F469747

General Info

Members Datasets Scaffolds Average Seq Length
618 303 615 303

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100199410|Ga0307416_1001994102
Length 352
Sequence MSGEFRYAAGTARADRGFRAASAVRRQRLFHTTHPFELRAPVADVLRGELRRDEPMSRHVSWRAGGSVDRAYWPADLADLQAFLRTLAAGEPVYFVGLGSNLLVRDAGLRGTVVFTHWALRNLSLVRSDGSEGLVSADVGVASPKVARFAALHDLGGAEFLAGIPGTIGGALAMNAGCYGGETWNVVREVTTIDRRGHLRCRTLADYHIAYRTVLLRTGHSGAALRSSTDFDEWFVSALLAFPRGEGAQARQKIRELLAKRIASQPLGEPNAGSVFRNPTGAYAARLIEDCGLKGRAIGGALISPKHANFIVNTGTATAADIEGLIELAQTAVRHKFGVDLEREVRIIGEPR

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
3 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
182 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
183 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
197 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
198 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
199 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
200 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
201 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
202 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
203 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
208 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
209 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
210 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.32
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0
Rhizoplane 1.46
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055528_1012294 3300003790 Bacteria 3333
2 Ga0070658_10035065 3300005327 Bacteria 4039
3 Ga0070658_10102091 3300005327 Bacteria 2371
4 Ga0070683_100012665 3300005329 Bacteria 7334
5 Ga0070690_100000076 3300005330 Bacteria 48076
6 Ga0070690_100025287 3300005330 Bacteria 3656
7 Ga0070690_100115885 3300005330 Bacteria 1793
8 Ga0070670_100027026 3300005331 Bacteria 4936
9 Ga0070670_100062463 3300005331 Bacteria 3198
10 Ga0070670_100068420 3300005331 Bacteria 3048
11 Ga0070670_100149502 3300005331 Bacteria 2021
12 Ga0068869_100001183 3300005334 Bacteria 15316
13 Ga0070680_100215823 3300005336 Bacteria 1619
14 Ga0070682_100099701 3300005337 Bacteria 1916
15 Ga0070682_100101595 3300005337 Bacteria 1899
16 Ga0068868_100020949 3300005338 Bacteria 4921
17 Ga0070689_100057420 3300005340 Bacteria 3021
18 Ga0070691_10009987 3300005341 Bacteria 4325
19 Ga0070692_10009953 3300005345 Bacteria 4308
20 Ga0070692_10040114 3300005345 Bacteria 2393
21 Ga0070692_10048341 3300005345 Bacteria 2204
22 Ga0070668_100021585 3300005347 Bacteria 4865
23 Ga0070669_100474669 3300005353 Bacteria 1034
24 Ga0070675_100008831 3300005354 Bacteria 7831
25 Ga0070675_100032974 3300005354 Bacteria 4195
26 Ga0070675_100043292 3300005354 Bacteria 3679
27 Ga0070675_100121825 3300005354 Bacteria 2216
28 Ga0070671_100014257 3300005355 Bacteria 6418
29 Ga0070674_100033003 3300005356 Bacteria 3442
30 Ga0070674_100068374 3300005356 Bacteria 2502
31 Ga0070673_100023681 3300005364 Bacteria 4490
32 Ga0070673_100024005 3300005364 Bacteria 4463
33 Ga0070673_100238362 3300005364 Bacteria 1580
34 Ga0070673_100429253 3300005364 Bacteria 1186
35 Ga0070688_100032478 3300005365 Bacteria 3147
36 Ga0070688_100133370 3300005365 Bacteria 1679
37 Ga0070667_100119626 3300005367 Bacteria 2290
38 Ga0070667_100122397 3300005367 Bacteria 2264
39 Ga0070710_10202560 3300005437 Bacteria 1254
40 Ga0070705_100017235 3300005440 Bacteria 3767
41 Ga0070705_100075661 3300005440 Bacteria 2050
42 Ga0070700_100000705 3300005441 Bacteria 16467
43 Ga0070700_100002345 3300005441 Bacteria 9640
44 Ga0070700_100045966 3300005441 Bacteria 2695
45 Ga0070700_100083418 3300005441 Bacteria 2069
46 Ga0070694_100139802 3300005444 Bacteria 1757
47 Ga0070708_100063688 3300005445 Bacteria 3301
48 Ga0070678_100018527 3300005456 Bacteria 4514
49 Ga0070678_100193976 3300005456 Bacteria 1672
50 Ga0070681_10015927 3300005458 Bacteria 7497
51 Ga0068867_100001930 3300005459 Bacteria 14446
52 Ga0068867_100394950 3300005459 Bacteria 1165
53 Ga0070685_10140292 3300005466 Bacteria 1521
54 Ga0070706_100030901 3300005467 Bacteria 4937
55 Ga0070706_100045752 3300005467 Bacteria 4041
56 Ga0070707_100044998 3300005468 Bacteria 4225
57 Ga0070707_100271266 3300005468 Bacteria 1649
58 Ga0070679_100101483 3300005530 Bacteria 2864
59 Ga0070684_100118465 3300005535 Bacteria 2380
60 Ga0070697_100070303 3300005536 Bacteria 2869
61 Ga0070672_100019521 3300005543 Bacteria 4921
62 Ga0070672_100048035 3300005543 Bacteria 3314
63 Ga0070672_100311018 3300005543 Bacteria 1337
64 Ga0070686_100000265 3300005544 Bacteria 35750
65 Ga0070686_100130774 3300005544 Bacteria 1735
66 Ga0070695_100073553 3300005545 Bacteria 2244
67 Ga0070695_100102368 3300005545 Bacteria 1931
68 Ga0070696_100003280 3300005546 Bacteria 10798
69 Ga0070696_100118951 3300005546 Bacteria 1910
70 Ga0070696_100131444 3300005546 Bacteria 1821
71 Ga0070693_100002947 3300005547 Bacteria 7870
72 Ga0070693_100139513 3300005547 Bacteria 1524
73 Ga0070665_100431051 3300005548 Bacteria 1327
74 Ga0070704_100033256 3300005549 Bacteria 3484
75 Ga0070704_100077445 3300005549 Bacteria 2436
76 Ga0070704_100094529 3300005549 Bacteria 2236
77 Ga0068855_100178181 3300005563 Bacteria 2404
78 Ga0070664_100013378 3300005564 Bacteria 6684
79 Ga0070664_100557376 3300005564 Bacteria 1060
80 Ga0068857_100021288 3300005577 Bacteria 5708
81 Ga0068857_100310186 3300005577 Bacteria 1455
82 Ga0068854_100011816 3300005578 Bacteria 5701
83 Ga0068856_100031048 3300005614 Bacteria 5226
84 Ga0068856_100111428 3300005614 Bacteria 2734
85 Ga0068856_100435235 3300005614 Bacteria 1332
86 Ga0068856_100603926 3300005614 Unclassified 1118
87 Ga0070702_100000223 3300005615 Bacteria 19138
88 Ga0070702_100019642 3300005615 Bacteria 3529
89 Ga0070702_100223467 3300005615 Bacteria 1261
90 Ga0068852_100028714 3300005616 Bacteria 4558
91 Ga0068859_100262650 3300005617 Bacteria 1818
92 Ga0068864_100103489 3300005618 Bacteria 2528
93 Ga0068864_100117562 3300005618 Bacteria 2373
94 Ga0068866_10004753 3300005718 Bacteria 5572
95 Ga0068866_10077607 3300005718 Bacteria 1774
96 Ga0068861_100008407 3300005719 Bacteria 7106
97 Ga0068861_100041588 3300005719 Bacteria 3443
98 Ga0068870_10001641 3300005840 Bacteria 9131
99 Ga0068870_10089532 3300005840 Bacteria 1718
100 Ga0068863_100149228 3300005841 Bacteria 2237
101 Ga0068858_100011872 3300005842 Bacteria 8210
102 Ga0068858_100103666 3300005842 Bacteria 2654
103 Ga0068860_100004675 3300005843 Bacteria 13979
104 Ga0068860_100256154 3300005843 Bacteria 1705
105 Ga0068862_100021899 3300005844 Bacteria 5344
106 Ga0068862_100033885 3300005844 Bacteria 4320
107 Ga0075365_10018477 3300006038 Bacteria 4288
108 Ga0075364_10001278 3300006051 Bacteria 13546
109 Ga0075366_10018719 3300006195 Bacteria 4000
110 Ga0075366_10064545 3300006195 Bacteria 2177
111 Ga0097621_100010998 3300006237 Bacteria 6648
112 Ga0097621_100028581 3300006237 Bacteria 4395
113 Ga0068871_100021904 3300006358 Bacteria 4921
114 Ga0075428_100002171 3300006844 Bacteria 21224
115 Ga0075428_100025570 3300006844 Bacteria 6536
116 Ga0075428_100167105 3300006844 Bacteria 2386
117 Ga0075428_100671135 3300006844 Bacteria 1105
118 Ga0075430_100003777 3300006846 Bacteria 12727
119 Ga0075430_100005026 3300006846 Bacteria 11132
120 Ga0075430_100040114 3300006846 Bacteria 3963
121 Ga0075430_100438995 3300006846 Bacteria 1077
122 Ga0075431_100035341 3300006847 Bacteria 5144
123 Ga0075431_100087601 3300006847 Bacteria 3213
124 Ga0075431_100137356 3300006847 Bacteria 2521
125 Ga0075433_10004587 3300006852 Bacteria 10778
126 Ga0075433_10019169 3300006852 Bacteria 5694
127 Ga0075434_100003639 3300006871 Bacteria 13765
128 Ga0075434_100004275 3300006871 Bacteria 12815
129 Ga0075429_100001915 3300006880 Bacteria 17264
130 Ga0068865_100008518 3300006881 Bacteria 6340
131 Ga0075436_100012672 3300006914 Bacteria 5778
132 Ga0097620_100262646 3300006931 Bacteria 1818
133 Ga0075435_100001061 3300007076 Bacteria 17462
134 Ga0075435_100004540 3300007076 Bacteria 9543
135 Ga0075435_100133649 3300007076 Bacteria 2077
136 Ga0105240_10006007 3300009093 Bacteria 17950
137 Ga0105240_10081963 3300009093 Bacteria 3963
138 Ga0111539_10000086 3300009094 Bacteria 95435
139 Ga0111539_10013931 3300009094 Bacteria 10052
140 Ga0111539_10018745 3300009094 Bacteria 8566
141 Ga0111539_10160775 3300009094 Bacteria 2627
142 Ga0105245_10259015 3300009098 Bacteria 1692
143 Ga0114129_10023925 3300009147 Bacteria 8656
144 Ga0114129_10101196 3300009147 Bacteria 3987
145 Ga0105243_10001212 3300009148 Bacteria 23228
146 Ga0105243_10001642 3300009148 Bacteria 19442
147 Ga0105243_10066704 3300009148 Bacteria 2895
148 Ga0105241_10028848 3300009174 Bacteria 4135
149 Ga0105242_10012243 3300009176 Bacteria 6602
150 Ga0105242_10049194 3300009176 Bacteria 3430
151 Ga0105248_10000708 3300009177 Bacteria 37708
152 Ga0105248_10154918 3300009177 Bacteria 2586
153 Ga0105248_10183810 3300009177 Bacteria 2356
154 Ga0105248_10231822 3300009177 Bacteria 2079
155 Ga0105237_10182942 3300009545 Bacteria 2096
156 Ga0105238_10387186 3300009551 Bacteria 1390
157 Ga0105249_10009025 3300009553 Bacteria 8714
158 Ga0105239_10041689 3300010375 Bacteria 5030
159 Ga0105239_10185672 3300010375 Bacteria 2327
160 Ga0157373_10355026 3300013100 Bacteria 1046
161 Ga0157370_10031088 3300013104 Bacteria 5226
162 Ga0157374_10066870 3300013296 Bacteria 3378
163 Ga0157378_10003052 3300013297 Bacteria 14881
164 Ga0157378_10017616 3300013297 Bacteria 6271
165 Ga0157378_10098287 3300013297 Bacteria 2669
166 Ga0157378_10464226 3300013297 Bacteria 1259
167 Ga0163162_10102026 3300013306 Bacteria 2962
168 Ga0157375_10120164 3300013308 Bacteria 2736
169 Ga0157375_10164114 3300013308 Bacteria 2365
170 Ga0157375_10374040 3300013308 Bacteria 1591
171 Ga0157380_10000239 3300014326 Bacteria 33002
172 Ga0157380_10002571 3300014326 Bacteria 12263
173 Ga0157380_10023775 3300014326 Bacteria 4627
174 Ga0157380_10091646 3300014326 Bacteria 2509
175 Ga0157377_10019158 3300014745 Bacteria 3573
176 Ga0157377_10113491 3300014745 Bacteria 1632
177 Ga0157379_10009289 3300014968 Bacteria 8562
178 Ga0157379_10228899 3300014968 Bacteria 1685
179 Ga0157376_10017293 3300014969 Bacteria 5494
180 Ga0157376_10278826 3300014969 Bacteria 1573
181 Ga0209565_1000118 3300025263 Bacteria 113196
182 Ga0209673_1005966 3300025273 Bacteria 5997
183 Ga0209675_1011319 3300025291 Bacteria 2967
184 Ga0209564_1028479 3300025295 Bacteria 1785
185 Ga0209758_1003035 3300025297 Bacteria 15994
186 Ga0209256_1004006 3300025299 Bacteria 9641
187 Ga0207682_10001431 3300025893 Bacteria 11015
188 Ga0207692_10161134 3300025898 Bacteria 1293
189 Ga0207642_10001872 3300025899 Bacteria 6486
190 Ga0207642_10015483 3300025899 Bacteria 2843
191 Ga0207642_10154562 3300025899 Bacteria 1225
192 Ga0207688_10172229 3300025901 Bacteria 1287
193 Ga0207645_10013350 3300025907 Bacteria 5538
194 Ga0207645_10038280 3300025907 Bacteria 3076
195 Ga0207645_10131657 3300025907 Unclassified 1628
196 Ga0207643_10005300 3300025908 Bacteria 6901
197 Ga0207643_10009949 3300025908 Bacteria 5110
198 Ga0207643_10063874 3300025908 Bacteria 2106
199 Ga0207695_10043211 3300025913 Bacteria 4804
200 Ga0207671_10037932 3300025914 Bacteria 3572
201 Ga0207660_10014287 3300025917 Bacteria 5218
202 Ga0207660_10189609 3300025917 Bacteria 1600
203 Ga0207662_10020600 3300025918 Bacteria 3763
204 Ga0207649_10296882 3300025920 Unclassified 1180
205 Ga0207652_10145235 3300025921 Bacteria 2123
206 Ga0207646_10085831 3300025922 Bacteria 2815
207 Ga0207646_10217100 3300025922 Bacteria 1728
208 Ga0207681_10114150 3300025923 Bacteria 1970
209 Ga0207650_10028033 3300025925 Bacteria 4035
210 Ga0207650_10043232 3300025925 Bacteria 3306
211 Ga0207659_10005742 3300025926 Bacteria 7557
212 Ga0207659_10014558 3300025926 Bacteria 5078
213 Ga0207659_10022463 3300025926 Bacteria 4200
214 Ga0207659_10254611 3300025926 Bacteria 1426
215 Ga0207687_10003109 3300025927 Bacteria 11254
216 Ga0207644_10015784 3300025931 Bacteria 5077
217 Ga0207706_10005160 3300025933 Bacteria 12189
218 Ga0207686_10000084 3300025934 Bacteria 79402
219 Ga0207709_10000907 3300025935 Bacteria 22294
220 Ga0207709_10037283 3300025935 Bacteria 2888
221 Ga0207709_10049069 3300025935 Bacteria 2575
222 Ga0207670_10045451 3300025936 Bacteria 2911
223 Ga0207670_10117165 3300025936 Bacteria 1930
224 Ga0207669_10003396 3300025937 Bacteria 6885
225 Ga0207669_10062580 3300025937 Bacteria 2293
226 Ga0207669_10257834 3300025937 Bacteria 1302
227 Ga0207669_10498724 3300025937 Bacteria 974
228 Ga0207704_10002137 3300025938 Bacteria 8864
229 Ga0207704_10003021 3300025938 Bacteria 7608
230 Ga0207665_10038437 3300025939 Bacteria 3187
231 Ga0207691_10004579 3300025940 Bacteria 13389
232 Ga0207691_10075807 3300025940 Bacteria 3032
233 Ga0207711_10000275 3300025941 Bacteria 55533
234 Ga0207711_10195609 3300025941 Bacteria 1844
235 Ga0207689_10000775 3300025942 Bacteria 30666
236 Ga0207689_10003287 3300025942 Bacteria 14814
237 Ga0207679_10173521 3300025945 Bacteria 1777
238 Ga0207679_10450745 3300025945 Bacteria 1141
239 Ga0207667_10294144 3300025949 Bacteria 1659
240 Ga0207651_10015342 3300025960 Bacteria 4450
241 Ga0207651_10165121 3300025960 Bacteria 1740
242 Ga0207712_10020708 3300025961 Bacteria 4310
243 Ga0207668_10011273 3300025972 Bacteria 5426
244 Ga0207658_10294528 3300025986 Bacteria 1396
245 Ga0207677_10027935 3300026023 Bacteria 3562
246 Ga0207677_10285085 3300026023 Bacteria 1357
247 Ga0207703_10135966 3300026035 Bacteria 2128
248 Ga0207703_10316807 3300026035 Bacteria 1427
249 Ga0207708_10000049 3300026075 Bacteria 114743
250 Ga0207708_10007913 3300026075 Bacteria 7880
251 Ga0207708_10027893 3300026075 Bacteria 4275
252 Ga0207702_10038243 3300026078 Bacteria 4019
253 Ga0207641_10079123 3300026088 Bacteria 2849
254 Ga0207641_10114174 3300026088 Bacteria 2399
255 Ga0207641_10119036 3300026088 Bacteria 2353
256 Ga0207641_10146334 3300026088 Bacteria 2137
257 Ga0207648_10000161 3300026089 Bacteria 69095
258 Ga0207648_10000685 3300026089 Bacteria 37956
259 Ga0207648_10080379 3300026089 Bacteria 2844
260 Ga0207676_10029498 3300026095 Bacteria 4109
261 Ga0207676_10072396 3300026095 Bacteria 2770
262 Ga0207676_10154865 3300026095 Bacteria 1978
263 Ga0207674_10063890 3300026116 Bacteria 3714
264 Ga0207674_10120210 3300026116 Bacteria 2595
265 Ga0207675_100000176 3300026118 Bacteria 57464
266 Ga0207675_100001627 3300026118 Bacteria 22493
267 Ga0207675_100060162 3300026118 Bacteria 3546
268 Ga0207675_100089106 3300026118 Bacteria 2899
269 Ga0207683_10021380 3300026121 Bacteria 5539
270 Ga0207683_10067076 3300026121 Bacteria 3165
271 Ga0209969_1001703 3300027360 Bacteria 3033
272 Ga0209967_1013482 3300027364 Bacteria 1160
273 Ga0209995_1006296 3300027471 Bacteria 1907
274 Ga0209983_1007102 3300027665 Bacteria 2299
275 Ga0209974_10000936 3300027876 Bacteria 10190
276 Ga0207428_10002137 3300027907 Bacteria 19863
277 Ga0207428_10023773 3300027907 Bacteria 5148
278 Ga0207428_10028032 3300027907 Bacteria 4682
279 Ga0207428_10078762 3300027907 Bacteria 2578
280 Ga0207428_10118734 3300027907 Bacteria 2029
281 Ga0268265_10019951 3300028380 Bacteria 4669
282 Ga0268264_10103536 3300028381 Bacteria 2479
283 Ga0268264_10132489 3300028381 Bacteria 2212
284 Ga0265318_10012165 3300028577 Unclassified 3672
285 Ga0307515_10030334 3300028794 Bacteria 9086
286 Ga0307515_10144953 3300028794 Bacteria 2522
287 Ga0265338_10008351 3300028800 Bacteria 12591
288 Ga0265332_10001273 3300031238 Bacteria 14416
289 Ga0265320_10026713 3300031240 Bacteria 3018
290 Ga0265325_10001423 3300031241 Bacteria 16843
291 Ga0265331_10011560 3300031250 Unclassified 4829
292 Ga0265327_10098126 3300031251 Unclassified 1418
293 Ga0265316_10016456 3300031344 Bacteria 6412
294 Ga0265316_10069578 3300031344 Bacteria 2716
295 Ga0307408_100014642 3300031548 Bacteria 5210
296 Ga0316575_10001516 3300031665 Bacteria 7512
297 Ga0316575_10036209 3300031665 Unclassified 1941
298 Ga0316579_10001580 3300031691 Bacteria 8310
299 Ga0316579_10008236 3300031691 Bacteria 4339
300 Ga0316579_10077111 3300031691 Bacteria 1584
301 Ga0265314_10055950 3300031711 Bacteria 2718
302 Ga0265314_10067021 3300031711 Bacteria 2420
303 Ga0265342_10009110 3300031712 Bacteria 7033
304 Ga0265342_10089153 3300031712 Bacteria 1770
305 Ga0316576_10002899 3300031727 Bacteria 9906
306 Ga0316576_10008864 3300031727 Bacteria 6454
307 Ga0316576_10087459 3300031727 Bacteria 2319
308 Ga0316576_10100552 3300031727 Bacteria 2161
309 Ga0316576_10209952 3300031727 Unclassified 1466
310 Ga0316576_10232041 3300031727 Bacteria 1387
311 Ga0316578_10001999 3300031728 Bacteria 8666
312 Ga0316578_10020422 3300031728 Bacteria 3660
313 Ga0316578_10109446 3300031728 Bacteria 1659
314 Ga0316578_10159531 3300031728 Bacteria 1359
315 Ga0307405_10083559 3300031731 Bacteria 2093
316 Ga0316577_10014282 3300031733 Bacteria 4358
317 Ga0316577_10016050 3300031733 Bacteria 4123
318 Ga0316577_10031697 3300031733 Bacteria 2953
319 Ga0316577_10052487 3300031733 Bacteria 2275
320 Ga0316577_10053887 3300031733 Bacteria 2245
321 Ga0316577_10115910 3300031733 Bacteria 1504
322 Ga0307406_10092107 3300031901 Bacteria 2043
323 Ga0307412_10048384 3300031911 Bacteria 2796
324 Ga0307409_100200714 3300031995 Bacteria 1784
325 Ga0307409_100282776 3300031995 Bacteria 1534
326 Ga0307409_100436890 3300031995 Bacteria 1260
327 Ga0307416_100006774 3300032002 Bacteria 7203
328 Ga0307416_100151523 3300032002 Bacteria 2127
329 Ga0307416_100199410 3300032002 Bacteria 1897
330 Ga0307411_10011806 3300032005 Bacteria 4734
331 Ga0307411_10161194 3300032005 Bacteria 1680
332 Ga0307411_10296216 3300032005 Bacteria 1295
333 Ga0307411_10328667 3300032005 Bacteria 1238
334 Ga0307411_10345751 3300032005 Bacteria 1210
335 Ga0307415_100113001 3300032126 Bacteria 2019
336 Ga0307415_100149195 3300032126 Bacteria 1797
337 Ga0316583_10001066 3300032133 Bacteria 8894
338 Ga0316583_10004374 3300032133 Bacteria 5039
339 Ga0316583_10008776 3300032133 Bacteria 3647
340 Ga0316583_10015240 3300032133 Bacteria 2766
341 Ga0316583_10030788 3300032133 Bacteria 1910
342 Ga0316583_10081129 3300032133 Bacteria 1133
343 Ga0316585_10009731 3300032137 Unclassified 2813
344 Ga0316580_10020218 3300032139 Bacteria 2050
345 Ga0316593_10002825 3300032168 Bacteria 4203
346 Ga0316593_10002881 3300032168 Bacteria 4175
347 Ga0373923_0013566 3300035111 Bacteria 3040
348 Ga0373923_0138226 3300035111 Unclassified 1100
349 Ga0373953_0007906 3300035117 Bacteria 3586
350 Ga0373956_0012993 3300035119 Bacteria 3460
351 Ga0373956_0025548 3300035119 Unclassified 2554
352 Ga0373955_0031365 3300035172 Bacteria 2783
353 Ga0316574_0002385 3300035398 Bacteria 9403
354 Ga0316574_0002874 3300035398 Bacteria 8753
355 Ga0316574_0025058 3300035398 Bacteria 3577
356 Ga0316574_0026162 3300035398 Bacteria 3508
357 Ga0316574_0028738 3300035398 Bacteria 3355
358 Ga0316574_0074536 3300035398 Bacteria 2148
359 Ga0316574_0167093 3300035398 Bacteria 1417
360 Ga0316574_0187481 3300035398 Bacteria 1330
361 Ga0316574_0214679 3300035398 Bacteria 1234
362 Ga0373924_0019685 3300035410 Bacteria 2616
363 Ga0373927_0004693 3300035695 Bacteria 9529
364 Ga0373933_0015584 3300035724 Bacteria 4238
365 Ga0373937_0000668 3300036401 Bacteria 29873
366 Ga0373937_0009654 3300036401 Bacteria 8403
367 Ga0316582_0007784 3300036647 Bacteria 5726
368 Ga0316582_0019293 3300036647 Bacteria 3988
369 Ga0316582_0027003 3300036647 Bacteria 3462
370 Ga0316582_0039999 3300036647 Bacteria 2923
371 Ga0316582_0111367 3300036647 Bacteria 1822
372 Ga0316582_0148580 3300036647 Bacteria 1583
373 Ga0316582_0184910 3300036647 Bacteria 1418
374 Ga0316582_0242418 3300036647 Bacteria 1235
375 Ga0316584_0003275 3300036712 Bacteria 10479
376 Ga0316584_0010804 3300036712 Bacteria 6394
377 Ga0316584_0012319 3300036712 Bacteria 6028
378 Ga0316584_0016764 3300036712 Bacteria 5256
379 Ga0316584_0031988 3300036712 Bacteria 3892
380 Ga0316584_0134158 3300036712 Bacteria 1849
381 Ga0316584_0161087 3300036712 Bacteria 1667
382 Ga0395900_0115098 3300037418 Bacteria 2760
383 Ga0316581_0000808 3300037588 Bacteria 6505
384 Ga0400484_37647 3300038725 Bacteria 17784
385 Ga0400490_32525 3300038726 Bacteria 20877
386 Ga0400490_38419 3300038726 Bacteria 9426
387 Ga0400490_43208 3300038726 Bacteria 40847
388 Ga0400490_55439 3300038726 Bacteria 3460
389 Ga0400485_09840 3300038735 Bacteria 7784
390 Ga0400485_10846 3300038735 Bacteria 1138
391 Ga0400488_07274 3300038741 Bacteria 3041
392 Ga0400488_41421 3300038741 Bacteria 5384
393 Ga0400488_48288 3300038741 Bacteria 12907
394 Ga0400486_02595 3300038742 Bacteria 12059
395 Ga0400486_20354 3300038742 Bacteria 2759
396 Ga0400489_07775 3300039093 Bacteria 14176
397 Ga0400487_25647 3300039110 Bacteria 4526
398 Ga0400487_25849 3300039110 Bacteria 10824
399 Ga0400487_57417 3300039110 Bacteria 26138
400 Ga0400487_61740 3300039110 Bacteria 26986
401 Ga0439453_0000865 3300041408 Bacteria 3612
402 Ga0451853_2575282 3300041512 Bacteria 1399
403 Ga0439433_0009624 3300041999 Bacteria 2109
404 Ga0439441_003981 3300042001 Bacteria 2213
405 Ga0450920_000110 3300042122 Bacteria 10927
406 Ga0450923_000591 3300042125 Bacteria 4140
407 Ga0450894_002633 3300042131 Bacteria 2390
408 Ga0450898_000237 3300042134 Bacteria 6024
409 Ga0450906_005635 3300042145 Bacteria 2562
410 Ga0450907_019164 3300042146 Bacteria 1147
411 Ga0450910_003509 3300042147 Bacteria 2083
412 Ga0439446_0002077 3300042156 Bacteria 4759
413 Ga0439434_0071387 3300042435 Bacteria 1093
414 Ga0439435_0000394 3300042436 Bacteria 6765
415 Ga0439444_0000160 3300042437 Bacteria 6043
416 Ga0439460_0002399 3300042461 Bacteria 4516
417 Ga0450916_007895 3300042530 Bacteria 1285
418 Ga0450918_002623 3300042531 Bacteria 3394
419 Ga0451577_0000071 3300042876 Bacteria 238560
420 Ga0451577_0065607 3300042876 Bacteria 3238
421 Ga0451577_0249359 3300042876 Bacteria 1607
422 Ga0453684_0000537 3300044712 Bacteria 144017
423 Ga0453684_0001268 3300044712 Bacteria 75704
424 Ga0453684_0002379 3300044712 Bacteria 45928
425 Ga0453684_0115550 3300044712 Bacteria 3251
426 Ga0453684_0193002 3300044712 Bacteria 2381
427 Ga0453684_0249949 3300044712 Bacteria 2037
428 Ga0451576_0000217 3300045051 Bacteria 142222
429 Ga0451576_0147652 3300045051 Bacteria 2452
430 Ga0451576_0188958 3300045051 Bacteria 2151
431 Ga0451576_0336463 3300045051 Bacteria 1580
432 Ga0495590_0001780 3300046457 Bacteria 9143
433 Ga0495638_0000892 3300046460 Bacteria 30611
434 Ga0495638_0008830 3300046460 Bacteria 7117
435 Ga0495605_0048452 3300046474 Bacteria 2080
436 Ga0495610_0000407 3300046512 Bacteria 44093
437 Ga0495610_0001778 3300046512 Bacteria 18835
438 Ga0495628_0257321 3300046516 Bacteria 1302
439 Ga0495631_0003596 3300046518 Bacteria 8455
440 Ga0495644_0142771 3300046523 Bacteria 915
441 Ga0495648_0001177 3300046524 Bacteria 26427
442 Ga0495642_0069074 3300046528 Bacteria 1475
443 Ga0495598_0002296 3300046537 Bacteria 3933
444 Ga0495621_0062333 3300046539 Bacteria 1357
445 Ga0495668_0010032 3300046616 Bacteria 5765
446 Ga0495669_0023691 3300046684 Bacteria 2674
447 Ga0495674_0158518 3300047319 Bacteria 1895
448 Ga0495680_0064527 3300047322 Bacteria 2808
449 Ga0495673_0001249 3300047469 Bacteria 21005
450 Ga0495686_0001819 3300047472 Bacteria 21511
451 Ga0495686_0005522 3300047472 Bacteria 9949
452 Ga0496101_0084845 3300048904 Bacteria 2346
453 Ga0496102_0165113 3300048905 Bacteria 2083
454 Ga0496106_0088640 3300048909 Bacteria 2385
455 Ga0496106_0160068 3300048909 Bacteria 1780
456 Ga0496108_0062533 3300048911 Bacteria 3135
457 Ga0496108_0206956 3300048911 Bacteria 1703
458 Ga0496109_0248166 3300048912 Bacteria 1676
459 Ga0496109_0367633 3300048912 Unclassified 1359
460 Ga0496111_0172291 3300048914 Bacteria 1608
461 Ga0495678_002267 3300049459 Bacteria 13345
462 Ga0501031_0019378 3300049568 Bacteria 4433
463 Ga0501031_0033825 3300049568 Bacteria 3337
464 Ga0501032_0001200 3300049569 Bacteria 20717
465 Ga0501032_0058320 3300049569 Bacteria 2592
466 Ga0501033_0000188 3300049570 Bacteria 59295
467 Ga0501033_0003912 3300049570 Bacteria 12095
468 Ga0501033_0141060 3300049570 Bacteria 1742
469 Ga0501033_0233720 3300049570 Bacteria 1305
470 Ga0501034_0008488 3300049571 Bacteria 10849
471 Ga0501034_0009000 3300049571 Bacteria 10485
472 Ga0501034_0051333 3300049571 Bacteria 4159
473 Ga0501034_0084666 3300049571 Bacteria 3172
474 Ga0501036_0000718 3300049572 Bacteria 24523
475 Ga0501036_0001240 3300049572 Bacteria 19516
476 Ga0501036_0042686 3300049572 Bacteria 3839
477 Ga0501037_0010203 3300049573 Bacteria 6891
478 Ga0501037_0029768 3300049573 Bacteria 4034
479 Ga0501037_0066120 3300049573 Bacteria 2634
480 Ga0501037_0353728 3300049573 Bacteria 1013
481 Ga0501038_0003652 3300049574 Bacteria 14338
482 Ga0501038_0004503 3300049574 Bacteria 12960
483 Ga0501038_0007525 3300049574 Bacteria 10040
484 Ga0501038_0016271 3300049574 Bacteria 6744
485 Ga0501038_0083584 3300049574 Bacteria 2687
486 Ga0501038_0148251 3300049574 Bacteria 1914
487 Ga0501038_0175769 3300049574 Bacteria 1730
488 Ga0501038_0176266 3300049574 Bacteria 1728
489 Ga0501039_0002522 3300049575 Bacteria 13654
490 Ga0501039_0062889 3300049575 Bacteria 2876
491 Ga0501040_0001755 3300049576 Bacteria 13937
492 Ga0501040_0028480 3300049576 Bacteria 3766
493 Ga0501040_0040177 3300049576 Bacteria 3183
494 Ga0501040_0043196 3300049576 Bacteria 3072
495 Ga0501040_0105258 3300049576 Bacteria 1971
496 Ga0501040_0233824 3300049576 Bacteria 1309
497 Ga0501041_0000472 3300049577 Bacteria 20445
498 Ga0501041_0006644 3300049577 Bacteria 6774
499 Ga0501041_0026044 3300049577 Bacteria 3515
500 Ga0501041_0150407 3300049577 Bacteria 1453
501 Ga0501042_0001285 3300049578 Bacteria 14606
502 Ga0501042_0068128 3300049578 Bacteria 2544
503 Ga0501042_0073672 3300049578 Bacteria 2443
504 Ga0501042_0188964 3300049578 Bacteria 1486
505 Ga0501042_0207865 3300049578 Bacteria 1411
506 Ga0501043_0014939 3300049579 Bacteria 6080
507 Ga0501043_0032065 3300049579 Bacteria 4130
508 Ga0501043_0212082 3300049579 Bacteria 1501
509 Ga0501046_0001072 3300049580 Bacteria 26824
510 Ga0501046_0045909 3300049580 Bacteria 3468
511 Ga0501046_0134212 3300049580 Bacteria 1876
512 Ga0501046_0443344 3300049580 Bacteria 934
513 Ga0501047_0000478 3300049581 Bacteria 43581
514 Ga0501047_0129236 3300049581 Bacteria 2406
515 Ga0501048_0000076 3300049582 Bacteria 51144
516 Ga0501048_0178273 3300049582 Bacteria 1506
517 Ga0501068_0000767 3300049584 Bacteria 16533
518 Ga0501068_0004342 3300049584 Bacteria 7709
519 Ga0501068_0076595 3300049584 Bacteria 2047
520 Ga0501068_0202072 3300049584 Bacteria 1260
521 Ga0501069_0010284 3300049585 Bacteria 4953
522 Ga0501069_0066608 3300049585 Bacteria 2014
523 Ga0501070_0003106 3300049586 Bacteria 14461
524 Ga0501070_0007205 3300049586 Bacteria 9439
525 Ga0501070_0110702 3300049586 Bacteria 2269
526 Ga0501071_0007357 3300049587 Bacteria 7221
527 Ga0501071_0033865 3300049587 Bacteria 3632
528 Ga0501071_0049039 3300049587 Bacteria 3038
529 Ga0501071_0060117 3300049587 Bacteria 2750
530 Ga0501072_0000201 3300049588 Bacteria 43540
531 Ga0501072_0000279 3300049588 Bacteria 36892
532 Ga0501072_0027819 3300049588 Bacteria 4411
533 Ga0501072_0221329 3300049588 Bacteria 1508
534 Ga0501072_0264708 3300049588 Bacteria 1368
535 Ga0501073_0002463 3300049589 Bacteria 13830
536 Ga0501073_0023099 3300049589 Bacteria 4470
537 Ga0501073_0072600 3300049589 Bacteria 2397
538 Ga0501074_0184703 3300049590 Bacteria 1487
539 Ga0501075_0000544 3300049591 Bacteria 22874
540 Ga0501075_0020429 3300049591 Bacteria 4818
541 Ga0501075_0104559 3300049591 Bacteria 2152
542 Ga0501076_0002059 3300049592 Bacteria 13777
543 Ga0501076_0034768 3300049592 Bacteria 3941
544 Ga0501076_0101622 3300049592 Bacteria 2317
545 Ga0501077_0000940 3300049593 Bacteria 17566
546 Ga0501077_0002116 3300049593 Bacteria 11982
547 Ga0501209_008906 3300049656 Bacteria 2002
548 Ga0501079_0001239 3300049741 Bacteria 17879
549 Ga0501079_0166823 3300049741 Bacteria 1717
550 Ga0501079_0172039 3300049741 Bacteria 1689
551 Ga0501080_0000762 3300049742 Bacteria 26133
552 Ga0501080_0004833 3300049742 Bacteria 12017
553 Ga0501080_0023689 3300049742 Bacteria 5688
554 Ga0501080_0044112 3300049742 Bacteria 4151
555 Ga0501080_0077819 3300049742 Bacteria 3085
556 Ga0501080_0179319 3300049742 Bacteria 1950
557 Ga0501081_0002121 3300049743 Bacteria 12402
558 Ga0501081_0009584 3300049743 Bacteria 6314
559 Ga0501081_0064701 3300049743 Bacteria 2540
560 Ga0501083_0033937 3300049744 Bacteria 3491
561 Ga0501035_0001470 3300049822 Bacteria 24148
562 Ga0501035_0003336 3300049822 Bacteria 15379
563 Ga0501035_0150267 3300049822 Bacteria 2022
564 Ga0501035_0185186 3300049822 Bacteria 1792
565 Ga0501044_0000700 3300049823 Bacteria 40445
566 Ga0501044_0045596 3300049823 Bacteria 4542
567 Ga0501044_0074650 3300049823 Bacteria 3444
568 Ga0501044_0146252 3300049823 Bacteria 2348
569 Ga0501044_0309784 3300049823 Bacteria 1506
570 Ga0501045_0002586 3300049824 Bacteria 12350
571 Ga0501045_0062927 3300049824 Bacteria 2723
572 Ga0501045_0201612 3300049824 Bacteria 1482
573 Ga0501045_0319791 3300049824 Bacteria 1155
574 nmdc:mga00v17_1575_c1 3300050491 Bacteria 11912
575 nmdc:mga0yw44_392_c1 3300050492 Bacteria 4352
576 nmdc:mga0k408_93752_c1 3300050493 Bacteria 1765
577 nmdc:mga09592_117642_c1 3300050508 Bacteria 2281
578 nmdc:mga09592_1308_c1 3300050508 Bacteria 19998
579 nmdc:mga09592_77022_c1 3300050508 Bacteria 2837
580 nmdc:mga0qj67_143552_c1 3300050509 Bacteria 1936
581 nmdc:mga0qj67_360_c1 3300050509 Bacteria 31452
582 nmdc:mga0qj67_386637_c1 3300050509 Bacteria 1130
583 nmdc:mga06r32_192035_c1 3300050510 Bacteria 2029
584 nmdc:mga06r32_262486_c1 3300050510 Bacteria 1715
585 nmdc:mga06r32_264289_c1 3300050510 Bacteria 1708
586 nmdc:mga08y16_109867_c1 3300050511 Bacteria 2871
587 nmdc:mga08y16_111384_c1 3300050511 Bacteria 2849
588 nmdc:mga08y16_15235_c1 3300050511 Bacteria 8086
589 nmdc:mga08y16_37268_c1 3300050511 Bacteria 5108
590 nmdc:mga08y16_53073_c2 3300050511 Bacteria 3713
591 nmdc:mga08y16_55056_c1 3300050511 Bacteria 4158
592 nmdc:mga0n895_458_c1 3300050512 Bacteria 27351
593 nmdc:mga0n895_6386_c1 3300050512 Bacteria 10006
594 nmdc:mga0rr50_4092_c1 3300050513 Bacteria 8514
595 nmdc:mga08x19_47094_c1 3300050514 Bacteria 2759
596 nmdc:mga0a205_13158_c1 3300050515 Bacteria 7687
597 Ga0500578_0000023 3300053086 Bacteria 153470
598 Ga0500644_0000174 3300053088 Bacteria 41140
599 Ga0500554_003204 3300053102 Bacteria 3318
600 Ga0500562_000505 3300053108 Bacteria 9492
601 Ga0500594_0000416 3300053118 Bacteria 9441
602 Ga0500658_0003039 3300053134 Bacteria 6430
603 Ga0500564_000227 3300053138 Bacteria 15612
604 Ga0500622_0002375 3300053156 Bacteria 13641
605 Ga0501084_0011394 3300054114 Bacteria 7362
606 Ga0501084_0021886 3300054114 Bacteria 5332
607 Ga0501084_0026938 3300054114 Bacteria 4802
608 Ga0501084_0043239 3300054114 Bacteria 3769
609 Ga0501082_0003857 3300060353 Bacteria 13106
610 Ga0501082_0004025 3300060353 Bacteria 12826
611 Ga0501082_0069873 3300060353 Bacteria 3024
612 Ga0501082_0207889 3300060353 Bacteria 1703
613 Ga0501082_0674745 3300060353 Bacteria 904
614 Ga0530510_0003587 3300061734 Bacteria 10683
615 Ga0530510_0339582 3300061734 Bacteria 1127

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10355026 Ga0157373_103550262 224
2 3300047319 Ga0495674_0158518 Ga0495674_0158518_60_785 239
3 3300049588 Ga0501072_0221329 Ga0501072_0221329_20_757 244
4 3300049592 Ga0501076_0034768 Ga0501076_0034768_17_754 244
5 3300060353 Ga0501082_0674745 Ga0501082_0674745_151_888 244
6 3300046523 Ga0495644_0142771 Ga0495644_0142771_67_831 246
7 3300049823 Ga0501044_0309784 Ga0501044_0309784_746_1495 248
8 3300049578 Ga0501042_0188964 Ga0501042_0188964_165_941 254
9 3300049570 Ga0501033_0233720 Ga0501033_0233720_512_1291 258
10 3300049576 Ga0501040_0043196 Ga0501040_0043196_12_791 258
11 3300049742 Ga0501080_0044112 Ga0501080_0044112_17_796 258
12 3300035111 Ga0373923_0138226 Ga0373923_0138226_290_1090 259
13 3300009177 Ga0105248_10000708 Ga0105248_100007084 267
14 3300025941 Ga0207711_10000275 Ga0207711_100002754 267
15 3300010375 Ga0105239_10185672 Ga0105239_101856722 269
16 3300049580 Ga0501046_0443344 Ga0501046_0443344_28_846 271
17 3300009093 Ga0105240_10081963 Ga0105240_100819632 275
18 3300013104 Ga0157370_10031088 Ga0157370_100310885 275
19 3300049570 Ga0501033_0141060 Ga0501033_0141060_32_952 275
20 3300005364 Ga0070673_100429253 Ga0070673_1004292532 277
21 3300025937 Ga0207669_10498724 Ga0207669_104987241 277
22 3300025945 Ga0207679_10450745 Ga0207679_104507452 277
23 3300048909 Ga0496106_0088640 Ga0496106_0088640_1257_2129 277
24 3300005549 Ga0070704_100033256 Ga0070704_1000332562 278
25 3300041512 Ga0451853_2575282 Ga0451853_2575282_232_1119 278
26 3300039110 Ga0400487_57417 Ga0400487_57417_13610_14452 279
27 3300049590 Ga0501074_0184703 Ga0501074_0184703_629_1471 279
28 3300050510 nmdc:mga06r32_262486_c1 nmdc:mga06r32_262486_c1_34_936 279
29 3300049573 Ga0501037_0353728 Ga0501037_0353728_22_882 280
30 3300042435 Ga0439434_0071387 Ga0439434_0071387_17_874 284
31 3300046537 Ga0495598_0002296 Ga0495598_0002296_504_1382 285
32 3300049570 Ga0501033_0003912 Ga0501033_0003912_5251_6129 285
33 3300049571 Ga0501034_0051333 Ga0501034_0051333_14_892 285
34 3300049572 Ga0501036_0001240 Ga0501036_0001240_5960_6838 285
35 3300049573 Ga0501037_0010203 Ga0501037_0010203_1204_2082 285
36 3300049574 Ga0501038_0007525 Ga0501038_0007525_5070_5948 285
37 3300049575 Ga0501039_0002522 Ga0501039_0002522_8160_9038 285
38 3300049576 Ga0501040_0001755 Ga0501040_0001755_5963_6841 285
39 3300049576 Ga0501040_0105258 Ga0501040_0105258_1019_1897 285
40 3300049577 Ga0501041_0000472 Ga0501041_0000472_12586_13464 285
41 3300049578 Ga0501042_0001285 Ga0501042_0001285_1906_2784 285
42 3300049579 Ga0501043_0032065 Ga0501043_0032065_1840_2718 285
43 3300049580 Ga0501046_0001072 Ga0501046_0001072_1938_2816 285
44 3300049582 Ga0501048_0000076 Ga0501048_0000076_26259_27137 285
45 3300049584 Ga0501068_0004342 Ga0501068_0004342_1719_2597 285
46 3300049587 Ga0501071_0060117 Ga0501071_0060117_1291_2169 285
47 3300049588 Ga0501072_0000201 Ga0501072_0000201_3214_4092 285
48 3300049589 Ga0501073_0072600 Ga0501073_0072600_1174_2052 285
49 3300049591 Ga0501075_0000544 Ga0501075_0000544_7435_8313 285
50 3300049592 Ga0501076_0002059 Ga0501076_0002059_7431_8309 285
51 3300049593 Ga0501077_0000940 Ga0501077_0000940_12567_13445 285
52 3300049741 Ga0501079_0001239 Ga0501079_0001239_5792_6670 285
53 3300049742 Ga0501080_0023689 Ga0501080_0023689_4727_5605 285
54 3300049743 Ga0501081_0002121 Ga0501081_0002121_7432_8310 285
55 3300049744 Ga0501083_0033937 Ga0501083_0033937_1798_2676 285
56 3300049822 Ga0501035_0003336 Ga0501035_0003336_2296_3174 285
57 3300049824 Ga0501045_0002586 Ga0501045_0002586_5618_6496 285
58 3300054114 Ga0501084_0011394 Ga0501084_0011394_1374_2252 285
59 3300060353 Ga0501082_0004025 Ga0501082_0004025_3214_4092 285
60 3300061734 Ga0530510_0003587 Ga0530510_0003587_5084_5962 285
61 3300005330 Ga0070690_100025287 Ga0070690_1000252872 286
62 3300005331 Ga0070670_100149502 Ga0070670_1001495022 286
63 3300005354 Ga0070675_100121825 Ga0070675_1001218252 286
64 3300005356 Ga0070674_100033003 Ga0070674_1000330034 286
65 3300005364 Ga0070673_100238362 Ga0070673_1002383621 286
66 3300005365 Ga0070688_100032478 Ga0070688_1000324783 286
67 3300005367 Ga0070667_100119626 Ga0070667_1001196261 286
68 3300005440 Ga0070705_100075661 Ga0070705_1000756612 286
69 3300005458 Ga0070681_10015927 Ga0070681_100159276 286
70 3300005466 Ga0070685_10140292 Ga0070685_101402922 286
71 3300005467 Ga0070706_100030901 Ga0070706_1000309012 286
72 3300005468 Ga0070707_100044998 Ga0070707_1000449984 286
73 3300005543 Ga0070672_100311018 Ga0070672_1003110182 286
74 3300005544 Ga0070686_100130774 Ga0070686_1001307742 286
75 3300005546 Ga0070696_100003280 Ga0070696_1000032808 286
76 3300005546 Ga0070696_100131444 Ga0070696_1001314442 286
77 3300005547 Ga0070693_100139513 Ga0070693_1001395132 286
78 3300005548 Ga0070665_100431051 Ga0070665_1004310512 286
79 3300005563 Ga0068855_100178181 Ga0068855_1001781813 286
80 3300005614 Ga0068856_100111428 Ga0068856_1001114282 286
81 3300005615 Ga0070702_100223467 Ga0070702_1002234672 286
82 3300005618 Ga0068864_100103489 Ga0068864_1001034892 286
83 3300005618 Ga0068864_100117562 Ga0068864_1001175623 286
84 3300005718 Ga0068866_10004753 Ga0068866_100047532 286
85 3300005841 Ga0068863_100149228 Ga0068863_1001492282 286
86 3300005842 Ga0068858_100103666 Ga0068858_1001036662 286
87 3300006871 Ga0075434_100003639 Ga0075434_1000036394 286
88 3300007076 Ga0075435_100001061 Ga0075435_10000106110 286
89 3300009148 Ga0105243_10066704 Ga0105243_100667042 286
90 3300009176 Ga0105242_10049194 Ga0105242_100491943 286
91 3300009177 Ga0105248_10183810 Ga0105248_101838102 286
92 3300009177 Ga0105248_10231822 Ga0105248_102318221 286
93 3300013297 Ga0157378_10098287 Ga0157378_100982873 286
94 3300014745 Ga0157377_10113491 Ga0157377_101134911 286
95 3300014968 Ga0157379_10228899 Ga0157379_102288992 286
96 3300014969 Ga0157376_10278826 Ga0157376_102788262 286
97 3300025893 Ga0207682_10001431 Ga0207682_1000143110 286
98 3300025899 Ga0207642_10015483 Ga0207642_100154832 286
99 3300025901 Ga0207688_10172229 Ga0207688_101722291 286
100 3300025907 Ga0207645_10013350 Ga0207645_100133502 286
101 3300025908 Ga0207643_10009949 Ga0207643_100099495 286
102 3300025922 Ga0207646_10217100 Ga0207646_102171002 286
103 3300025923 Ga0207681_10114150 Ga0207681_101141501 286
104 3300025925 Ga0207650_10043232 Ga0207650_100432324 286
105 3300025933 Ga0207706_10005160 Ga0207706_1000516011 286
106 3300025935 Ga0207709_10037283 Ga0207709_100372833 286
107 3300025937 Ga0207669_10257834 Ga0207669_102578342 286
108 3300025940 Ga0207691_10075807 Ga0207691_100758072 286
109 3300025942 Ga0207689_10003287 Ga0207689_1000328710 286
110 3300025949 Ga0207667_10294144 Ga0207667_102941442 286
111 3300026035 Ga0207703_10135966 Ga0207703_101359662 286
112 3300026078 Ga0207702_10038243 Ga0207702_100382432 286
113 3300026088 Ga0207641_10079123 Ga0207641_100791232 286
114 3300026088 Ga0207641_10114174 Ga0207641_101141742 286
115 3300026088 Ga0207641_10119036 Ga0207641_101190363 286
116 3300026088 Ga0207641_10146334 Ga0207641_101463342 286
117 3300026089 Ga0207648_10080379 Ga0207648_100803792 286
118 3300026095 Ga0207676_10029498 Ga0207676_100294983 286
119 3300026095 Ga0207676_10072396 Ga0207676_100723963 286
120 3300026118 Ga0207675_100060162 Ga0207675_1000601623 286
121 3300026118 Ga0207675_100089106 Ga0207675_1000891062 286
122 3300026121 Ga0207683_10067076 Ga0207683_100670762 286
123 3300027907 Ga0207428_10078762 Ga0207428_100787622 286
124 3300027907 Ga0207428_10118734 Ga0207428_101187342 286
125 3300028381 Ga0268264_10103536 Ga0268264_101035362 286
126 3300031238 Ga0265332_10001273 Ga0265332_100012732 286
127 3300031240 Ga0265320_10026713 Ga0265320_100267131 286
128 3300031344 Ga0265316_10069578 Ga0265316_100695782 286
129 3300031711 Ga0265314_10055950 Ga0265314_100559502 286
130 3300031712 Ga0265342_10089153 Ga0265342_100891532 286
131 3300045051 Ga0451576_0336463 Ga0451576_0336463_239_1123 286
132 3300046474 Ga0495605_0048452 Ga0495605_0048452_317_1219 286
133 3300046528 Ga0495642_0069074 Ga0495642_0069074_60_962 286
134 3300046684 Ga0495669_0023691 Ga0495669_0023691_1664_2566 286
135 3300050511 nmdc:mga08y16_111384_c1 nmdc:mga08y16_111384_c1_1590_2492 286
136 3300050511 nmdc:mga08y16_53073_c2 nmdc:mga08y16_53073_c2_1808_2692 286
137 3300050512 nmdc:mga0n895_458_c1 nmdc:mga0n895_458_c1_2702_3586 286
138 3300005327 Ga0070658_10102091 Ga0070658_101020912 287
139 3300005329 Ga0070683_100012665 Ga0070683_1000126654 287
140 3300005331 Ga0070670_100027026 Ga0070670_1000270262 287
141 3300005338 Ga0068868_100020949 Ga0068868_1000209493 287
142 3300005354 Ga0070675_100032974 Ga0070675_1000329744 287
143 3300005355 Ga0070671_100014257 Ga0070671_1000142575 287
144 3300005364 Ga0070673_100023681 Ga0070673_1000236814 287
145 3300005367 Ga0070667_100122397 Ga0070667_1001223972 287
146 3300005456 Ga0070678_100018527 Ga0070678_1000185272 287
147 3300005535 Ga0070684_100118465 Ga0070684_1001184652 287
148 3300005543 Ga0070672_100019521 Ga0070672_1000195213 287
149 3300005564 Ga0070664_100013378 Ga0070664_1000133782 287
150 3300005578 Ga0068854_100011816 Ga0068854_1000118164 287
151 3300005614 Ga0068856_100603926 Ga0068856_1006039261 287
152 3300005616 Ga0068852_100028714 Ga0068852_1000287143 287
153 3300006237 Ga0097621_100028581 Ga0097621_1000285812 287
154 3300006358 Ga0068871_100021904 Ga0068871_1000219043 287
155 3300013296 Ga0157374_10066870 Ga0157374_100668702 287
156 3300013297 Ga0157378_10017616 Ga0157378_100176162 287
157 3300013306 Ga0163162_10102026 Ga0163162_101020262 287
158 3300013308 Ga0157375_10374040 Ga0157375_103740402 287
159 3300014969 Ga0157376_10017293 Ga0157376_100172935 287
160 3300025907 Ga0207645_10131657 Ga0207645_101316572 287
161 3300025920 Ga0207649_10296882 Ga0207649_102968822 287
162 3300025926 Ga0207659_10022463 Ga0207659_100224633 287
163 3300025931 Ga0207644_10015784 Ga0207644_100157842 287
164 3300025940 Ga0207691_10004579 Ga0207691_100045796 287
165 3300025960 Ga0207651_10015342 Ga0207651_100153424 287
166 3300026023 Ga0207677_10027935 Ga0207677_100279354 287
167 3300026095 Ga0207676_10154865 Ga0207676_101548652 287
168 3300026121 Ga0207683_10021380 Ga0207683_100213803 287
169 3300044712 Ga0453684_0002379 Ga0453684_0002379_44766_45650 287
170 3300048912 Ga0496109_0367633 Ga0496109_0367633_232_1188 287
171 3300048914 Ga0496111_0172291 Ga0496111_0172291_564_1520 287
172 3300027360 Ga0209969_1001703 Ga0209969_10017033 288
173 3300027364 Ga0209967_1013482 Ga0209967_10134822 288
174 3300027471 Ga0209995_1006296 Ga0209995_10062963 288
175 3300027665 Ga0209983_1007102 Ga0209983_10071022 288
176 3300027876 Ga0209974_10000936 Ga0209974_100009368 288
177 3300042001 Ga0439441_003981 Ga0439441_003981_1217_2134 288
178 3300005437 Ga0070710_10202560 Ga0070710_102025601 289
179 3300025898 Ga0207692_10161134 Ga0207692_101611342 289
180 3300031727 Ga0316576_10100552 Ga0316576_101005522 289
181 3300031995 Ga0307409_100200714 Ga0307409_1002007142 289
182 3300035111 Ga0373923_0013566 Ga0373923_0013566_1229_2119 289
183 3300035117 Ga0373953_0007906 Ga0373953_0007906_2274_3164 289
184 3300035119 Ga0373956_0012993 Ga0373956_0012993_2271_3161 289
185 3300035172 Ga0373955_0031365 Ga0373955_0031365_407_1297 289
186 3300035410 Ga0373924_0019685 Ga0373924_0019685_1205_2095 289
187 3300035724 Ga0373933_0015584 Ga0373933_0015584_2628_3518 289
188 3300036401 Ga0373937_0000668 Ga0373937_0000668_13762_14652 289
189 3300038726 Ga0400490_38419 Ga0400490_38419_4112_4999 289
190 3300046516 Ga0495628_0257321 Ga0495628_0257321_300_1190 289
191 3300047322 Ga0495680_0064527 Ga0495680_0064527_1114_2004 289
192 iso_pu_bacteria 2894510363 2894513959 289
193 3300028577 Ga0265318_10012165 Ga0265318_100121652 290
194 3300031250 Ga0265331_10011560 Ga0265331_100115603 290
195 3300031344 Ga0265316_10016456 Ga0265316_100164564 290
196 3300031712 Ga0265342_10009110 Ga0265342_100091105 290
197 3300032005 Ga0307411_10328667 Ga0307411_103286672 290
198 3300042876 Ga0451577_0065607 Ga0451577_0065607_847_1734 290
199 3300044712 Ga0453684_0249949 Ga0453684_0249949_921_1829 290
200 3300005337 Ga0070682_100099701 Ga0070682_1000997012 291
201 3300006038 Ga0075365_10018477 Ga0075365_100184773 291
202 3300006051 Ga0075364_10001278 Ga0075364_100012783 291
203 3300048909 Ga0496106_0160068 Ga0496106_0160068_225_1271 291
204 3300050491 nmdc:mga00v17_1575_c1 nmdc:mga00v17_1575_c1_2676_3557 291
205 3300050492 nmdc:mga0yw44_392_c1 nmdc:mga0yw44_392_c1_2415_3296 291
206 3300005843 Ga0068860_100256154 Ga0068860_1002561542 292
207 3300006844 Ga0075428_100002171 Ga0075428_10000217117 292
208 3300006880 Ga0075429_100001915 Ga0075429_1000019158 292
209 3300009094 Ga0111539_10000086 Ga0111539_1000008670 292
210 3300027907 Ga0207428_10002137 Ga0207428_100021373 292
211 3300031711 Ga0265314_10067021 Ga0265314_100670212 292
212 3300035119 Ga0373956_0025548 Ga0373956_0025548_1545_2450 292
213 3300036401 Ga0373937_0009654 Ga0373937_0009654_1453_2358 292
214 3300045051 Ga0451576_0147652 Ga0451576_0147652_770_1717 292
215 3300049656 Ga0501209_008906 Ga0501209_008906_587_1510 292
216 3300050508 nmdc:mga09592_1308_c1 nmdc:mga09592_1308_c1_14348_15274 292
217 3300050511 nmdc:mga08y16_55056_c1 nmdc:mga08y16_55056_c1_1087_2013 292
218 iso_pu_bacteria 2989392574 2989395994 292
219 3300031241 Ga0265325_10001423 Ga0265325_1000142313 293
220 3300032133 Ga0316583_10004374 Ga0316583_100043743 293
221 3300035398 Ga0316574_0026162 Ga0316574_0026162_1693_2574 293
222 3300035398 Ga0316574_0214679 Ga0316574_0214679_194_1078 293
223 3300036647 Ga0316582_0242418 Ga0316582_0242418_25_906 293
224 3300038725 Ga0400484_37647 Ga0400484_37647_13538_14437 293
225 3300038726 Ga0400490_32525 Ga0400490_32525_6480_7379 293
226 3300038726 Ga0400490_43208 Ga0400490_43208_26912_27811 293
227 3300038726 Ga0400490_55439 Ga0400490_55439_1195_2094 293
228 3300038735 Ga0400485_09840 Ga0400485_09840_1706_2605 293
229 3300038735 Ga0400485_10846 Ga0400485_10846_35_934 293
230 3300038741 Ga0400488_07274 Ga0400488_07274_334_1233 293
231 3300038741 Ga0400488_41421 Ga0400488_41421_3650_4549 293
232 3300038741 Ga0400488_48288 Ga0400488_48288_10499_11398 293
233 3300038742 Ga0400486_02595 Ga0400486_02595_4855_5754 293
234 3300038742 Ga0400486_20354 Ga0400486_20354_446_1345 293
235 3300039093 Ga0400489_07775 Ga0400489_07775_6302_7201 293
236 3300039110 Ga0400487_25647 Ga0400487_25647_2282_3181 293
237 3300039110 Ga0400487_25849 Ga0400487_25849_4306_5205 293
238 3300039110 Ga0400487_61740 Ga0400487_61740_13092_13991 293
239 3300005330 Ga0070690_100115885 Ga0070690_1001158852 294
240 3300005840 Ga0068870_10089532 Ga0068870_100895322 294
241 3300031727 Ga0316576_10002899 Ga0316576_100028997 294
242 3300031727 Ga0316576_10232041 Ga0316576_102320412 294
243 3300032002 Ga0307416_100199410 Ga0307416_1001994102 294
244 3300032126 Ga0307415_100149195 Ga0307415_1001491952 294
245 3300035398 Ga0316574_0074536 Ga0316574_0074536_476_1432 294
246 3300036712 Ga0316584_0134158 Ga0316584_0134158_156_1109 294
247 3300049570 Ga0501033_0000188 Ga0501033_0000188_19274_20305 294
248 3300049573 Ga0501037_0029768 Ga0501037_0029768_711_1742 294
249 3300049574 Ga0501038_0083584 Ga0501038_0083584_952_1983 294
250 3300049581 Ga0501047_0129236 Ga0501047_0129236_470_1501 294
251 3300049585 Ga0501069_0010284 Ga0501069_0010284_3956_4930 294
252 3300049586 Ga0501070_0003106 Ga0501070_0003106_9189_10163 294
253 3300049586 Ga0501070_0007205 Ga0501070_0007205_6436_7410 294
254 3300049742 Ga0501080_0077819 Ga0501080_0077819_191_1165 294
255 3300049823 Ga0501044_0074650 Ga0501044_0074650_1477_2508 294
256 3300005330 Ga0070690_100000076 Ga0070690_10000007648 295
257 3300005331 Ga0070670_100062463 Ga0070670_1000624633 295
258 3300005334 Ga0068869_100001183 Ga0068869_1000011831 295
259 3300005336 Ga0070680_100215823 Ga0070680_1002158232 295
260 3300005337 Ga0070682_100101595 Ga0070682_1001015952 295
261 3300005340 Ga0070689_100057420 Ga0070689_1000574203 295
262 3300005341 Ga0070691_10009987 Ga0070691_100099872 295
263 3300005345 Ga0070692_10009953 Ga0070692_100099535 295
264 3300005345 Ga0070692_10048341 Ga0070692_100483413 295
265 3300005347 Ga0070668_100021585 Ga0070668_1000215853 295
266 3300005353 Ga0070669_100474669 Ga0070669_1004746691 295
267 3300005354 Ga0070675_100008831 Ga0070675_1000088314 295
268 3300005354 Ga0070675_100043292 Ga0070675_1000432922 295
269 3300005356 Ga0070674_100068374 Ga0070674_1000683742 295
270 3300005364 Ga0070673_100024005 Ga0070673_1000240053 295
271 3300005365 Ga0070688_100133370 Ga0070688_1001333702 295
272 3300005440 Ga0070705_100017235 Ga0070705_1000172352 295
273 3300005441 Ga0070700_100002345 Ga0070700_1000023452 295
274 3300005441 Ga0070700_100045966 Ga0070700_1000459663 295
275 3300005441 Ga0070700_100083418 Ga0070700_1000834182 295
276 3300005444 Ga0070694_100139802 Ga0070694_1001398022 295
277 3300005445 Ga0070708_100063688 Ga0070708_1000636881 295
278 3300005456 Ga0070678_100193976 Ga0070678_1001939762 295
279 3300005459 Ga0068867_100001930 Ga0068867_1000019302 295
280 3300005459 Ga0068867_100394950 Ga0068867_1003949501 295
281 3300005467 Ga0070706_100045752 Ga0070706_1000457522 295
282 3300005468 Ga0070707_100271266 Ga0070707_1002712662 295
283 3300005530 Ga0070679_100101483 Ga0070679_1001014831 295
284 3300005536 Ga0070697_100070303 Ga0070697_1000703032 295
285 3300005543 Ga0070672_100048035 Ga0070672_1000480352 295
286 3300005544 Ga0070686_100000265 Ga0070686_10000026539 295
287 3300005545 Ga0070695_100073553 Ga0070695_1000735532 295
288 3300005547 Ga0070693_100002947 Ga0070693_1000029479 295
289 3300005549 Ga0070704_100077445 Ga0070704_1000774452 295
290 3300005549 Ga0070704_100094529 Ga0070704_1000945291 295
291 3300005577 Ga0068857_100021288 Ga0068857_1000212884 295
292 3300005577 Ga0068857_100310186 Ga0068857_1003101862 295
293 3300005615 Ga0070702_100000223 Ga0070702_1000002237 295
294 3300005615 Ga0070702_100019642 Ga0070702_1000196422 295
295 3300005718 Ga0068866_10077607 Ga0068866_100776072 295
296 3300005719 Ga0068861_100008407 Ga0068861_1000084075 295
297 3300005719 Ga0068861_100041588 Ga0068861_1000415884 295
298 3300005840 Ga0068870_10001641 Ga0068870_100016415 295
299 3300005842 Ga0068858_100011872 Ga0068858_1000118722 295
300 3300005843 Ga0068860_100004675 Ga0068860_1000046759 295
301 3300005844 Ga0068862_100021899 Ga0068862_1000218994 295
302 3300005844 Ga0068862_100033885 Ga0068862_1000338853 295
303 3300006237 Ga0097621_100010998 Ga0097621_1000109982 295
304 3300006844 Ga0075428_100025570 Ga0075428_1000255702 295
305 3300006844 Ga0075428_100167105 Ga0075428_1001671052 295
306 3300006844 Ga0075428_100671135 Ga0075428_1006711351 295
307 3300006846 Ga0075430_100003777 Ga0075430_10000377711 295
308 3300006846 Ga0075430_100040114 Ga0075430_1000401143 295
309 3300006846 Ga0075430_100438995 Ga0075430_1004389951 295
310 3300006847 Ga0075431_100087601 Ga0075431_1000876013 295
311 3300006847 Ga0075431_100137356 Ga0075431_1001373563 295
312 3300006852 Ga0075433_10004587 Ga0075433_100045872 295
313 3300006852 Ga0075433_10019169 Ga0075433_100191696 295
314 3300006871 Ga0075434_100004275 Ga0075434_1000042754 295
315 3300006881 Ga0068865_100008518 Ga0068865_1000085184 295
316 3300006914 Ga0075436_100012672 Ga0075436_1000126724 295
317 3300007076 Ga0075435_100004540 Ga0075435_1000045404 295
318 3300007076 Ga0075435_100133649 Ga0075435_1001336492 295
319 3300009094 Ga0111539_10013931 Ga0111539_100139318 295
320 3300009094 Ga0111539_10018745 Ga0111539_100187456 295
321 3300009094 Ga0111539_10160775 Ga0111539_101607752 295
322 3300009098 Ga0105245_10259015 Ga0105245_102590152 295
323 3300009147 Ga0114129_10023925 Ga0114129_100239255 295
324 3300009147 Ga0114129_10101196 Ga0114129_101011963 295
325 3300009148 Ga0105243_10001212 Ga0105243_1000121225 295
326 3300009148 Ga0105243_10001642 Ga0105243_1000164211 295
327 3300009174 Ga0105241_10028848 Ga0105241_100288484 295
328 3300009176 Ga0105242_10012243 Ga0105242_100122436 295
329 3300009177 Ga0105248_10154918 Ga0105248_101549182 295
330 3300009545 Ga0105237_10182942 Ga0105237_101829422 295
331 3300009551 Ga0105238_10387186 Ga0105238_103871861 295
332 3300009553 Ga0105249_10009025 Ga0105249_100090257 295
333 3300010375 Ga0105239_10041689 Ga0105239_100416892 295
334 3300013297 Ga0157378_10003052 Ga0157378_100030522 295
335 3300013308 Ga0157375_10164114 Ga0157375_101641142 295
336 3300014326 Ga0157380_10000239 Ga0157380_100002395 295
337 3300014326 Ga0157380_10002571 Ga0157380_100025714 295
338 3300014326 Ga0157380_10023775 Ga0157380_100237752 295
339 3300014326 Ga0157380_10091646 Ga0157380_100916462 295
340 3300014745 Ga0157377_10019158 Ga0157377_100191582 295
341 3300014968 Ga0157379_10009289 Ga0157379_100092895 295
342 3300025899 Ga0207642_10001872 Ga0207642_100018722 295
343 3300025899 Ga0207642_10154562 Ga0207642_101545622 295
344 3300025907 Ga0207645_10038280 Ga0207645_100382803 295
345 3300025908 Ga0207643_10005300 Ga0207643_100053002 295
346 3300025908 Ga0207643_10063874 Ga0207643_100638742 295
347 3300025914 Ga0207671_10037932 Ga0207671_100379322 295
348 3300025917 Ga0207660_10014287 Ga0207660_100142873 295
349 3300025917 Ga0207660_10189609 Ga0207660_101896092 295
350 3300025918 Ga0207662_10020600 Ga0207662_100206003 295
351 3300025922 Ga0207646_10085831 Ga0207646_100858312 295
352 3300025925 Ga0207650_10028033 Ga0207650_100280333 295
353 3300025926 Ga0207659_10005742 Ga0207659_100057425 295
354 3300025926 Ga0207659_10014558 Ga0207659_100145582 295
355 3300025926 Ga0207659_10254611 Ga0207659_102546112 295
356 3300025927 Ga0207687_10003109 Ga0207687_1000310911 295
357 3300025934 Ga0207686_10000084 Ga0207686_1000008476 295
358 3300025935 Ga0207709_10000907 Ga0207709_1000090720 295
359 3300025935 Ga0207709_10049069 Ga0207709_100490692 295
360 3300025936 Ga0207670_10045451 Ga0207670_100454511 295
361 3300025936 Ga0207670_10117165 Ga0207670_101171652 295
362 3300025937 Ga0207669_10003396 Ga0207669_100033963 295
363 3300025937 Ga0207669_10062580 Ga0207669_100625803 295
364 3300025938 Ga0207704_10002137 Ga0207704_100021379 295
365 3300025938 Ga0207704_10003021 Ga0207704_100030211 295
366 3300025939 Ga0207665_10038437 Ga0207665_100384372 295
367 3300025941 Ga0207711_10195609 Ga0207711_101956092 295
368 3300025942 Ga0207689_10000775 Ga0207689_100007751 295
369 3300025945 Ga0207679_10173521 Ga0207679_101735212 295
370 3300025960 Ga0207651_10165121 Ga0207651_101651212 295
371 3300025961 Ga0207712_10020708 Ga0207712_100207082 295
372 3300025972 Ga0207668_10011273 Ga0207668_100112734 295
373 3300025986 Ga0207658_10294528 Ga0207658_102945282 295
374 3300026023 Ga0207677_10285085 Ga0207677_102850852 295
375 3300026035 Ga0207703_10316807 Ga0207703_103168071 295
376 3300026075 Ga0207708_10000049 Ga0207708_1000004963 295
377 3300026075 Ga0207708_10007913 Ga0207708_100079134 295
378 3300026075 Ga0207708_10027893 Ga0207708_100278933 295
379 3300026089 Ga0207648_10000161 Ga0207648_1000016136 295
380 3300026089 Ga0207648_10000685 Ga0207648_1000068517 295
381 3300026116 Ga0207674_10063890 Ga0207674_100638902 295
382 3300026116 Ga0207674_10120210 Ga0207674_101202102 295
383 3300026118 Ga0207675_100000176 Ga0207675_10000017612 295
384 3300026118 Ga0207675_100001627 Ga0207675_1000016274 295
385 3300027907 Ga0207428_10023773 Ga0207428_100237732 295
386 3300027907 Ga0207428_10028032 Ga0207428_100280322 295
387 3300028380 Ga0268265_10019951 Ga0268265_100199514 295
388 3300028381 Ga0268264_10132489 Ga0268264_101324892 295
389 3300031251 Ga0265327_10098126 Ga0265327_100981261 295
390 3300031548 Ga0307408_100014642 Ga0307408_1000146423 295
391 3300031665 Ga0316575_10001516 Ga0316575_100015162 295
392 3300031691 Ga0316579_10001580 Ga0316579_100015807 295
393 3300031691 Ga0316579_10008236 Ga0316579_100082362 295
394 3300031727 Ga0316576_10087459 Ga0316576_100874592 295
395 3300031728 Ga0316578_10001999 Ga0316578_100019996 295
396 3300031728 Ga0316578_10109446 Ga0316578_101094462 295
397 3300031728 Ga0316578_10159531 Ga0316578_101595312 295
398 3300031731 Ga0307405_10083559 Ga0307405_100835592 295
399 3300031733 Ga0316577_10016050 Ga0316577_100160503 295
400 3300031733 Ga0316577_10052487 Ga0316577_100524872 295
401 3300031901 Ga0307406_10092107 Ga0307406_100921071 295
402 3300031911 Ga0307412_10048384 Ga0307412_100483843 295
403 3300031995 Ga0307409_100282776 Ga0307409_1002827761 295
404 3300031995 Ga0307409_100436890 Ga0307409_1004368902 295
405 3300032002 Ga0307416_100006774 Ga0307416_1000067744 295
406 3300032002 Ga0307416_100151523 Ga0307416_1001515232 295
407 3300032005 Ga0307411_10011806 Ga0307411_100118063 295
408 3300032005 Ga0307411_10161194 Ga0307411_101611942 295
409 3300032005 Ga0307411_10296216 Ga0307411_102962162 295
410 3300032133 Ga0316583_10001066 Ga0316583_100010666 295
411 3300032133 Ga0316583_10015240 Ga0316583_100152402 295
412 3300032133 Ga0316583_10030788 Ga0316583_100307882 295
413 3300032168 Ga0316593_10002825 Ga0316593_100028254 295
414 3300035398 Ga0316574_0025058 Ga0316574_0025058_798_1721 295
415 3300035398 Ga0316574_0167093 Ga0316574_0167093_182_1078 295
416 3300035695 Ga0373927_0004693 Ga0373927_0004693_484_1401 295
417 3300036647 Ga0316582_0111367 Ga0316582_0111367_399_1322 295
418 3300036647 Ga0316582_0148580 Ga0316582_0148580_273_1214 295
419 3300036712 Ga0316584_0031988 Ga0316584_0031988_224_1165 295
420 3300036712 Ga0316584_0161087 Ga0316584_0161087_516_1439 295
421 3300041408 Ga0439453_0000865 Ga0439453_0000865_1089_1988 295
422 3300041999 Ga0439433_0009624 Ga0439433_0009624_925_1824 295
423 3300042122 Ga0450920_000110 Ga0450920_000110_8528_9427 295
424 3300042125 Ga0450923_000591 Ga0450923_000591_1398_2297 295
425 3300042131 Ga0450894_002633 Ga0450894_002633_345_1244 295
426 3300042134 Ga0450898_000237 Ga0450898_000237_4820_5719 295
427 3300042145 Ga0450906_005635 Ga0450906_005635_1010_1909 295
428 3300042146 Ga0450907_019164 Ga0450907_019164_131_1030 295
429 3300042147 Ga0450910_003509 Ga0450910_003509_292_1191 295
430 3300042156 Ga0439446_0002077 Ga0439446_0002077_3079_3978 295
431 3300042436 Ga0439435_0000394 Ga0439435_0000394_2518_3417 295
432 3300042437 Ga0439444_0000160 Ga0439444_0000160_1024_1923 295
433 3300042461 Ga0439460_0002399 Ga0439460_0002399_2613_3512 295
434 3300042530 Ga0450916_007895 Ga0450916_007895_301_1200 295
435 3300042531 Ga0450918_002623 Ga0450918_002623_844_1743 295
436 3300042876 Ga0451577_0000071 Ga0451577_0000071_15259_16149 295
437 3300042876 Ga0451577_0249359 Ga0451577_0249359_661_1551 295
438 3300044712 Ga0453684_0000537 Ga0453684_0000537_140207_141097 295
439 3300044712 Ga0453684_0115550 Ga0453684_0115550_774_1664 295
440 3300044712 Ga0453684_0193002 Ga0453684_0193002_534_1424 295
441 3300045051 Ga0451576_0000217 Ga0451576_0000217_92639_93529 295
442 3300045051 Ga0451576_0188958 Ga0451576_0188958_1130_2020 295
443 3300046539 Ga0495621_0062333 Ga0495621_0062333_140_1057 295
444 3300048905 Ga0496102_0165113 Ga0496102_0165113_838_1803 295
445 3300049568 Ga0501031_0019378 Ga0501031_0019378_1274_2263 295
446 3300049572 Ga0501036_0042686 Ga0501036_0042686_2194_3093 295
447 3300049573 Ga0501037_0066120 Ga0501037_0066120_75_974 295
448 3300049574 Ga0501038_0003652 Ga0501038_0003652_571_1527 295
449 3300049574 Ga0501038_0148251 Ga0501038_0148251_85_984 295
450 3300049574 Ga0501038_0176266 Ga0501038_0176266_696_1595 295
451 3300049575 Ga0501039_0062889 Ga0501039_0062889_1850_2767 295
452 3300049576 Ga0501040_0028480 Ga0501040_0028480_716_1633 295
453 3300049576 Ga0501040_0040177 Ga0501040_0040177_1378_2277 295
454 3300049576 Ga0501040_0233824 Ga0501040_0233824_158_1057 295
455 3300049577 Ga0501041_0006644 Ga0501041_0006644_5261_6160 295
456 3300049577 Ga0501041_0026044 Ga0501041_0026044_768_1685 295
457 3300049577 Ga0501041_0150407 Ga0501041_0150407_94_993 295
458 3300049578 Ga0501042_0068128 Ga0501042_0068128_939_1856 295
459 3300049578 Ga0501042_0073672 Ga0501042_0073672_1168_2067 295
460 3300049578 Ga0501042_0207865 Ga0501042_0207865_76_975 295
461 3300049579 Ga0501043_0212082 Ga0501043_0212082_260_1159 295
462 3300049580 Ga0501046_0045909 Ga0501046_0045909_816_1715 295
463 3300049582 Ga0501048_0178273 Ga0501048_0178273_117_1034 295
464 3300049584 Ga0501068_0076595 Ga0501068_0076595_258_1157 295
465 3300049584 Ga0501068_0202072 Ga0501068_0202072_238_1137 295
466 3300049585 Ga0501069_0066608 Ga0501069_0066608_213_1112 295
467 3300049587 Ga0501071_0007357 Ga0501071_0007357_5859_6758 295
468 3300049587 Ga0501071_0033865 Ga0501071_0033865_1003_1902 295
469 3300049587 Ga0501071_0049039 Ga0501071_0049039_2129_3028 295
470 3300049588 Ga0501072_0027819 Ga0501072_0027819_921_1820 295
471 3300049588 Ga0501072_0264708 Ga0501072_0264708_334_1233 295
472 3300049589 Ga0501073_0002463 Ga0501073_0002463_10171_11070 295
473 3300049591 Ga0501075_0020429 Ga0501075_0020429_301_1200 295
474 3300049591 Ga0501075_0104559 Ga0501075_0104559_572_1471 295
475 3300049592 Ga0501076_0101622 Ga0501076_0101622_1385_2284 295
476 3300049593 Ga0501077_0002116 Ga0501077_0002116_863_1762 295
477 3300049741 Ga0501079_0166823 Ga0501079_0166823_464_1363 295
478 3300049741 Ga0501079_0172039 Ga0501079_0172039_124_1023 295
479 3300049742 Ga0501080_0004833 Ga0501080_0004833_6751_7650 295
480 3300049742 Ga0501080_0179319 Ga0501080_0179319_448_1347 295
481 3300049743 Ga0501081_0009584 Ga0501081_0009584_4781_5680 295
482 3300049743 Ga0501081_0064701 Ga0501081_0064701_217_1116 295
483 3300049822 Ga0501035_0185186 Ga0501035_0185186_78_977 295
484 3300049823 Ga0501044_0045596 Ga0501044_0045596_2820_3809 295
485 3300049824 Ga0501045_0062927 Ga0501045_0062927_1716_2615 295
486 3300049824 Ga0501045_0201612 Ga0501045_0201612_568_1467 295
487 3300049824 Ga0501045_0319791 Ga0501045_0319791_185_1096 295
488 3300050508 nmdc:mga09592_117642_c1 nmdc:mga09592_117642_c1_525_1436 295
489 3300050508 nmdc:mga09592_77022_c1 nmdc:mga09592_77022_c1_715_1632 295
490 3300050509 nmdc:mga0qj67_143552_c1 nmdc:mga0qj67_143552_c1_862_1779 295
491 3300050509 nmdc:mga0qj67_360_c1 nmdc:mga0qj67_360_c1_1664_2575 295
492 3300050509 nmdc:mga0qj67_386637_c1 nmdc:mga0qj67_386637_c1_168_1079 295
493 3300050510 nmdc:mga06r32_192035_c1 nmdc:mga06r32_192035_c1_937_1848 295
494 3300050510 nmdc:mga06r32_264289_c1 nmdc:mga06r32_264289_c1_653_1564 295
495 3300050511 nmdc:mga08y16_109867_c1 nmdc:mga08y16_109867_c1_341_1252 295
496 3300050511 nmdc:mga08y16_15235_c1 nmdc:mga08y16_15235_c1_4886_5797 295
497 3300050511 nmdc:mga08y16_37268_c1 nmdc:mga08y16_37268_c1_2058_2975 295
498 3300050512 nmdc:mga0n895_6386_c1 nmdc:mga0n895_6386_c1_8576_9475 295
499 3300050513 nmdc:mga0rr50_4092_c1 nmdc:mga0rr50_4092_c1_3304_4203 295
500 3300050514 nmdc:mga08x19_47094_c1 nmdc:mga08x19_47094_c1_1757_2674 295
501 3300050515 nmdc:mga0a205_13158_c1 nmdc:mga0a205_13158_c1_1905_2804 295
502 3300054114 Ga0501084_0021886 Ga0501084_0021886_1519_2418 295
503 3300054114 Ga0501084_0026938 Ga0501084_0026938_2402_3301 295
504 3300060353 Ga0501082_0003857 Ga0501082_0003857_6142_7041 295
505 3300060353 Ga0501082_0207889 Ga0501082_0207889_667_1566 295
506 3300061734 Ga0530510_0339582 Ga0530510_0339582_42_941 295
507 3300005331 Ga0070670_100068420 Ga0070670_1000684203 296
508 3300005345 Ga0070692_10040114 Ga0070692_100401142 296
509 3300005441 Ga0070700_100000705 Ga0070700_10000070514 296
510 3300005545 Ga0070695_100102368 Ga0070695_1001023682 296
511 3300005546 Ga0070696_100118951 Ga0070696_1001189512 296
512 3300005617 Ga0068859_100262650 Ga0068859_1002626502 296
513 3300006931 Ga0097620_100262646 Ga0097620_1002626462 296
514 3300009093 Ga0105240_10006007 Ga0105240_100060074 296
515 3300025913 Ga0207695_10043211 Ga0207695_100432114 296
516 3300031665 Ga0316575_10036209 Ga0316575_100362092 296
517 3300031691 Ga0316579_10077111 Ga0316579_100771112 296
518 3300031727 Ga0316576_10008864 Ga0316576_100088644 296
519 3300031727 Ga0316576_10209952 Ga0316576_102099522 296
520 3300031728 Ga0316578_10020422 Ga0316578_100204222 296
521 3300031733 Ga0316577_10014282 Ga0316577_100142824 296
522 3300031733 Ga0316577_10031697 Ga0316577_100316972 296
523 3300031733 Ga0316577_10053887 Ga0316577_100538872 296
524 3300031733 Ga0316577_10115910 Ga0316577_101159102 296
525 3300032133 Ga0316583_10008776 Ga0316583_100087761 296
526 3300032133 Ga0316583_10081129 Ga0316583_100811291 296
527 3300032137 Ga0316585_10009731 Ga0316585_100097313 296
528 3300032139 Ga0316580_10020218 Ga0316580_100202182 296
529 3300032168 Ga0316593_10002881 Ga0316593_100028812 296
530 3300035398 Ga0316574_0002385 Ga0316574_0002385_4559_5473 296
531 3300035398 Ga0316574_0002874 Ga0316574_0002874_2065_2964 296
532 3300035398 Ga0316574_0028738 Ga0316574_0028738_2048_2995 296
533 3300035398 Ga0316574_0187481 Ga0316574_0187481_114_1013 296
534 3300036647 Ga0316582_0007784 Ga0316582_0007784_721_1623 296
535 3300036647 Ga0316582_0019293 Ga0316582_0019293_1074_2021 296
536 3300036647 Ga0316582_0027003 Ga0316582_0027003_1440_2342 296
537 3300036647 Ga0316582_0039999 Ga0316582_0039999_979_1887 296
538 3300036647 Ga0316582_0184910 Ga0316582_0184910_223_1125 296
539 3300036712 Ga0316584_0003275 Ga0316584_0003275_5385_6332 296
540 3300036712 Ga0316584_0010804 Ga0316584_0010804_4890_5792 296
541 3300036712 Ga0316584_0012319 Ga0316584_0012319_4907_5806 296
542 3300036712 Ga0316584_0016764 Ga0316584_0016764_3896_4795 296
543 3300037588 Ga0316581_0000808 Ga0316581_0000808_4041_4940 296
544 3300044712 Ga0453684_0001268 Ga0453684_0001268_19147_20073 296
545 3300049568 Ga0501031_0033825 Ga0501031_0033825_1906_2940 296
546 3300049569 Ga0501032_0001200 Ga0501032_0001200_13568_14587 296
547 3300049571 Ga0501034_0008488 Ga0501034_0008488_1577_2551 296
548 3300049571 Ga0501034_0009000 Ga0501034_0009000_2651_3580 296
549 3300049571 Ga0501034_0084666 Ga0501034_0084666_1915_2844 296
550 3300049574 Ga0501038_0175769 Ga0501038_0175769_168_1202 296
551 3300049580 Ga0501046_0134212 Ga0501046_0134212_778_1812 296
552 3300049584 Ga0501068_0000767 Ga0501068_0000767_2207_3136 296
553 3300049586 Ga0501070_0110702 Ga0501070_0110702_654_1583 296
554 3300049588 Ga0501072_0000279 Ga0501072_0000279_33482_34411 296
555 3300049589 Ga0501073_0023099 Ga0501073_0023099_1976_2905 296
556 3300049742 Ga0501080_0000762 Ga0501080_0000762_1485_2414 296
557 3300054114 Ga0501084_0043239 Ga0501084_0043239_2767_3696 296
558 3300060353 Ga0501082_0069873 Ga0501082_0069873_1505_2434 296
559 3300005564 Ga0070664_100557376 Ga0070664_1005573761 297
560 3300005614 Ga0068856_100031048 Ga0068856_1000310485 297
561 3300006195 Ga0075366_10064545 Ga0075366_100645453 297
562 3300013297 Ga0157378_10464226 Ga0157378_104642261 297
563 3300013308 Ga0157375_10120164 Ga0157375_101201642 297
564 3300048904 Ga0496101_0084845 Ga0496101_0084845_969_1937 297
565 3300048911 Ga0496108_0062533 Ga0496108_0062533_749_1717 297
566 3300048911 Ga0496108_0206956 Ga0496108_0206956_647_1627 297
567 3300048912 Ga0496109_0248166 Ga0496109_0248166_80_1060 297
568 3300049822 Ga0501035_0150267 Ga0501035_0150267_533_1573 297
569 3300005614 Ga0068856_100435235 Ga0068856_1004352351 298
570 3300006846 Ga0075430_100005026 Ga0075430_1000050268 298
571 3300006847 Ga0075431_100035341 Ga0075431_1000353414 298
572 3300032005 Ga0307411_10345751 Ga0307411_103457511 298
573 3300032126 Ga0307415_100113001 Ga0307415_1001130012 298
574 3300037418 Ga0395900_0115098 Ga0395900_0115098_1182_2168 298
575 3300049569 Ga0501032_0058320 Ga0501032_0058320_740_1789 298
576 3300049572 Ga0501036_0000718 Ga0501036_0000718_15812_16861 298
577 3300049574 Ga0501038_0004503 Ga0501038_0004503_3542_4591 298
578 3300049574 Ga0501038_0016271 Ga0501038_0016271_1590_2618 298
579 3300049579 Ga0501043_0014939 Ga0501043_0014939_2357_3406 298
580 3300049822 Ga0501035_0001470 Ga0501035_0001470_12123_13172 298
581 3300049823 Ga0501044_0000700 Ga0501044_0000700_5894_6943 298
582 3300049823 Ga0501044_0146252 Ga0501044_0146252_564_1610 298
583 iso_pu_bacteria 2582581279 2585147403 298
584 3300005327 Ga0070658_10035065 Ga0070658_100350654 299
585 3300025921 Ga0207652_10145235 Ga0207652_101452352 299
586 3300049581 Ga0501047_0000478 Ga0501047_0000478_25004_25903 299
587 3300006195 Ga0075366_10018719 Ga0075366_100187193 301
588 3300046512 Ga0495610_0001778 Ga0495610_0001778_5857_6762 301
589 3300046518 Ga0495631_0003596 Ga0495631_0003596_2642_3547 301
590 3300046524 Ga0495648_0001177 Ga0495648_0001177_21035_21961 301
591 3300047469 Ga0495673_0001249 Ga0495673_0001249_1629_2534 301
592 3300047472 Ga0495686_0001819 Ga0495686_0001819_6587_7492 301
593 3300049459 Ga0495678_002267 Ga0495678_002267_12382_13302 301
594 3300050493 nmdc:mga0k408_93752_c1 nmdc:mga0k408_93752_c1_165_1070 301
595 3300053086 Ga0500578_0000023 Ga0500578_0000023_150182_151087 301
596 3300053088 Ga0500644_0000174 Ga0500644_0000174_19719_20624 301
597 3300053118 Ga0500594_0000416 Ga0500594_0000416_2685_3605 301
598 3300003790 Ga0055528_1012294 Ga0055528_10122942 302
599 3300025263 Ga0209565_1000118 Ga0209565_100011840 302
600 3300025273 Ga0209673_1005966 Ga0209673_10059663 302
601 3300025291 Ga0209675_1011319 Ga0209675_10113192 302
602 3300025295 Ga0209564_1028479 Ga0209564_10284793 302
603 3300025297 Ga0209758_1003035 Ga0209758_10030356 302
604 3300025299 Ga0209256_1004006 Ga0209256_10040067 302
605 3300028794 Ga0307515_10030334 Ga0307515_100303345 302
606 3300028794 Ga0307515_10144953 Ga0307515_101449532 302
607 3300028800 Ga0265338_10008351 Ga0265338_100083518 302
608 3300046457 Ga0495590_0001780 Ga0495590_0001780_1485_2393 302
609 3300046460 Ga0495638_0000892 Ga0495638_0000892_5455_6363 302
610 3300046460 Ga0495638_0008830 Ga0495638_0008830_5954_6862 302
611 3300046512 Ga0495610_0000407 Ga0495610_0000407_9963_10871 302
612 3300046616 Ga0495668_0010032 Ga0495668_0010032_3456_4364 302
613 3300047472 Ga0495686_0005522 Ga0495686_0005522_4895_5803 302
614 3300053102 Ga0500554_003204 Ga0500554_003204_216_1127 302
615 3300053108 Ga0500562_000505 Ga0500562_000505_6149_7057 302
616 3300053134 Ga0500658_0003039 Ga0500658_0003039_1661_2575 302
617 3300053138 Ga0500564_000227 Ga0500564_000227_14640_15569 302
618 3300053156 Ga0500622_0002375 Ga0500622_0002375_12684_13592 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

249

348

0.98

PF01565

FAD_binding_4

FAD binding domain

68

202

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9619 12 300
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9602 11 302
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9536 13 301
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9284 11 302
2gqu-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus 0.9208 9 297
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9814 216 302 3.90.78.10
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9705 216 302 3.90.78.10
4pytA01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9484 12 80 3.30.43.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9407 87 215 3.30.465.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9337 87 215 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A4Q3RQ90-F1-model_v4 UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) 0.9967 7 282 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A536EYE7-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.989 2 302 GO:0005506
GO:0005507
GO:0005737
GO:0008360
GO:0008762
GO:0009252
GO:0030151
GO:0043885
GO:0051301
GO:0071555
GO:0071949
AF-A0A3N5RV35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9882 223 300 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A840FG60-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.988 8 300 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A0S8A7P8-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9871 198 302 GO:0005829
GO:0008762
GO:0050660
GO:0071555

Feature Viewer

pLDDT pTM Quality
95.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map