313 | 285 |
| 50 | 3300049592 | Ga0501076_0002059 | Ga0501076_0002059_7431_8309 | 285 |
| 51 | 3300049593 | Ga0501077_0000940 | Ga0501077_0000940_12567_13445 | 285 |
| 52 | 3300049741 | Ga0501079_0001239 | Ga0501079_0001239_5792_6670 | 285 |
| 53 | 3300049742 | Ga0501080_0023689 | Ga0501080_0023689_4727_5605 | 285 |
| 54 | 3300049743 | Ga0501081_0002121 | Ga0501081_0002121_7432_8310 | 285 |
| 55 | 3300049744 | Ga0501083_0033937 | Ga0501083_0033937_1798_2676 | 285 |
| 56 | 3300049822 | Ga0501035_0003336 | Ga0501035_0003336_2296_3174 | 285 |
| 57 | 3300049824 | Ga0501045_0002586 | Ga0501045_0002586_5618_6496 | 285 |
| 58 | 3300054114 | Ga0501084_0011394 | Ga0501084_0011394_1374_2252 | 285 |
| 59 | 3300060353 | Ga0501082_0004025 | Ga0501082_0004025_3214_4092 | 285 |
| 60 | 3300061734 | Ga0530510_0003587 | Ga0530510_0003587_5084_5962 | 285 |
| 61 | 3300005330 | Ga0070690_100025287 | Ga0070690_1000252872 | 286 |
| 62 | 3300005331 | Ga0070670_100149502 | Ga0070670_1001495022 | 286 |
| 63 | 3300005354 | Ga0070675_100121825 | Ga0070675_1001218252 | 286 |
| 64 | 3300005356 | Ga0070674_100033003 | Ga0070674_1000330034 | 286 |
| 65 | 3300005364 | Ga0070673_100238362 | Ga0070673_1002383621 | 286 |
| 66 | 3300005365 | Ga0070688_100032478 | Ga0070688_1000324783 | 286 |
| 67 | 3300005367 | Ga0070667_100119626 | Ga0070667_1001196261 | 286 |
| 68 | 3300005440 | Ga0070705_100075661 | Ga0070705_1000756612 | 286 |
| 69 | 3300005458 | Ga0070681_10015927 | Ga0070681_100159276 | 286 |
| 70 | 3300005466 | Ga0070685_10140292 | Ga0070685_101402922 | 286 |
| 71 | 3300005467 | Ga0070706_100030901 | Ga0070706_1000309012 | 286 |
| 72 | 3300005468 | Ga0070707_100044998 | Ga0070707_1000449984 | 286 |
| 73 | 3300005543 | Ga0070672_100311018 | Ga0070672_1003110182 | 286 |
| 74 | 3300005544 | Ga0070686_100130774 | Ga0070686_1001307742 | 286 |
| 75 | 3300005546 | Ga0070696_100003280 | Ga0070696_1000032808 | 286 |
| 76 | 3300005546 | Ga0070696_100131444 | Ga0070696_1001314442 | 286 |
| 77 | 3300005547 | Ga0070693_100139513 | Ga0070693_1001395132 | 286 |
| 78 | 3300005548 | Ga0070665_100431051 | Ga0070665_1004310512 | 286 |
| 79 | 3300005563 | Ga0068855_100178181 | Ga0068855_1001781813 | 286 |
| 80 | 3300005614 | Ga0068856_100111428 | Ga0068856_1001114282 | 286 |
| 81 | 3300005615 | Ga0070702_100223467 | Ga0070702_1002234672 | 286 |
| 82 | 3300005618 | Ga0068864_100103489 | Ga0068864_1001034892 | 286 |
| 83 | 3300005618 | Ga0068864_100117562 | Ga0068864_1001175623 | 286 |
| 84 | 3300005718 | Ga0068866_10004753 | Ga0068866_100047532 | 286 |
| 85 | 3300005841 | Ga0068863_100149228 | Ga0068863_1001492282 | 286 |
| 86 | 3300005842 | Ga0068858_100103666 | Ga0068858_1001036662 | 286 |
| 87 | 3300006871 | Ga0075434_100003639 | Ga0075434_1000036394 | 286 |
| 88 | 3300007076 | Ga0075435_100001061 | Ga0075435_10000106110 | 286 |
| 89 | 3300009148 | Ga0105243_10066704 | Ga0105243_100667042 | 286 |
| 90 | 3300009176 | Ga0105242_10049194 | Ga0105242_100491943 | 286 |
| 91 | 3300009177 | Ga0105248_10183810 | Ga0105248_101838102 | 286 |
| 92 | 3300009177 | Ga0105248_10231822 | Ga0105248_102318221 | 286 |
| 93 | 3300013297 | Ga0157378_10098287 | Ga0157378_100982873 | 286 |
| 94 | 3300014745 | Ga0157377_10113491 | Ga0157377_101134911 | 286 |
| 95 | 3300014968 | Ga0157379_10228899 | Ga0157379_102288992 | 286 |
| 96 | 3300014969 | Ga0157376_10278826 | Ga0157376_102788262 | 286 |
| 97 | 3300025893 | Ga0207682_10001431 | Ga0207682_1000143110 | 286 |
| 98 | 3300025899 | Ga0207642_10015483 | Ga0207642_100154832 | 286 |
| 99 | 3300025901 | Ga0207688_10172229 | Ga0207688_101722291 | 286 |
| 100 | 3300025907 | Ga0207645_10013350 | Ga0207645_100133502 | 286 |
| 101 | 3300025908 | Ga0207643_10009949 | Ga0207643_100099495 | 286 |
| 102 | 3300025922 | Ga0207646_10217100 | Ga0207646_102171002 | 286 |
| 103 | 3300025923 | Ga0207681_10114150 | Ga0207681_101141501 | 286 |
| 104 | 3300025925 | Ga0207650_10043232 | Ga0207650_100432324 | 286 |
| 105 | 3300025933 | Ga0207706_10005160 | Ga0207706_1000516011 | 286 |
| 106 | 3300025935 | Ga0207709_10037283 | Ga0207709_100372833 | 286 |
| 107 | 3300025937 | Ga0207669_10257834 | Ga0207669_102578342 | 286 |
| 108 | 3300025940 | Ga0207691_10075807 | Ga0207691_100758072 | 286 |
| 109 | 3300025942 | Ga0207689_10003287 | Ga0207689_1000328710 | 286 |
| 110 | 3300025949 | Ga0207667_10294144 | Ga0207667_102941442 | 286 |
| 111 | 3300026035 | Ga0207703_10135966 | Ga0207703_101359662 | 286 |
| 112 | 3300026078 | Ga0207702_10038243 | Ga0207702_100382432 | 286 |
| 113 | 3300026088 | Ga0207641_10079123 | Ga0207641_100791232 | 286 |
| 114 | 3300026088 | Ga0207641_10114174 | Ga0207641_101141742 | 286 |
| 115 | 3300026088 | Ga0207641_10119036 | Ga0207641_101190363 | 286 |
| 116 | 3300026088 | Ga0207641_10146334 | Ga0207641_101463342 | 286 |
| 117 | 3300026089 | Ga0207648_10080379 | Ga0207648_100803792 | 286 |
| 118 | 3300026095 | Ga0207676_10029498 | Ga0207676_100294983 | 286 |
| 119 | 3300026095 | Ga0207676_10072396 | Ga0207676_100723963 | 286 |
| 120 | 3300026118 | Ga0207675_100060162 | Ga0207675_1000601623 | 286 |
| 121 | 3300026118 | Ga0207675_100089106 | Ga0207675_1000891062 | 286 |
| 122 | 3300026121 | Ga0207683_10067076 | Ga0207683_100670762 | 286 |
| 123 | 3300027907 | Ga0207428_10078762 | Ga0207428_100787622 | 286 |
| 124 | 3300027907 | Ga0207428_10118734 | Ga0207428_101187342 | 286 |
| 125 | 3300028381 | Ga0268264_10103536 | Ga0268264_101035362 | 286 |
| 126 | 3300031238 | Ga0265332_10001273 | Ga0265332_100012732 | 286 |
| 127 | 3300031240 | Ga0265320_10026713 | Ga0265320_100267131 | 286 |
| 128 | 3300031344 | Ga0265316_10069578 | Ga0265316_100695782 | 286 |
| 129 | 3300031711 | Ga0265314_10055950 | Ga0265314_100559502 | 286 |
| 130 | 3300031712 | Ga0265342_10089153 | Ga0265342_100891532 | 286 |
| 131 | 3300045051 | Ga0451576_0336463 | Ga0451576_0336463_239_1123 | 286 |
| 132 | 3300046474 | Ga0495605_0048452 | Ga0495605_0048452_317_1219 | 286 |
| 133 | 3300046528 | Ga0495642_0069074 | Ga0495642_0069074_60_962 | 286 |
| 134 | 3300046684 | Ga0495669_0023691 | Ga0495669_0023691_1664_2566 | 286 |
| 135 | 3300050511 | nmdc:mga08y16_111384_c1 | nmdc:mga08y16_111384_c1_1590_2492 | 286 |
| 136 | 3300050511 | nmdc:mga08y16_53073_c2 | nmdc:mga08y16_53073_c2_1808_2692 | 286 |
| 137 | 3300050512 | nmdc:mga0n895_458_c1 | nmdc:mga0n895_458_c1_2702_3586 | 286 |
| 138 | 3300005327 | Ga0070658_10102091 | Ga0070658_101020912 | 287 |
| 139 | 3300005329 | Ga0070683_100012665 | Ga0070683_1000126654 | 287 |
| 140 | 3300005331 | Ga0070670_100027026 | Ga0070670_1000270262 | 287 |
| 141 | 3300005338 | Ga0068868_100020949 | Ga0068868_1000209493 | 287 |
| 142 | 3300005354 | Ga0070675_100032974 | Ga0070675_1000329744 | 287 |
| 143 | 3300005355 | Ga0070671_100014257 | Ga0070671_1000142575 | 287 |
| 144 | 3300005364 | Ga0070673_100023681 | Ga0070673_1000236814 | 287 |
| 145 | 3300005367 | Ga0070667_100122397 | Ga0070667_1001223972 | 287 |
| 146 | 3300005456 | Ga0070678_100018527 | Ga0070678_1000185272 | 287 |
| 147 | 3300005535 | Ga0070684_100118465 | Ga0070684_1001184652 | 287 |
| 148 | 3300005543 | Ga0070672_100019521 | Ga0070672_1000195213 | 287 |
| 149 | 3300005564 | Ga0070664_100013378 | Ga0070664_1000133782 | 287 |
| 150 | 3300005578 | Ga0068854_100011816 | Ga0068854_1000118164 | 287 |
| 151 | 3300005614 | Ga0068856_100603926 | Ga0068856_1006039261 | 287 |
| 152 | 3300005616 | Ga0068852_100028714 | Ga0068852_1000287143 | 287 |
| 153 | 3300006237 | Ga0097621_100028581 | Ga0097621_1000285812 | 287 |
| 154 | 3300006358 | Ga0068871_100021904 | Ga0068871_1000219043 | 287 |
| 155 | 3300013296 | Ga0157374_10066870 | Ga0157374_100668702 | 287 |
| 156 | 3300013297 | Ga0157378_10017616 | Ga0157378_100176162 | 287 |
| 157 | 3300013306 | Ga0163162_10102026 | Ga0163162_101020262 | 287 |
| 158 | 3300013308 | Ga0157375_10374040 | Ga0157375_103740402 | 287 |
| 159 | 3300014969 | Ga0157376_10017293 | Ga0157376_100172935 | 287 |
| 160 | 3300025907 | Ga0207645_10131657 | Ga0207645_101316572 | 287 |
| 161 | 3300025920 | Ga0207649_10296882 | Ga0207649_102968822 | 287 |
| 162 | 3300025926 | Ga0207659_10022463 | Ga0207659_100224633 | 287 |
| 163 | 3300025931 | Ga0207644_10015784 | Ga0207644_100157842 | 287 |
| 164 | 3300025940 | Ga0207691_10004579 | Ga0207691_100045796 | 287 |
| 165 | 3300025960 | Ga0207651_10015342 | Ga0207651_100153424 | 287 |
| 166 | 3300026023 | Ga0207677_10027935 | Ga0207677_100279354 | 287 |
| 167 | 3300026095 | Ga0207676_10154865 | Ga0207676_101548652 | 287 |
| 168 | 3300026121 | Ga0207683_10021380 | Ga0207683_100213803 | 287 |
| 169 | 3300044712 | Ga0453684_0002379 | Ga0453684_0002379_44766_45650 | 287 |
| 170 | 3300048912 | Ga0496109_0367633 | Ga0496109_0367633_232_1188 | 287 |
| 171 | 3300048914 | Ga0496111_0172291 | Ga0496111_0172291_564_1520 | 287 |
| 172 | 3300027360 | Ga0209969_1001703 | Ga0209969_10017033 | 288 |
| 173 | 3300027364 | Ga0209967_1013482 | Ga0209967_10134822 | 288 |
| 174 | 3300027471 | Ga0209995_1006296 | Ga0209995_10062963 | 288 |
| 175 | 3300027665 | Ga0209983_1007102 | Ga0209983_10071022 | 288 |
| 176 | 3300027876 | Ga0209974_10000936 | Ga0209974_100009368 | 288 |
| 177 | 3300042001 | Ga0439441_003981 | Ga0439441_003981_1217_2134 | 288 |
| 178 | 3300005437 | Ga0070710_10202560 | Ga0070710_102025601 | 289 |
| 179 | 3300025898 | Ga0207692_10161134 | Ga0207692_101611342 | 289 |
| 180 | 3300031727 | Ga0316576_10100552 | Ga0316576_101005522 | 289 |
| 181 | 3300031995 | Ga0307409_100200714 | Ga0307409_1002007142 | 289 |
| 182 | 3300035111 | Ga0373923_0013566 | Ga0373923_0013566_1229_2119 | 289 |
| 183 | 3300035117 | Ga0373953_0007906 | Ga0373953_0007906_2274_3164 | 289 |
| 184 | 3300035119 | Ga0373956_0012993 | Ga0373956_0012993_2271_3161 | 289 |
| 185 | 3300035172 | Ga0373955_0031365 | Ga0373955_0031365_407_1297 | 289 |
| 186 | 3300035410 | Ga0373924_0019685 | Ga0373924_0019685_1205_2095 | 289 |
| 187 | 3300035724 | Ga0373933_0015584 | Ga0373933_0015584_2628_3518 | 289 |
| 188 | 3300036401 | Ga0373937_0000668 | Ga0373937_0000668_13762_14652 | 289 |
| 189 | 3300038726 | Ga0400490_38419 | Ga0400490_38419_4112_4999 | 289 |
| 190 | 3300046516 | Ga0495628_0257321 | Ga0495628_0257321_300_1190 | 289 |
| 191 | 3300047322 | Ga0495680_0064527 | Ga0495680_0064527_1114_2004 | 289 |
| 192 | iso_pu_bacteria | 2894510363 | 2894513959 | 289 |
| 193 | 3300028577 | Ga0265318_10012165 | Ga0265318_100121652 | 290 |
| 194 | 3300031250 | Ga0265331_10011560 | Ga0265331_100115603 | 290 |
| 195 | 3300031344 | Ga0265316_10016456 | Ga0265316_100164564 | 290 |
| 196 | 3300031712 | Ga0265342_10009110 | Ga0265342_100091105 | 290 |
| 197 | 3300032005 | Ga0307411_10328667 | Ga0307411_103286672 | 290 |
| 198 | 3300042876 | Ga0451577_0065607 | Ga0451577_0065607_847_1734 | 290 |
| 199 | 3300044712 | Ga0453684_0249949 | Ga0453684_0249949_921_1829 | 290 |
| 200 | 3300005337 | Ga0070682_100099701 | Ga0070682_1000997012 | 291 |
| 201 | 3300006038 | Ga0075365_10018477 | Ga0075365_100184773 | 291 |
| 202 | 3300006051 | Ga0075364_10001278 | Ga0075364_100012783 | 291 |
| 203 | 3300048909 | Ga0496106_0160068 | Ga0496106_0160068_225_1271 | 291 |
| 204 | 3300050491 | nmdc:mga00v17_1575_c1 | nmdc:mga00v17_1575_c1_2676_3557 | 291 |
| 205 | 3300050492 | nmdc:mga0yw44_392_c1 | nmdc:mga0yw44_392_c1_2415_3296 | 291 |
| 206 | 3300005843 | Ga0068860_100256154 | Ga0068860_1002561542 | 292 |
| 207 | 3300006844 | Ga0075428_100002171 | Ga0075428_10000217117 | 292 |
| 208 | 3300006880 | Ga0075429_100001915 | Ga0075429_1000019158 | 292 |
| 209 | 3300009094 | Ga0111539_10000086 | Ga0111539_1000008670 | 292 |
| 210 | 3300027907 | Ga0207428_10002137 | Ga0207428_100021373 | 292 |
| 211 | 3300031711 | Ga0265314_10067021 | Ga0265314_100670212 | 292 |
| 212 | 3300035119 | Ga0373956_0025548 | Ga0373956_0025548_1545_2450 | 292 |
| 213 | 3300036401 | Ga0373937_0009654 | Ga0373937_0009654_1453_2358 | 292 |
| 214 | 3300045051 | Ga0451576_0147652 | Ga0451576_0147652_770_1717 | 292 |
| 215 | 3300049656 | Ga0501209_008906 | Ga0501209_008906_587_1510 | 292 |
| 216 | 3300050508 | nmdc:mga09592_1308_c1 | nmdc:mga09592_1308_c1_14348_15274 | 292 |
| 217 | 3300050511 | nmdc:mga08y16_55056_c1 | nmdc:mga08y16_55056_c1_1087_2013 | 292 |
| 218 | iso_pu_bacteria | 2989392574 | 2989395994 | 292 |
| 219 | 3300031241 | Ga0265325_10001423 | Ga0265325_1000142313 | 293 |
| 220 | 3300032133 | Ga0316583_10004374 | Ga0316583_100043743 | 293 |
| 221 | 3300035398 | Ga0316574_0026162 | Ga0316574_0026162_1693_2574 | 293 |
| 222 | 3300035398 | Ga0316574_0214679 | Ga0316574_0214679_194_1078 | 293 |
| 223 | 3300036647 | Ga0316582_0242418 | Ga0316582_0242418_25_906 | 293 |
| 224 | 3300038725 | Ga0400484_37647 | Ga0400484_37647_13538_14437 | 293 |
| 225 | 3300038726 | Ga0400490_32525 | Ga0400490_32525_6480_7379 | 293 |
| 226 | 3300038726 | Ga0400490_43208 | Ga0400490_43208_26912_27811 | 293 |
| 227 | 3300038726 | Ga0400490_55439 | Ga0400490_55439_1195_2094 | 293 |
| 228 | 3300038735 | Ga0400485_09840 | Ga0400485_09840_1706_2605 | 293 |
| 229 | 3300038735 | Ga0400485_10846 | Ga0400485_10846_35_934 | 293 |
| 230 | 3300038741 | Ga0400488_07274 | Ga0400488_07274_334_1233 | 293 |
| 231 | 3300038741 | Ga0400488_41421 | Ga0400488_41421_3650_4549 | 293 |
| 232 | 3300038741 | Ga0400488_48288 | Ga0400488_48288_10499_11398 | 293 |
| 233 | 3300038742 | Ga0400486_02595 | Ga0400486_02595_4855_5754 | 293 |
| 234 | 3300038742 | Ga0400486_20354 | Ga0400486_20354_446_1345 | 293 |
| 235 | 3300039093 | Ga0400489_07775 | Ga0400489_07775_6302_7201 | 293 |
| 236 | 3300039110 | Ga0400487_25647 | Ga0400487_25647_2282_3181 | 293 |
| 237 | 3300039110 | Ga0400487_25849 | Ga0400487_25849_4306_5205 | 293 |
| 238 | 3300039110 | Ga0400487_61740 | Ga0400487_61740_13092_13991 | 293 |
| 239 | 3300005330 | Ga0070690_100115885 | Ga0070690_1001158852 | 294 |
| 240 | 3300005840 | Ga0068870_10089532 | Ga0068870_100895322 | 294 |
| 241 | 3300031727 | Ga0316576_10002899 | Ga0316576_100028997 | 294 |
| 242 | 3300031727 | Ga0316576_10232041 | Ga0316576_102320412 | 294 |
| 243 | 3300032002 | Ga0307416_100199410 | Ga0307416_1001994102 | 294 |
| 244 | 3300032126 | Ga0307415_100149195 | Ga0307415_1001491952 | 294 |
| 245 | 3300035398 | Ga0316574_0074536 | Ga0316574_0074536_476_1432 | 294 |
| 246 | 3300036712 | Ga0316584_0134158 | Ga0316584_0134158_156_1109 | 294 |
| 247 | 3300049570 | Ga0501033_0000188 | Ga0501033_0000188_19274_20305 | 294 |
| 248 | 3300049573 | Ga0501037_0029768 | Ga0501037_0029768_711_1742 | 294 |
| 249 | 3300049574 | Ga0501038_0083584 | Ga0501038_0083584_952_1983 | 294 |
| 250 | 3300049581 | Ga0501047_0129236 | Ga0501047_0129236_470_1501 | 294 |
| 251 | 3300049585 | Ga0501069_0010284 | Ga0501069_0010284_3956_4930 | 294 |
| 252 | 3300049586 | Ga0501070_0003106 | Ga0501070_0003106_9189_10163 | 294 |
| 253 | 3300049586 | Ga0501070_0007205 | Ga0501070_0007205_6436_7410 | 294 |
| 254 | 3300049742 | Ga0501080_0077819 | Ga0501080_0077819_191_1165 | 294 |
| 255 | 3300049823 | Ga0501044_0074650 | Ga0501044_0074650_1477_2508 | 294 |
| 256 | 3300005330 | Ga0070690_100000076 | Ga0070690_10000007648 | 295 |
| 257 | 3300005331 | Ga0070670_100062463 | Ga0070670_1000624633 | 295 |
| 258 | 3300005334 | Ga0068869_100001183 | Ga0068869_1000011831 | 295 |
| 259 | 3300005336 | Ga0070680_100215823 | Ga0070680_1002158232 | 295 |
| 260 | 3300005337 | Ga0070682_100101595 | Ga0070682_1001015952 | 295 |
| 261 | 3300005340 | Ga0070689_100057420 | Ga0070689_1000574203 | 295 |
| 262 | 3300005341 | Ga0070691_10009987 | Ga0070691_100099872 | 295 |
| 263 | 3300005345 | Ga0070692_10009953 | Ga0070692_100099535 | 295 |
| 264 | 3300005345 | Ga0070692_10048341 | Ga0070692_100483413 | 295 |
| 265 | 3300005347 | Ga0070668_100021585 | Ga0070668_1000215853 | 295 |
| 266 | 3300005353 | Ga0070669_100474669 | Ga0070669_1004746691 | 295 |
| 267 | 3300005354 | Ga0070675_100008831 | Ga0070675_1000088314 | 295 |
| 268 | 3300005354 | Ga0070675_100043292 | Ga0070675_1000432922 | 295 |
| 269 | 3300005356 | Ga0070674_100068374 | Ga0070674_1000683742 | 295 |
| 270 | 3300005364 | Ga0070673_100024005 | Ga0070673_1000240053 | 295 |
| 271 | 3300005365 | Ga0070688_100133370 | Ga0070688_1001333702 | 295 |
| 272 | 3300005440 | Ga0070705_100017235 | Ga0070705_1000172352 | 295 |
| 273 | 3300005441 | Ga0070700_100002345 | Ga0070700_1000023452 | 295 |
| 274 | 3300005441 | Ga0070700_100045966 | Ga0070700_1000459663 | 295 |
| 275 | 3300005441 | Ga0070700_100083418 | Ga0070700_1000834182 | 295 |
| 276 | 3300005444 | Ga0070694_100139802 | Ga0070694_1001398022 | 295 |
| 277 | 3300005445 | Ga0070708_100063688 | Ga0070708_1000636881 | 295 |
| 278 | 3300005456 | Ga0070678_100193976 | Ga0070678_1001939762 | 295 |
| 279 | 3300005459 | Ga0068867_100001930 | Ga0068867_1000019302 | 295 |
| 280 | 3300005459 | Ga0068867_100394950 | Ga0068867_1003949501 | 295 |
| 281 | 3300005467 | Ga0070706_100045752 | Ga0070706_1000457522 | 295 |
| 282 | 3300005468 | Ga0070707_100271266 | Ga0070707_1002712662 | 295 |
| 283 | 3300005530 | Ga0070679_100101483 | Ga0070679_1001014831 | 295 |
| 284 | 3300005536 | Ga0070697_100070303 | Ga0070697_1000703032 | 295 |
| 285 | 3300005543 | Ga0070672_100048035 | Ga0070672_1000480352 | 295 |
| 286 | 3300005544 | Ga0070686_100000265 | Ga0070686_10000026539 | 295 |
| 287 | 3300005545 | Ga0070695_100073553 | Ga0070695_1000735532 | 295 |
| 288 | 3300005547 | Ga0070693_100002947 | Ga0070693_1000029479 | 295 |
| 289 | 3300005549 | Ga0070704_100077445 | Ga0070704_1000774452 | 295 |
| 290 | 3300005549 | Ga0070704_100094529 | Ga0070704_1000945291 | 295 |
| 291 | 3300005577 | Ga0068857_100021288 | Ga0068857_1000212884 | 295 |
| 292 | 3300005577 | Ga0068857_100310186 | Ga0068857_1003101862 | 295 |
| 293 | 3300005615 | Ga0070702_100000223 | Ga0070702_1000002237 | 295 |
| 294 | 3300005615 | Ga0070702_100019642 | Ga0070702_1000196422 | 295 |
| 295 | 3300005718 | Ga0068866_10077607 | Ga0068866_100776072 | 295 |
| 296 | 3300005719 | Ga0068861_100008407 | Ga0068861_1000084075 | 295 |
| 297 | 3300005719 | Ga0068861_100041588 | Ga0068861_1000415884 | 295 |
| 298 | 3300005840 | Ga0068870_10001641 | Ga0068870_100016415 | 295 |
| 299 | 3300005842 | Ga0068858_100011872 | Ga0068858_1000118722 | 295 |
| 300 | 3300005843 | Ga0068860_100004675 | Ga0068860_1000046759 | 295 |
| 301 | 3300005844 | Ga0068862_100021899 | Ga0068862_1000218994 | 295 |
| 302 | 3300005844 | Ga0068862_100033885 | Ga0068862_1000338853 | 295 |
| 303 | 3300006237 | Ga0097621_100010998 | Ga0097621_1000109982 | 295 |
| 304 | 3300006844 | Ga0075428_100025570 | Ga0075428_1000255702 | 295 |
| 305 | 3300006844 | Ga0075428_100167105 | Ga0075428_1001671052 | 295 |
| 306 | 3300006844 | Ga0075428_100671135 | Ga0075428_1006711351 | 295 |
| 307 | 3300006846 | Ga0075430_100003777 | Ga0075430_10000377711 | 295 |
| 308 | 3300006846 | Ga0075430_100040114 | Ga0075430_1000401143 | 295 |
| 309 | 3300006846 | Ga0075430_100438995 | Ga0075430_1004389951 | 295 |
| 310 | 3300006847 | Ga0075431_100087601 | Ga0075431_1000876013 | 295 |
| 311 | 3300006847 | Ga0075431_100137356 | Ga0075431_1001373563 | 295 |
| 312 | 3300006852 | Ga0075433_10004587 | Ga0075433_100045872 | 295 |
| 313 | 3300006852 | Ga0075433_10019169 | Ga0075433_100191696 | 295 |
| 314 | 3300006871 | Ga0075434_100004275 | Ga0075434_1000042754 | 295 |
| 315 | 3300006881 | Ga0068865_100008518 | Ga0068865_1000085184 | 295 |
| 316 | 3300006914 | Ga0075436_100012672 | Ga0075436_1000126724 | 295 |
| 317 | 3300007076 | Ga0075435_100004540 | Ga0075435_1000045404 | 295 |
| 318 | 3300007076 | Ga0075435_100133649 | Ga0075435_1001336492 | 295 |
| 319 | 3300009094 | Ga0111539_10013931 | Ga0111539_100139318 | 295 |
| 320 | 3300009094 | Ga0111539_10018745 | Ga0111539_100187456 | 295 |
| 321 | 3300009094 | Ga0111539_10160775 | Ga0111539_101607752 | 295 |
| 322 | 3300009098 | Ga0105245_10259015 | Ga0105245_102590152 | 295 |
| 323 | 3300009147 | Ga0114129_10023925 | Ga0114129_100239255 | 295 |
| 324 | 3300009147 | Ga0114129_10101196 | Ga0114129_101011963 | 295 |
| 325 | 3300009148 | Ga0105243_10001212 | Ga0105243_1000121225 | 295 |
| 326 | 3300009148 | Ga0105243_10001642 | Ga0105243_1000164211 | 295 |
| 327 | 3300009174 | Ga0105241_10028848 | Ga0105241_100288484 | 295 |
| 328 | 3300009176 | Ga0105242_10012243 | Ga0105242_100122436 | 295 |
| 329 | 3300009177 | Ga0105248_10154918 | Ga0105248_101549182 | 295 |
| 330 | 3300009545 | Ga0105237_10182942 | Ga0105237_101829422 | 295 |
| 331 | 3300009551 | Ga0105238_10387186 | Ga0105238_103871861 | 295 |
| 332 | 3300009553 | Ga0105249_10009025 | Ga0105249_100090257 | 295 |
| 333 | 3300010375 | Ga0105239_10041689 | Ga0105239_100416892 | 295 |
| 334 | 3300013297 | Ga0157378_10003052 | Ga0157378_100030522 | 295 |
| 335 | 3300013308 | Ga0157375_10164114 | Ga0157375_101641142 | 295 |
| 336 | 3300014326 | Ga0157380_10000239 | Ga0157380_100002395 | 295 |
| 337 | 3300014326 | Ga0157380_10002571 | Ga0157380_100025714 | 295 |
| 338 | 3300014326 | Ga0157380_10023775 | Ga0157380_100237752 | 295 |
| 339 | 3300014326 | Ga0157380_10091646 | Ga0157380_100916462 | 295 |
| 340 | 3300014745 | Ga0157377_10019158 | Ga0157377_100191582 | 295 |
| 341 | 3300014968 | Ga0157379_10009289 | Ga0157379_100092895 | 295 |
| 342 | 3300025899 | Ga0207642_10001872 | Ga0207642_100018722 | 295 |
| 343 | 3300025899 | Ga0207642_10154562 | Ga0207642_101545622 | 295 |
| 344 | 3300025907 | Ga0207645_10038280 | Ga0207645_100382803 | 295 |
| 345 | 3300025908 | Ga0207643_10005300 | Ga0207643_100053002 | 295 |
| 346 | 3300025908 | Ga0207643_10063874 | Ga0207643_100638742 | 295 |
| 347 | 3300025914 | Ga0207671_10037932 | Ga0207671_100379322 | 295 |
| 348 | 3300025917 | Ga0207660_10014287 | Ga0207660_100142873 | 295 |
| 349 | 3300025917 | Ga0207660_10189609 | Ga0207660_101896092 | 295 |
| 350 | 3300025918 | Ga0207662_10020600 | Ga0207662_100206003 | 295 |
| 351 | 3300025922 | Ga0207646_10085831 | Ga0207646_100858312 | 295 |
| 352 | 3300025925 | Ga0207650_10028033 | Ga0207650_100280333 | 295 |
| 353 | 3300025926 | Ga0207659_10005742 | Ga0207659_100057425 | 295 |
| 354 | 3300025926 | Ga0207659_10014558 | Ga0207659_100145582 | 295 |
| 355 | 3300025926 | Ga0207659_10254611 | Ga0207659_102546112 | 295 |
| 356 | 3300025927 | Ga0207687_10003109 | Ga0207687_1000310911 | 295 |
| 357 | 3300025934 | Ga0207686_10000084 | Ga0207686_1000008476 | 295 |
| 358 | 3300025935 | Ga0207709_10000907 | Ga0207709_1000090720 | 295 |
| 359 | 3300025935 | Ga0207709_10049069 | Ga0207709_100490692 | 295 |
| 360 | 3300025936 | Ga0207670_10045451 | Ga0207670_100454511 | 295 |
| 361 | 3300025936 | Ga0207670_10117165 | Ga0207670_101171652 | 295 |
| 362 | 3300025937 | Ga0207669_10003396 | Ga0207669_100033963 | 295 |
| 363 | 3300025937 | Ga0207669_10062580 | Ga0207669_100625803 | 295 |
| 364 | 3300025938 | Ga0207704_10002137 | Ga0207704_100021379 | 295 |
| 365 | 3300025938 | Ga0207704_10003021 | Ga0207704_100030211 | 295 |
| 366 | 3300025939 | Ga0207665_10038437 | Ga0207665_100384372 | 295 |
| 367 | 3300025941 | Ga0207711_10195609 | Ga0207711_101956092 | 295 |
| 368 | 3300025942 | Ga0207689_10000775 | Ga0207689_100007751 | 295 |
| 369 | 3300025945 | Ga0207679_10173521 | Ga0207679_101735212 | 295 |
| 370 | 3300025960 | Ga0207651_10165121 | Ga0207651_101651212 | 295 |
| 371 | 3300025961 | Ga0207712_10020708 | Ga0207712_100207082 | 295 |
| 372 | 3300025972 | Ga0207668_10011273 | Ga0207668_100112734 | 295 |
| 373 | 3300025986 | Ga0207658_10294528 | Ga0207658_102945282 | 295 |
| 374 | 3300026023 | Ga0207677_10285085 | Ga0207677_102850852 | 295 |
| 375 | 3300026035 | Ga0207703_10316807 | Ga0207703_103168071 | 295 |
| 376 | 3300026075 | Ga0207708_10000049 | Ga0207708_1000004963 | 295 |
| 377 | 3300026075 | Ga0207708_10007913 | Ga0207708_100079134 | 295 |
| 378 | 3300026075 | Ga0207708_10027893 | Ga0207708_100278933 | 295 |
| 379 | 3300026089 | Ga0207648_10000161 | Ga0207648_1000016136 | 295 |
| 380 | 3300026089 | Ga0207648_10000685 | Ga0207648_1000068517 | 295 |
| 381 | 3300026116 | Ga0207674_10063890 | Ga0207674_100638902 | 295 |
| 382 | 3300026116 | Ga0207674_10120210 | Ga0207674_101202102 | 295 |
| 383 | 3300026118 | Ga0207675_100000176 | Ga0207675_10000017612 | 295 |
| 384 | 3300026118 | Ga0207675_100001627 | Ga0207675_1000016274 | 295 |
| 385 | 3300027907 | Ga0207428_10023773 | Ga0207428_100237732 | 295 |
| 386 | 3300027907 | Ga0207428_10028032 | Ga0207428_100280322 | 295 |
| 387 | 3300028380 | Ga0268265_10019951 | Ga0268265_100199514 | 295 |
| 388 | 3300028381 | Ga0268264_10132489 | Ga0268264_101324892 | 295 |
| 389 | 3300031251 | Ga0265327_10098126 | Ga0265327_100981261 | 295 |
| 390 | 3300031548 | Ga0307408_100014642 | Ga0307408_1000146423 | 295 |
| 391 | 3300031665 | Ga0316575_10001516 | Ga0316575_100015162 | 295 |
| 392 | 3300031691 | Ga0316579_10001580 | Ga0316579_100015807 | 295 |
| 393 | 3300031691 | Ga0316579_10008236 | Ga0316579_100082362 | 295 |
| 394 | 3300031727 | Ga0316576_10087459 | Ga0316576_100874592 | 295 |
| 395 | 3300031728 | Ga0316578_10001999 | Ga0316578_100019996 | 295 |
| 396 | 3300031728 | Ga0316578_10109446 | Ga0316578_101094462 | 295 |
| 397 | 3300031728 | Ga0316578_10159531 | Ga0316578_101595312 | 295 |
| 398 | 3300031731 | Ga0307405_10083559 | Ga0307405_100835592 | 295 |
| 399 | 3300031733 | Ga0316577_10016050 | Ga0316577_100160503 | 295 |
| 400 | 3300031733 | Ga0316577_10052487 | Ga0316577_100524872 | 295 |
| 401 | 3300031901 | Ga0307406_10092107 | Ga0307406_100921071 | 295 |
| 402 | 3300031911 | Ga0307412_10048384 | Ga0307412_100483843 | 295 |
| 403 | 3300031995 | Ga0307409_100282776 | Ga0307409_1002827761 | 295 |
| 404 | 3300031995 | Ga0307409_100436890 | Ga0307409_1004368902 | 295 |
| 405 | 3300032002 | Ga0307416_100006774 | Ga0307416_1000067744 | 295 |
| 406 | 3300032002 | Ga0307416_100151523 | Ga0307416_1001515232 | 295 |
| 407 | 3300032005 | Ga0307411_10011806 | Ga0307411_100118063 | 295 |
| 408 | 3300032005 | Ga0307411_10161194 | Ga0307411_101611942 | 295 |
| 409 | 3300032005 | Ga0307411_10296216 | Ga0307411_102962162 | 295 |
| 410 | 3300032133 | Ga0316583_10001066 | Ga0316583_100010666 | 295 |
| 411 | 3300032133 | Ga0316583_10015240 | Ga0316583_100152402 | 295 |
| 412 | 3300032133 | Ga0316583_10030788 | Ga0316583_100307882 | 295 |
| 413 | 3300032168 | Ga0316593_10002825 | Ga0316593_100028254 | 295 |
| 414 | 3300035398 | Ga0316574_0025058 | Ga0316574_0025058_798_1721 | 295 |
| 415 | 3300035398 | Ga0316574_0167093 | Ga0316574_0167093_182_1078 | 295 |
| 416 | 3300035695 | Ga0373927_0004693 | Ga0373927_0004693_484_1401 | 295 |
| 417 | 3300036647 | Ga0316582_0111367 | Ga0316582_0111367_399_1322 | 295 |
| 418 | 3300036647 | Ga0316582_0148580 | Ga0316582_0148580_273_1214 | 295 |
| 419 | 3300036712 | Ga0316584_0031988 | Ga0316584_0031988_224_1165 | 295 |
| 420 | 3300036712 | Ga0316584_0161087 | Ga0316584_0161087_516_1439 | 295 |
| 421 | 3300041408 | Ga0439453_0000865 | Ga0439453_0000865_1089_1988 | 295 |
| 422 | 3300041999 | Ga0439433_0009624 | Ga0439433_0009624_925_1824 | 295 |
| 423 | 3300042122 | Ga0450920_000110 | Ga0450920_000110_8528_9427 | 295 |
| 424 | 3300042125 | Ga0450923_000591 | Ga0450923_000591_1398_2297 | 295 |
| 425 | 3300042131 | Ga0450894_002633 | Ga0450894_002633_345_1244 | 295 |
| 426 | 3300042134 | Ga0450898_000237 | Ga0450898_000237_4820_5719 | 295 |
| 427 | 3300042145 | Ga0450906_005635 | Ga0450906_005635_1010_1909 | 295 |
| 428 | 3300042146 | Ga0450907_019164 | Ga0450907_019164_131_1030 | 295 |
| 429 | 3300042147 | Ga0450910_003509 | Ga0450910_003509_292_1191 | 295 |
| 430 | 3300042156 | Ga0439446_0002077 | Ga0439446_0002077_3079_3978 | 295 |
| 431 | 3300042436 | Ga0439435_0000394 | Ga0439435_0000394_2518_3417 | 295 |
| 432 | 3300042437 | Ga0439444_0000160 | Ga0439444_0000160_1024_1923 | 295 |
| 433 | 3300042461 | Ga0439460_0002399 | Ga0439460_0002399_2613_3512 | 295 |
| 434 | 3300042530 | Ga0450916_007895 | Ga0450916_007895_301_1200 | 295 |
| 435 | 3300042531 | Ga0450918_002623 | Ga0450918_002623_844_1743 | 295 |
| 436 | 3300042876 | Ga0451577_0000071 | Ga0451577_0000071_15259_16149 | 295 |
| 437 | 3300042876 | Ga0451577_0249359 | Ga0451577_0249359_661_1551 | 295 |
| 438 | 3300044712 | Ga0453684_0000537 | Ga0453684_0000537_140207_141097 | 295 |
| 439 | 3300044712 | Ga0453684_0115550 | Ga0453684_0115550_774_1664 | 295 |
| 440 | 3300044712 | Ga0453684_0193002 | Ga0453684_0193002_534_1424 | 295 |
| 441 | 3300045051 | Ga0451576_0000217 | Ga0451576_0000217_92639_93529 | 295 |
| 442 | 3300045051 | Ga0451576_0188958 | Ga0451576_0188958_1130_2020 | 295 |
| 443 | 3300046539 | Ga0495621_0062333 | Ga0495621_0062333_140_1057 | 295 |
| 444 | 3300048905 | Ga0496102_0165113 | Ga0496102_0165113_838_1803 | 295 |
| 445 | 3300049568 | Ga0501031_0019378 | Ga0501031_0019378_1274_2263 | 295 |
| 446 | 3300049572 | Ga0501036_0042686 | Ga0501036_0042686_2194_3093 | 295 |
| 447 | 3300049573 | Ga0501037_0066120 | Ga0501037_0066120_75_974 | 295 |
| 448 | 3300049574 | Ga0501038_0003652 | Ga0501038_0003652_571_1527 | 295 |
| 449 | 3300049574 | Ga0501038_0148251 | Ga0501038_0148251_85_984 | 295 |
| 450 | 3300049574 | Ga0501038_0176266 | Ga0501038_0176266_696_1595 | 295 |
| 451 | 3300049575 | Ga0501039_0062889 | Ga0501039_0062889_1850_2767 | 295 |
| 452 | 3300049576 | Ga0501040_0028480 | Ga0501040_0028480_716_1633 | 295 |
| 453 | 3300049576 | Ga0501040_0040177 | Ga0501040_0040177_1378_2277 | 295 |
| 454 | 3300049576 | Ga0501040_0233824 | Ga0501040_0233824_158_1057 | 295 |
| 455 | 3300049577 | Ga0501041_0006644 | Ga0501041_0006644_5261_6160 | 295 |
| 456 | 3300049577 | Ga0501041_0026044 | Ga0501041_0026044_768_1685 | 295 |
| 457 | 3300049577 | Ga0501041_0150407 | Ga0501041_0150407_94_993 | 295 |
| 458 | 3300049578 | Ga0501042_0068128 | Ga0501042_0068128_939_1856 | 295 |
| 459 | 3300049578 | Ga0501042_0073672 | Ga0501042_0073672_1168_2067 | 295 |
| 460 | 3300049578 | Ga0501042_0207865 | Ga0501042_0207865_76_975 | 295 |
| 461 | 3300049579 | Ga0501043_0212082 | Ga0501043_0212082_260_1159 | 295 |
| 462 | 3300049580 | Ga0501046_0045909 | Ga0501046_0045909_816_1715 | 295 |
| 463 | 3300049582 | Ga0501048_0178273 | Ga0501048_0178273_117_1034 | 295 |
| 464 | 3300049584 | Ga0501068_0076595 | Ga0501068_0076595_258_1157 | 295 |
| 465 | 3300049584 | Ga0501068_0202072 | Ga0501068_0202072_238_1137 | 295 |
| 466 | 3300049585 | Ga0501069_0066608 | Ga0501069_0066608_213_1112 | 295 |
| 467 | 3300049587 | Ga0501071_0007357 | Ga0501071_0007357_5859_6758 | 295 |
| 468 | 3300049587 | Ga0501071_0033865 | Ga0501071_0033865_1003_1902 | 295 |
| 469 | 3300049587 | Ga0501071_0049039 | Ga0501071_0049039_2129_3028 | 295 |
| 470 | 3300049588 | Ga0501072_0027819 | Ga0501072_0027819_921_1820 | 295 |
| 471 | 3300049588 | Ga0501072_0264708 | Ga0501072_0264708_334_1233 | 295 |
| 472 | 3300049589 | Ga0501073_0002463 | Ga0501073_0002463_10171_11070 | 295 |
| 473 | 3300049591 | Ga0501075_0020429 | Ga0501075_0020429_301_1200 | 295 |
| 474 | 3300049591 | Ga0501075_0104559 | Ga0501075_0104559_572_1471 | 295 |
| 475 | 3300049592 | Ga0501076_0101622 | Ga0501076_0101622_1385_2284 | 295 |
| 476 | 3300049593 | Ga0501077_0002116 | Ga0501077_0002116_863_1762 | 295 |
| 477 | 3300049741 | Ga0501079_0166823 | Ga0501079_0166823_464_1363 | 295 |
| 478 | 3300049741 | Ga0501079_0172039 | Ga0501079_0172039_124_1023 | 295 |
| 479 | 3300049742 | Ga0501080_0004833 | Ga0501080_0004833_6751_7650 | 295 |
| 480 | 3300049742 | Ga0501080_0179319 | Ga0501080_0179319_448_1347 | 295 |
| 481 | 3300049743 | Ga0501081_0009584 | Ga0501081_0009584_4781_5680 | 295 |
| 482 | 3300049743 | Ga0501081_0064701 | Ga0501081_0064701_217_1116 | 295 |
| 483 | 3300049822 | Ga0501035_0185186 | Ga0501035_0185186_78_977 | 295 |
| 484 | 3300049823 | Ga0501044_0045596 | Ga0501044_0045596_2820_3809 | 295 |
| 485 | 3300049824 | Ga0501045_0062927 | Ga0501045_0062927_1716_2615 | 295 |
| 486 | 3300049824 | Ga0501045_0201612 | Ga0501045_0201612_568_1467 | 295 |
| 487 | 3300049824 | Ga0501045_0319791 | Ga0501045_0319791_185_1096 | 295 |
| 488 | 3300050508 | nmdc:mga09592_117642_c1 | nmdc:mga09592_117642_c1_525_1436 | 295 |
| 489 | 3300050508 | nmdc:mga09592_77022_c1 | nmdc:mga09592_77022_c1_715_1632 | 295 |
| 490 | 3300050509 | nmdc:mga0qj67_143552_c1 | nmdc:mga0qj67_143552_c1_862_1779 | 295 |
| 491 | 3300050509 | nmdc:mga0qj67_360_c1 | nmdc:mga0qj67_360_c1_1664_2575 | 295 |
| 492 | 3300050509 | nmdc:mga0qj67_386637_c1 | nmdc:mga0qj67_386637_c1_168_1079 | 295 |
| 493 | 3300050510 | nmdc:mga06r32_192035_c1 | nmdc:mga06r32_192035_c1_937_1848 | 295 |
| 494 | 3300050510 | nmdc:mga06r32_264289_c1 | nmdc:mga06r32_264289_c1_653_1564 | 295 |
| 495 | 3300050511 | nmdc:mga08y16_109867_c1 | nmdc:mga08y16_109867_c1_341_1252 | 295 |
| 496 | 3300050511 | nmdc:mga08y16_15235_c1 | nmdc:mga08y16_15235_c1_4886_5797 | 295 |
| 497 | 3300050511 | nmdc:mga08y16_37268_c1 | nmdc:mga08y16_37268_c1_2058_2975 | 295 |
| 498 | 3300050512 | nmdc:mga0n895_6386_c1 | nmdc:mga0n895_6386_c1_8576_9475 | 295 |
| 499 | 3300050513 | nmdc:mga0rr50_4092_c1 | nmdc:mga0rr50_4092_c1_3304_4203 | 295 |
| 500 | 3300050514 | nmdc:mga08x19_47094_c1 | nmdc:mga08x19_47094_c1_1757_2674 | 295 |
| 501 | 3300050515 | nmdc:mga0a205_13158_c1 | nmdc:mga0a205_13158_c1_1905_2804 | 295 |
| 502 | 3300054114 | Ga0501084_0021886 | Ga0501084_0021886_1519_2418 | 295 |
| 503 | 3300054114 | Ga0501084_0026938 | Ga0501084_0026938_2402_3301 | 295 |
| 504 | 3300060353 | Ga0501082_0003857 | Ga0501082_0003857_6142_7041 | 295 |
| 505 | 3300060353 | Ga0501082_0207889 | Ga0501082_0207889_667_1566 | 295 |
| 506 | 3300061734 | Ga0530510_0339582 | Ga0530510_0339582_42_941 | 295 |
| 507 | 3300005331 | Ga0070670_100068420 | Ga0070670_1000684203 | 296 |
| 508 | 3300005345 | Ga0070692_10040114 | Ga0070692_100401142 | 296 |
| 509 | 3300005441 | Ga0070700_100000705 | Ga0070700_10000070514 | 296 |
| 510 | 3300005545 | Ga0070695_100102368 | Ga0070695_1001023682 | 296 |
| 511 | 3300005546 | Ga0070696_100118951 | Ga0070696_1001189512 | 296 |
| 512 | 3300005617 | Ga0068859_100262650 | Ga0068859_1002626502 | 296 |
| 513 | 3300006931 | Ga0097620_100262646 | Ga0097620_1002626462 | 296 |
| 514 | 3300009093 | Ga0105240_10006007 | Ga0105240_100060074 | 296 |
| 515 | 3300025913 | Ga0207695_10043211 | Ga0207695_100432114 | 296 |
| 516 | 3300031665 | Ga0316575_10036209 | Ga0316575_100362092 | 296 |
| 517 | 3300031691 | Ga0316579_10077111 | Ga0316579_100771112 | 296 |
| 518 | 3300031727 | Ga0316576_10008864 | Ga0316576_100088644 | 296 |
| 519 | 3300031727 | Ga0316576_10209952 | Ga0316576_102099522 | 296 |
| 520 | 3300031728 | Ga0316578_10020422 | Ga0316578_100204222 | 296 |
| 521 | 3300031733 | Ga0316577_10014282 | Ga0316577_100142824 | 296 |
| 522 | 3300031733 | Ga0316577_10031697 | Ga0316577_100316972 | 296 |
| 523 | 3300031733 | Ga0316577_10053887 | Ga0316577_100538872 | 296 |
| 524 | 3300031733 | Ga0316577_10115910 | Ga0316577_101159102 | 296 |
| 525 | 3300032133 | Ga0316583_10008776 | Ga0316583_100087761 | 296 |
| 526 | 3300032133 | Ga0316583_10081129 | Ga0316583_100811291 | 296 |
| 527 | 3300032137 | Ga0316585_10009731 | Ga0316585_100097313 | 296 |
| 528 | 3300032139 | Ga0316580_10020218 | Ga0316580_100202182 | 296 |
| 529 | 3300032168 | Ga0316593_10002881 | Ga0316593_100028812 | 296 |
| 530 | 3300035398 | Ga0316574_0002385 | Ga0316574_0002385_4559_5473 | 296 |
| 531 | 3300035398 | Ga0316574_0002874 | Ga0316574_0002874_2065_2964 | 296 |
| 532 | 3300035398 | Ga0316574_0028738 | Ga0316574_0028738_2048_2995 | 296 |
| 533 | 3300035398 | Ga0316574_0187481 | Ga0316574_0187481_114_1013 | 296 |
| 534 | 3300036647 | Ga0316582_0007784 | Ga0316582_0007784_721_1623 | 296 |
| 535 | 3300036647 | Ga0316582_0019293 | Ga0316582_0019293_1074_2021 | 296 |
| 536 | 3300036647 | Ga0316582_0027003 | Ga0316582_0027003_1440_2342 | 296 |
| 537 | 3300036647 | Ga0316582_0039999 | Ga0316582_0039999_979_1887 | 296 |
| 538 | 3300036647 | Ga0316582_0184910 | Ga0316582_0184910_223_1125 | 296 |
| 539 | 3300036712 | Ga0316584_0003275 | Ga0316584_0003275_5385_6332 | 296 |
| 540 | 3300036712 | Ga0316584_0010804 | Ga0316584_0010804_4890_5792 | 296 |
| 541 | 3300036712 | Ga0316584_0012319 | Ga0316584_0012319_4907_5806 | 296 |
| 542 | 3300036712 | Ga0316584_0016764 | Ga0316584_0016764_3896_4795 | 296 |
| 543 | 3300037588 | Ga0316581_0000808 | Ga0316581_0000808_4041_4940 | 296 |
| 544 | 3300044712 | Ga0453684_0001268 | Ga0453684_0001268_19147_20073 | 296 |
| 545 | 3300049568 | Ga0501031_0033825 | Ga0501031_0033825_1906_2940 | 296 |
| 546 | 3300049569 | Ga0501032_0001200 | Ga0501032_0001200_13568_14587 | 296 |
| 547 | 3300049571 | Ga0501034_0008488 | Ga0501034_0008488_1577_2551 | 296 |
| 548 | 3300049571 | Ga0501034_0009000 | Ga0501034_0009000_2651_3580 | 296 |
| 549 | 3300049571 | Ga0501034_0084666 | Ga0501034_0084666_1915_2844 | 296 |
| 550 | 3300049574 | Ga0501038_0175769 | Ga0501038_0175769_168_1202 | 296 |
| 551 | 3300049580 | Ga0501046_0134212 | Ga0501046_0134212_778_1812 | 296 |
| 552 | 3300049584 | Ga0501068_0000767 | Ga0501068_0000767_2207_3136 | 296 |
| 553 | 3300049586 | Ga0501070_0110702 | Ga0501070_0110702_654_1583 | 296 |
| 554 | 3300049588 | Ga0501072_0000279 | Ga0501072_0000279_33482_34411 | 296 |
| 555 | 3300049589 | Ga0501073_0023099 | Ga0501073_0023099_1976_2905 | 296 |
| 556 | 3300049742 | Ga0501080_0000762 | Ga0501080_0000762_1485_2414 | 296 |
| 557 | 3300054114 | Ga0501084_0043239 | Ga0501084_0043239_2767_3696 | 296 |
| 558 | 3300060353 | Ga0501082_0069873 | Ga0501082_0069873_1505_2434 | 296 |
| 559 | 3300005564 | Ga0070664_100557376 | Ga0070664_1005573761 | 297 |
| 560 | 3300005614 | Ga0068856_100031048 | Ga0068856_1000310485 | 297 |
| 561 | 3300006195 | Ga0075366_10064545 | Ga0075366_100645453 | 297 |
| 562 | 3300013297 | Ga0157378_10464226 | Ga0157378_104642261 | 297 |
| 563 | 3300013308 | Ga0157375_10120164 | Ga0157375_101201642 | 297 |
| 564 | 3300048904 | Ga0496101_0084845 | Ga0496101_0084845_969_1937 | 297 |
| 565 | 3300048911 | Ga0496108_0062533 | Ga0496108_0062533_749_1717 | 297 |
| 566 | 3300048911 | Ga0496108_0206956 | Ga0496108_0206956_647_1627 | 297 |
| 567 | 3300048912 | Ga0496109_0248166 | Ga0496109_0248166_80_1060 | 297 |
| 568 | 3300049822 | Ga0501035_0150267 | Ga0501035_0150267_533_1573 | 297 |
| 569 | 3300005614 | Ga0068856_100435235 | Ga0068856_1004352351 | 298 |
| 570 | 3300006846 | Ga0075430_100005026 | Ga0075430_1000050268 | 298 |
| 571 | 3300006847 | Ga0075431_100035341 | Ga0075431_1000353414 | 298 |
| 572 | 3300032005 | Ga0307411_10345751 | Ga0307411_103457511 | 298 |
| 573 | 3300032126 | Ga0307415_100113001 | Ga0307415_1001130012 | 298 |
| 574 | 3300037418 | Ga0395900_0115098 | Ga0395900_0115098_1182_2168 | 298 |
| 575 | 3300049569 | Ga0501032_0058320 | Ga0501032_0058320_740_1789 | 298 |
| 576 | 3300049572 | Ga0501036_0000718 | Ga0501036_0000718_15812_16861 | 298 |
| 577 | 3300049574 | Ga0501038_0004503 | Ga0501038_0004503_3542_4591 | 298 |
| 578 | 3300049574 | Ga0501038_0016271 | Ga0501038_0016271_1590_2618 | 298 |
| 579 | 3300049579 | Ga0501043_0014939 | Ga0501043_0014939_2357_3406 | 298 |
| 580 | 3300049822 | Ga0501035_0001470 | Ga0501035_0001470_12123_13172 | 298 |
| 581 | 3300049823 | Ga0501044_0000700 | Ga0501044_0000700_5894_6943 | 298 |
| 582 | 3300049823 | Ga0501044_0146252 | Ga0501044_0146252_564_1610 | 298 |
| 583 | iso_pu_bacteria | 2582581279 | 2585147403 | 298 |
| 584 | 3300005327 | Ga0070658_10035065 | Ga0070658_100350654 | 299 |
| 585 | 3300025921 | Ga0207652_10145235 | Ga0207652_101452352 | 299 |
| 586 | 3300049581 | Ga0501047_0000478 | Ga0501047_0000478_25004_25903 | 299 |
| 587 | 3300006195 | Ga0075366_10018719 | Ga0075366_100187193 | 301 |
| 588 | 3300046512 | Ga0495610_0001778 | Ga0495610_0001778_5857_6762 | 301 |
| 589 | 3300046518 | Ga0495631_0003596 | Ga0495631_0003596_2642_3547 | 301 |
| 590 | 3300046524 | Ga0495648_0001177 | Ga0495648_0001177_21035_21961 | 301 |
| 591 | 3300047469 | Ga0495673_0001249 | Ga0495673_0001249_1629_2534 | 301 |
| 592 | 3300047472 | Ga0495686_0001819 | Ga0495686_0001819_6587_7492 | 301 |
| 593 | 3300049459 | Ga0495678_002267 | Ga0495678_002267_12382_13302 | 301 |
| 594 | 3300050493 | nmdc:mga0k408_93752_c1 | nmdc:mga0k408_93752_c1_165_1070 | 301 |
| 595 | 3300053086 | Ga0500578_0000023 | Ga0500578_0000023_150182_151087 | 301 |
| 596 | 3300053088 | Ga0500644_0000174 | Ga0500644_0000174_19719_20624 | 301 |
| 597 | 3300053118 | Ga0500594_0000416 | Ga0500594_0000416_2685_3605 | 301 |
| 598 | 3300003790 | Ga0055528_1012294 | Ga0055528_10122942 | 302 |
| 599 | 3300025263 | Ga0209565_1000118 | Ga0209565_100011840 | 302 |
| 600 | 3300025273 | Ga0209673_1005966 | Ga0209673_10059663 | 302 |
| 601 | 3300025291 | Ga0209675_1011319 | Ga0209675_10113192 | 302 |
| 602 | 3300025295 | Ga0209564_1028479 | Ga0209564_10284793 | 302 |
| 603 | 3300025297 | Ga0209758_1003035 | Ga0209758_10030356 | 302 |
| 604 | 3300025299 | Ga0209256_1004006 | Ga0209256_10040067 | 302 |
| 605 | 3300028794 | Ga0307515_10030334 | Ga0307515_100303345 | 302 |
| 606 | 3300028794 | Ga0307515_10144953 | Ga0307515_101449532 | 302 |
| 607 | 3300028800 | Ga0265338_10008351 | Ga0265338_100083518 | 302 |
| 608 | 3300046457 | Ga0495590_0001780 | Ga0495590_0001780_1485_2393 | 302 |
| 609 | 3300046460 | Ga0495638_0000892 | Ga0495638_0000892_5455_6363 | 302 |
| 610 | 3300046460 | Ga0495638_0008830 | Ga0495638_0008830_5954_6862 | 302 |
| 611 | 3300046512 | Ga0495610_0000407 | Ga0495610_0000407_9963_10871 | 302 |
| 612 | 3300046616 | Ga0495668_0010032 | Ga0495668_0010032_3456_4364 | 302 |
| 613 | 3300047472 | Ga0495686_0005522 | Ga0495686_0005522_4895_5803 | 302 |
| 614 | 3300053102 | Ga0500554_003204 | Ga0500554_003204_216_1127 | 302 |
| 615 | 3300053108 | Ga0500562_000505 | Ga0500562_000505_6149_7057 | 302 |
| 616 | 3300053134 | Ga0500658_0003039 | Ga0500658_0003039_1661_2575 | 302 |
| 617 | 3300053138 | Ga0500564_000227 | Ga0500564_000227_14640_15569 | 302 |
| 618 | 3300053156 | Ga0500622_0002375 | Ga0500622_0002375_12684_13592 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9619 | 12 | 300 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9602 | 11 | 302 |
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.9536 | 13 | 301 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9284 | 11 | 302 |
| 2gqu-assembly1.cif.gz_A | crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus | 0.9208 | 9 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9814 | 216 | 302 | 3.90.78.10 |
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9705 | 216 | 302 | 3.90.78.10 |
| 4pytA01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9484 | 12 | 80 | 3.30.43.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9407 | 87 | 215 | 3.30.465.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9337 | 87 | 215 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RQ90-F1-model_v4 | UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) | 0.9967 | 7 | 282 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A536EYE7-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.989 | 2 | 302 |
GO:0005506
GO:0005507 GO:0005737 GO:0008360 GO:0008762 GO:0009252 GO:0030151 GO:0043885 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A3N5RV35-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9882 | 223 | 300 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A840FG60-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.988 | 8 | 300 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A0S8A7P8-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9871 | 198 | 302 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar