F469660

General Info

Members Datasets Scaffolds Average Seq Length
617 403 547 296

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0088801|Ga0466967_0088801_497_1381
Length 279
Sequence MTQISGSLVAIVTPMHEDGSLDFPSLRKLIDWHIDEGTDGIVIVGTSGESPTVSVEEHRELIRVAVEQANKRIPLTAYAKQVGADASLQVVPYYNKPTQEGMYLHFRKVAESVDLPVILYNVPGRTVADMTVETMLRLADVPGIIGVKEATGNIDRAAQLIKGAPASFKIYSGDDPTAIALMLLGGHGNISVTANVAPRAMHELCAAAMRGDVETARRIHMQLLSVHKNLFVESNPIPVKWALQAMGKMEGGIRLPLTPLAPQYHEVVRASLKDAGLLS

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221596 Acidovorax sp. Root70 Isolate Unclassified
13 2643221609 Acidovorax sp. Root217 Isolate Unclassified
14 2643221611 Acidovorax sp. Root219 Isolate Unclassified
15 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2721755523 Delftia sp. HK171 Isolate Unclassified
22 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738543012 Acidovorax sp. CF301 Isolate Unclassified
26 2738543013 Variovorax sp. BT01 Isolate Unclassified
27 2738543019 Variovorax sp. GV040 Isolate Unclassified
28 2816332133 Acidovorax radicis 2721A Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
32 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
33 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
34 2842677519 Variovorax sp. R-72495 Isolate Unclassified
35 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
36 2842733646 Variovorax sp. R-72446 Isolate Unclassified
37 2842747753 Variovorax sp. R-72060 Isolate Unclassified
38 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
39 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
40 2885198086 Variovorax sp. 679 Isolate Unclassified
41 2885211737 Variovorax sp. 553 Isolate Unclassified
42 2885266251 Ralstonia sp. SET104 Isolate Nodule
43 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
44 2899924645 Variovorax sp. 369 Isolate Unclassified
45 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
46 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
47 2904456579 Variovorax sp. 2002 Isolate Unclassified
48 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
49 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
50 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
51 2928037797 Variovorax sp. 1126 Isolate Unclassified
52 2928044640 Variovorax sp. 1128 Isolate Unclassified
53 2928051484 Variovorax sp. 1133 Isolate Unclassified
54 2928058823 Ralstonia sp. 1138 Isolate Unclassified
55 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
56 2928070936 Variovorax gossypii 1167 Isolate Unclassified
57 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
58 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
59 2929520902 Variovorax beijingensis 502 Isolate Unclassified
60 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
61 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
62 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
63 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
64 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
65 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
66 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
67 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
70 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
71 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
72 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
73 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
82 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
83 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
84 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
90 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
91 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
92 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
97 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
104 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
105 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
106 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
107 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
125 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
219 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
220 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
226 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
254 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
255 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
261 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
262 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
269 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
366 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
387 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
388 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
389 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
394 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
395 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
396 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
399 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 639633007 Azoarcus olearius BH72 Isolate Unclassified
402 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
403 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.01
Metatranscriptomes 0.65
Isolates 11.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.82
Nodule 1.94
Rhizoplane 2.76
Rhizosphere 53
Stem 0
Stem Tuber 0
Unclassified 12.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10037077 3300001989 Bacteria 1644
2 JGI25155J39150_1000079 3300002704 Bacteria 56287
3 JGI25156J39149_1000125 3300002705 Bacteria 56308
4 JGI25154J39366_1000141 3300002738 Bacteria 56305
5 JGI25158J39367_1002898 3300002739 Bacteria 2712
6 JGI25157J39369_1000159 3300002741 Bacteria 56308
7 JGI25152J39213_1023049 3300002773 Bacteria 1066
8 JGI25150J39212_1002448 3300002774 Bacteria 4607
9 JGI25150J39212_1005975 3300002774 Bacteria 2556
10 JGI25159J45721_1000638 3300002987 Bacteria 15559
11 JGI25159J45721_1001149 3300002987 Bacteria 11309
12 JGI25159J45721_1003507 3300002987 Bacteria 5532
13 JGI25159J45721_1010700 3300002987 Bacteria 2311
14 JGI25151J46595_10002430 3300003187 Bacteria 11222
15 JGI25151J46595_10007994 3300003187 Bacteria 5128
16 JGI25151J46595_10011650 3300003187 Bacteria 4035
17 JGI25151J46595_10030161 3300003187 Bacteria 2136
18 JGI25151J46595_10068115 3300003187 Bacteria 1093
19 JGI25406J46586_10015910 3300003203 Bacteria 3155
20 JGI25153J46596_10056704 3300003215 Bacteria 1088
21 JGI25160J50197_1000067 3300003354 Bacteria 113436
22 JGI25161J50226_1000035 3300003374 Bacteria 133666
23 Ga0006562J51391_1036758 3300003578 Bacteria 2990
24 Ga0006562J51391_1036760 3300003578 Bacteria 1880
25 Ga0006562J51391_1114748 3300003578 Bacteria 2843
26 Ga0006562J51391_1114752 3300003578 Bacteria 1480
27 Ga0055535_1002162 3300003761 Bacteria 7614
28 Ga0055542_1000087 3300003762 Bacteria 123666
29 Ga0055526_1001094 3300003771 Bacteria 19717
30 Ga0055537_1000490 3300003773 Bacteria 24227
31 Ga0055537_1002621 3300003773 Bacteria 5881
32 Ga0055537_1004715 3300003773 Bacteria 3830
33 Ga0055524_1000006 3300003775 Bacteria 324702
34 Ga0055524_1000360 3300003775 Bacteria 40907
35 Ga0055524_1001538 3300003775 Bacteria 13046
36 Ga0055524_1032458 3300003775 Bacteria 1479
37 Ga0055536_1001210 3300003781 Bacteria 16014
38 Ga0055536_1003127 3300003781 Bacteria 8989
39 Ga0055536_1011696 3300003781 Bacteria 3332
40 Ga0055534_1000042 3300003784 Bacteria 99433
41 Ga0055534_1000722 3300003784 Bacteria 15998
42 Ga0055534_1001178 3300003784 Bacteria 10992
43 Ga0055534_1002450 3300003784 Bacteria 6412
44 Ga0055534_1005829 3300003784 Bacteria 3222
45 Ga0055534_1008709 3300003784 Bacteria 2273
46 Ga0055534_1019507 3300003784 Bacteria 1162
47 Ga0055528_1000242 3300003790 Bacteria 45905
48 Ga0055528_1000374 3300003790 Bacteria 36367
49 Ga0055530_10000346 3300003791 Bacteria 41934
50 Ga0055530_10031413 3300003791 Bacteria 1394
51 Ga0055540_1000005 3300003792 Bacteria 378126
52 Ga0055540_1013970 3300003792 Bacteria 2421
53 Ga0055540_1017045 3300003792 Bacteria 2041
54 Ga0055540_1021135 3300003792 Bacteria 1699
55 Ga0055531_10000604 3300003794 Bacteria 31172
56 Ga0055531_10000705 3300003794 Bacteria 28429
57 Ga0055543_1001289 3300004625 Bacteria 10317
58 Ga0065165_1013863 3300005262 Bacteria 3169
59 Ga0065165_1013875 3300005262 Bacteria 3167
60 Ga0065715_10139916 3300005293 Bacteria 1869
61 Ga0070658_10096585 3300005327 Bacteria 2440
62 Ga0068869_100020707 3300005334 Bacteria 4514
63 Ga0070680_100112944 3300005336 Bacteria 2262
64 Ga0070689_100049510 3300005340 Bacteria 3244
65 Ga0070691_10047960 3300005341 Bacteria 2032
66 Ga0070674_100131131 3300005356 Bacteria 1869
67 Ga0070667_100085849 3300005367 Bacteria 2700
68 Ga0070703_10033858 3300005406 Bacteria 1557
69 Ga0070703_10061474 3300005406 Bacteria 1230
70 Ga0070714_100077358 3300005435 Bacteria 2890
71 Ga0070713_100473532 3300005436 Bacteria 1179
72 Ga0070694_100133563 3300005444 Bacteria 1796
73 Ga0070694_100151422 3300005444 Bacteria 1694
74 Ga0070694_100159303 3300005444 Bacteria 1655
75 Ga0070681_10183863 3300005458 Bacteria 2011
76 Ga0070699_100003963 3300005518 Bacteria 13087
77 Ga0070699_100023179 3300005518 Bacteria 5349
78 Ga0070679_100298176 3300005530 Bacteria 1563
79 Ga0070697_100003309 3300005536 Bacteria 12379
80 Ga0068853_100005208 3300005539 Bacteria 10169
81 Ga0070695_100002731 3300005545 Bacteria 10229
82 Ga0070696_100000523 3300005546 Bacteria 24329
83 Ga0070693_100364057 3300005547 Bacteria 993
84 Ga0070704_100009813 3300005549 Bacteria 5806
85 Ga0070704_100265913 3300005549 Bacteria 1415
86 Ga0070664_100149065 3300005564 Bacteria 2065
87 Ga0068857_100169700 3300005577 Bacteria 1983
88 Ga0068857_100559028 3300005577 Bacteria 1078
89 Ga0068862_100070359 3300005844 Bacteria 3021
90 Ga0081539_10000668 3300005985 Bacteria 68754
91 Ga0075365_10100765 3300006038 Bacteria 1977
92 Ga0075363_100034165 3300006048 Bacteria 2653
93 Ga0075363_100066165 3300006048 Bacteria 1955
94 Ga0075364_10034160 3300006051 Bacteria 3279
95 Ga0075364_10052235 3300006051 Bacteria 2671
96 Ga0075432_10014721 3300006058 Bacteria 2664
97 Ga0070716_100044268 3300006173 Bacteria 2493
98 Ga0075362_10001536 3300006177 Bacteria 7443
99 Ga0075362_10025368 3300006177 Bacteria 2523
100 Ga0075362_10039428 3300006177 Bacteria 2077
101 Ga0075362_10048826 3300006177 Bacteria 1889
102 Ga0075367_10105055 3300006178 Bacteria 1729
103 Ga0075366_10000517 3300006195 Bacteria 17834
104 Ga0075366_10010971 3300006195 Bacteria 5100
105 Ga0075366_10047092 3300006195 Bacteria 2556
106 Ga0075370_10002974 3300006353 Bacteria 7966
107 Ga0075370_10008542 3300006353 Bacteria 5276
108 Ga0075370_10011368 3300006353 Bacteria 4674
109 Ga0075370_10063049 3300006353 Bacteria 2112
110 Ga0075370_10163309 3300006353 Bacteria 1308
111 Ga0068871_100053786 3300006358 Bacteria 3264
112 Ga0075428_100072011 3300006844 Bacteria 3777
113 Ga0075431_100030053 3300006847 Bacteria 5595
114 Ga0075434_100000083 3300006871 Bacteria 51151
115 Ga0075434_100023583 3300006871 Bacteria 5999
116 Ga0075434_100037499 3300006871 Bacteria 4798
117 Ga0075429_100066161 3300006880 Bacteria 3146
118 Ga0075429_100127368 3300006880 Bacteria 2227
119 Ga0075436_100022009 3300006914 Bacteria 4377
120 Ga0075436_100027856 3300006914 Bacteria 3889
121 Ga0075436_100042280 3300006914 Bacteria 3143
122 Ga0079104_1000002 3300006946 Bacteria 514469
123 Ga0099826_10000004 3300006948 Bacteria 802669
124 Ga0099826_10189649 3300006948 Bacteria 1135
125 Ga0075435_100004854 3300007076 Bacteria 9307
126 Ga0075435_100101313 3300007076 Bacteria 2386
127 Ga0105251_10049307 3300009011 Bacteria 2016
128 Ga0105244_10004693 3300009036 Bacteria 9311
129 Ga0105250_10004264 3300009092 Bacteria 6610
130 Ga0111539_10048579 3300009094 Bacteria 5065
131 Ga0114129_10167578 3300009147 Bacteria 2996
132 Ga0114129_10452062 3300009147 Bacteria 1685
133 Ga0105243_10002300 3300009148 Bacteria 16025
134 Ga0105243_10009710 3300009148 Bacteria 7328
135 Ga0105241_10156974 3300009174 Bacteria 1867
136 Ga0105242_10017149 3300009176 Bacteria 5638
137 Ga0105239_10572032 3300010375 Bacteria 1288
138 Ga0157373_10027789 3300013100 Bacteria 4081
139 Ga0157371_10000123 3300013102 Bacteria 118119
140 Ga0157370_10037489 3300013104 Bacteria 4699
141 Ga0157369_10013458 3300013105 Bacteria 9246
142 Ga0157378_10516983 3300013297 Bacteria 1195
143 Ga0163162_10024877 3300013306 Bacteria 5914
144 Ga0157372_10000067 3300013307 Bacteria 111621
145 Ga0157375_10514764 3300013308 Bacteria 1360
146 Ga0182008_10000838 3300014497 Bacteria 21458
147 Ga0182008_10003873 3300014497 Bacteria 8884
148 Ga0182008_10011535 3300014497 Bacteria 4693
149 Ga0182008_10055610 3300014497 Bacteria 1957
150 Ga0182006_1002216 3300015261 Bacteria 10773
151 Ga0182006_1056801 3300015261 Bacteria 1489
152 Ga0182007_10000601 3300015262 Bacteria 21082
153 Ga0182007_10000825 3300015262 Bacteria 17267
154 Ga0183362_10003 3300015683 Bacteria 977584
155 Ga0163161_10011479 3300017792 Bacteria 6147
156 Ga0163161_10092071 3300017792 Bacteria 2244
157 Ga0163161_10161761 3300017792 Bacteria 1707
158 Ga0213872_10001797 3300021361 Bacteria 13357
159 Ga0213872_10157299 3300021361 Bacteria 990
160 Ga0209435_100001 3300025206 Bacteria 1424171
161 Ga0209436_107649 3300025208 Bacteria 2233
162 Ga0209672_101515 3300025228 Bacteria 8079
163 Ga0209147_103861 3300025229 Bacteria 2705
164 Ga0209258_100199 3300025242 Bacteria 123718
165 Ga0207425_1000863 3300025245 Bacteria 14839
166 Ga0207425_1002398 3300025245 Bacteria 6625
167 Ga0207425_1004716 3300025245 Bacteria 4023
168 Ga0209646_1000001 3300025246 Bacteria 3092932
169 Ga0209026_1000003 3300025250 Bacteria 1060571
170 Ga0209148_1000179 3300025254 Bacteria 126083
171 Ga0209759_1000001 3300025256 Bacteria 2799452
172 Ga0209129_1000071 3300025258 Bacteria 210729
173 Ga0209129_1001902 3300025258 Bacteria 11014
174 Ga0209565_1000083 3300025263 Bacteria 154007
175 Ga0209565_1000124 3300025263 Bacteria 110789
176 Ga0209565_1000235 3300025263 Bacteria 60351
177 Ga0209565_1000498 3300025263 Bacteria 28727
178 Ga0209565_1002195 3300025263 Bacteria 7317
179 Ga0209565_1008861 3300025263 Bacteria 2604
180 Ga0209673_1000043 3300025273 Bacteria 291503
181 Ga0209673_1000534 3300025273 Bacteria 62274
182 Ga0209673_1001906 3300025273 Bacteria 16707
183 Ga0209673_1020278 3300025273 Bacteria 2359
184 Ga0209673_1033411 3300025273 Bacteria 1569
185 Ga0209130_1000442 3300025284 Bacteria 43829
186 Ga0209130_1000620 3300025284 Bacteria 33992
187 Ga0209130_1000773 3300025284 Bacteria 27625
188 Ga0209130_1002969 3300025284 Bacteria 7705
189 Ga0209675_1000081 3300025291 Bacteria 154007
190 Ga0209675_1000125 3300025291 Bacteria 105527
191 Ga0209675_1000309 3300025291 Bacteria 44113
192 Ga0209675_1000312 3300025291 Bacteria 43634
193 Ga0209675_1002859 3300025291 Bacteria 8569
194 Ga0209675_1006924 3300025291 Bacteria 4447
195 Ga0209675_1007688 3300025291 Bacteria 4083
196 Ga0209676_1000005 3300025292 Bacteria 1076001
197 Ga0209676_1000007 3300025292 Bacteria 1029371
198 Ga0209676_1000014 3300025292 Bacteria 793514
199 Ga0209676_1001007 3300025292 Bacteria 33026
200 Ga0209676_1003004 3300025292 Bacteria 10965
201 Ga0209676_1009837 3300025292 Bacteria 4067
202 Ga0209676_1030273 3300025292 Bacteria 1657
203 Ga0209025_1000232 3300025294 Bacteria 130663
204 Ga0209025_1000246 3300025294 Bacteria 127684
205 Ga0209025_1000544 3300025294 Bacteria 70638
206 Ga0209025_1000854 3300025294 Bacteria 48260
207 Ga0209025_1001132 3300025294 Bacteria 38158
208 Ga0209025_1001880 3300025294 Bacteria 24550
209 Ga0209025_1002427 3300025294 Bacteria 19781
210 Ga0209025_1004201 3300025294 Bacteria 12707
211 Ga0209025_1004916 3300025294 Bacteria 11238
212 Ga0209025_1007365 3300025294 Bacteria 8232
213 Ga0209025_1010312 3300025294 Bacteria 6347
214 Ga0209564_1000239 3300025295 Bacteria 119761
215 Ga0209564_1000268 3300025295 Bacteria 109101
216 Ga0209564_1000476 3300025295 Bacteria 67062
217 Ga0209564_1001012 3300025295 Bacteria 34912
218 Ga0209564_1003314 3300025295 Bacteria 11188
219 Ga0209564_1031042 3300025295 Bacteria 1642
220 Ga0209564_1033743 3300025295 Bacteria 1515
221 Ga0209564_1052362 3300025295 Bacteria 982
222 Ga0209758_1000027 3300025297 Bacteria 549650
223 Ga0209758_1003037 3300025297 Bacteria 15990
224 Ga0209758_1004677 3300025297 Bacteria 11192
225 Ga0209758_1054966 3300025297 Bacteria 1356
226 Ga0209050_1000003 3300025298 Bacteria 1609245
227 Ga0209050_1000007 3300025298 Bacteria 1187891
228 Ga0209050_1001089 3300025298 Bacteria 33034
229 Ga0209050_1004391 3300025298 Bacteria 9566
230 Ga0209256_1000001 3300025299 Bacteria 2166974
231 Ga0209256_1000081 3300025299 Bacteria 222908
232 Ga0209256_1000291 3300025299 Bacteria 88153
233 Ga0209256_1000700 3300025299 Bacteria 44602
234 Ga0209256_1027019 3300025299 Bacteria 1642
235 Ga0207426_1000027 3300025302 Bacteria 513176
236 Ga0207426_1000247 3300025302 Bacteria 119659
237 Ga0207426_1000614 3300025302 Bacteria 45951
238 Ga0207426_1002558 3300025302 Bacteria 11384
239 Ga0209051_1000003 3300025303 Bacteria 1609245
240 Ga0209051_1000009 3300025303 Bacteria 706778
241 Ga0209051_1000320 3300025303 Bacteria 72764
242 Ga0209051_1000347 3300025303 Bacteria 68841
243 Ga0209051_1000373 3300025303 Bacteria 64348
244 Ga0209051_1000553 3300025303 Bacteria 45537
245 Ga0209051_1002578 3300025303 Bacteria 12758
246 Ga0209051_1036022 3300025303 Bacteria 1833
247 Ga0209051_1043024 3300025303 Bacteria 1589
248 Ga0209257_1000011 3300025304 Bacteria 1112630
249 Ga0209257_1000020 3300025304 Bacteria 773356
250 Ga0209257_1000161 3300025304 Bacteria 176089
251 Ga0209257_1000449 3300025304 Bacteria 77522
252 Ga0209257_1017645 3300025304 Bacteria 2798
253 Ga0207656_10026603 3300025321 Bacteria 2361
254 Ga0207696_1003880 3300025711 Bacteria 6616
255 Ga0207655_1001731 3300025728 Bacteria 19151
256 Ga0207705_10233764 3300025909 Bacteria 1399
257 Ga0207707_10016765 3300025912 Bacteria 6382
258 Ga0207707_10326222 3300025912 Bacteria 1325
259 Ga0207695_10223244 3300025913 Bacteria 1791
260 Ga0207660_10027059 3300025917 Bacteria 3910
261 Ga0207660_10055123 3300025917 Bacteria 2839
262 Ga0207652_10280342 3300025921 Bacteria 1503
263 Ga0207681_10082163 3300025923 Bacteria 2277
264 Ga0207706_10006469 3300025933 Bacteria 10879
265 Ga0207686_10035403 3300025934 Bacteria 2997
266 Ga0207709_10000015 3300025935 Bacteria 493221
267 Ga0207709_10001584 3300025935 Bacteria 15523
268 Ga0207709_10010549 3300025935 Bacteria 5088
269 Ga0207669_10016406 3300025937 Bacteria 3762
270 Ga0207665_10081418 3300025939 Bacteria 2229
271 Ga0207689_10246913 3300025942 Bacteria 1476
272 Ga0207651_10094176 3300025960 Bacteria 2202
273 Ga0207639_10125879 3300026041 Bacteria 2113
274 Ga0207708_10207519 3300026075 Bacteria 1565
275 Ga0207648_10075188 3300026089 Bacteria 2945
276 Ga0207683_10035294 3300026121 Bacteria 4348
277 Ga0207683_10176934 3300026121 Bacteria 1934
278 Ga0207698_10095965 3300026142 Bacteria 2442
279 Ga0209281_1000007 3300027111 Bacteria 938265
280 Ga0209969_1002647 3300027360 Bacteria 2480
281 Ga0209995_1017097 3300027471 Bacteria 1193
282 Ga0209968_1008420 3300027526 Bacteria 1571
283 Ga0209999_1022464 3300027543 Bacteria 1161
284 Ga0209970_1002734 3300027614 Bacteria 2981
285 Ga0209282_1000027 3300027666 Bacteria 159842
286 Ga0209282_1023309 3300027666 Bacteria 3893
287 Ga0209971_1008251 3300027682 Bacteria 2470
288 Ga0207428_10277477 3300027907 Bacteria 1245
289 Ga0207428_10277844 3300027907 Bacteria 1244
290 Ga0268266_10013638 3300028379 Bacteria 6999
291 Ga0307517_10243831 3300028786 Bacteria 1063
292 Ga0316176_1066153 3300030732 Bacteria 6972
293 Ga0314311_1174773 3300030733 Bacteria 6162
294 Ga0316181_1035278 3300030744 Bacteria 8135
295 Ga0265331_10066245 3300031250 Bacteria 1697
296 Ga0265327_10089230 3300031251 Bacteria 1506
297 Ga0307513_10000054 3300031456 Bacteria 148887
298 Ga0307408_100000617 3300031548 Bacteria 30246
299 Ga0307408_100008657 3300031548 Bacteria 6720
300 Ga0307514_10088797 3300031649 Bacteria 2261
301 Ga0316575_10000472 3300031665 Bacteria 11577
302 Ga0307405_10001308 3300031731 Bacteria 10408
303 Ga0307405_10045486 3300031731 Bacteria 2690
304 Ga0307405_10089794 3300031731 Bacteria 2031
305 Ga0307406_10000749 3300031901 Bacteria 18227
306 Ga0307406_10001016 3300031901 Bacteria 15602
307 Ga0307406_10241256 3300031901 Bacteria 1356
308 Ga0307412_10035707 3300031911 Bacteria 3178
309 Ga0307412_10081245 3300031911 Bacteria 2241
310 Ga0307412_10159158 3300031911 Bacteria 1675
311 Ga0307416_100081998 3300032002 Bacteria 2730
312 Ga0307416_100620116 3300032002 Bacteria 1163
313 Ga0307414_10358703 3300032004 Bacteria 1253
314 Ga0307411_10104682 3300032005 Bacteria 2010
315 Ga0316583_10000683 3300032133 Bacteria 10431
316 Ga0373938_0015789 3300034957 Bacteria 1468
317 Ga0373932_0071142 3300035112 Bacteria 1079
318 Ga0373953_0005311 3300035117 Bacteria 4170
319 Ga0373953_0095300 3300035117 Bacteria 1248
320 Ga0373954_0000012 3300035118 Bacteria 73616
321 Ga0373956_0005123 3300035119 Bacteria 5245
322 Ga0373957_0026221 3300035120 Bacteria 2106
323 Ga0373955_0154793 3300035172 Bacteria 1350
324 Ga0373931_0083084 3300035691 Bacteria 1771
325 Ga0373933_0005384 3300035724 Bacteria 6968
326 Ga0373933_0034499 3300035724 Bacteria 2949
327 Ga0373937_0001168 3300036401 Bacteria 22061
328 Ga0373937_0003159 3300036401 Bacteria 13788
329 Ga0373937_0034989 3300036401 Bacteria 4569
330 Ga0316582_0084073 3300036647 Bacteria 2083
331 Ga0395899_0005385 3300037312 Bacteria 9941
332 Ga0395900_0001269 3300037418 Bacteria 30864
333 Ga0395900_0094874 3300037418 Bacteria 3065
334 Ga0395900_0409209 3300037418 Bacteria 1319
335 Ga0395898_0048848 3300037466 Bacteria 4147
336 Ga0395898_0084784 3300037466 Bacteria 3054
337 Ga0395905_0035418 3300037471 Bacteria 4687
338 Ga0395905_0170776 3300037471 Bacteria 2042
339 Ga0395901_0290923 3300038443 Bacteria 1695
340 Ga0395901_0334647 3300038443 Bacteria 1564
341 Ga0395901_0353963 3300038443 Bacteria 1515
342 Ga0400487_47147 3300039110 Bacteria 5996
343 Ga0436360_1217697 3300039438 Bacteria 1732
344 Ga0436361_0928448 3300039447 Bacteria 1184
345 Ga0436361_1152527 3300039447 Bacteria 20391
346 Ga0439447_005612 3300041407 Bacteria 4153
347 Ga0439453_0016796 3300041408 Bacteria 1279
348 Ga0439461_0005991 3300041410 Bacteria 2102
349 Ga0439461_0016872 3300041410 Bacteria 1414
350 Ga0439466_0010309 3300041411 Bacteria 3474
351 Ga0439466_0012586 3300041411 Bacteria 3114
352 Ga0439466_0041716 3300041411 Bacteria 1530
353 Ga0451800_0811317 3300041459 Bacteria 1541
354 Ga0451807_2067542 3300041486 Bacteria 1242
355 Ga0439431_0001255 3300041997 Bacteria 5559
356 Ga0439433_0000519 3300041999 Bacteria 7235
357 Ga0439441_001340 3300042001 Bacteria 3184
358 Ga0439442_000506 3300042002 Bacteria 8767
359 Ga0439443_005115 3300042003 Bacteria 1742
360 Ga0439445_0001045 3300042004 Bacteria 5910
361 Ga0439432_006319 3300042006 Bacteria 4237
362 Ga0439449_0000469 3300042007 Bacteria 15091
363 Ga0439449_0000720 3300042007 Bacteria 12664
364 Ga0439452_002385 3300042010 Bacteria 6968
365 Ga0450923_015944 3300042125 Bacteria 1410
366 Ga0450894_005188 3300042131 Bacteria 1685
367 Ga0450898_006727 3300042134 Bacteria 1774
368 Ga0450906_001292 3300042145 Bacteria 5495
369 Ga0450906_003902 3300042145 Bacteria 3160
370 Ga0439446_0000219 3300042156 Bacteria 10507
371 Ga0439446_0013925 3300042156 Bacteria 2213
372 Ga0450909_005997 3300042185 Bacteria 1754
373 Ga0450909_006951 3300042185 Bacteria 1633
374 Ga0439434_0001219 3300042435 Bacteria 7405
375 Ga0439434_0008117 3300042435 Bacteria 3078
376 Ga0439435_0001848 3300042436 Bacteria 4042
377 Ga0439444_0008944 3300042437 Bacteria 1569
378 Ga0439464_0022711 3300042439 Bacteria 1730
379 Ga0439460_0005393 3300042461 Bacteria 3135
380 Ga0450918_000592 3300042531 Bacteria 7761
381 Ga0451577_0000142 3300042876 Bacteria 160598
382 Ga0453683_0001682 3300044673 Bacteria 18444
383 Ga0466965_0062588 3300044683 Bacteria 1861
384 Ga0453684_0000126 3300044712 Bacteria 336395
385 Ga0466960_0154459 3300044901 Bacteria 1228
386 Ga0451576_0044853 3300045051 Bacteria 4658
387 Ga0451576_0072775 3300045051 Bacteria 3576
388 Ga0451576_0134427 3300045051 Bacteria 2579
389 Ga0466967_0088801 3300045976 Bacteria 2805
390 Ga0495592_0001196 3300046454 Bacteria 18024
391 Ga0495605_0002853 3300046474 Bacteria 10517
392 Ga0495662_0021823 3300046476 Bacteria 3094
393 Ga0495596_0000335 3300046500 Bacteria 30658
394 Ga0495596_0032243 3300046500 Bacteria 2090
395 Ga0495583_0001878 3300046506 Bacteria 19527
396 Ga0495583_0029247 3300046506 Bacteria 2698
397 Ga0495606_0012887 3300046507 Bacteria 6656
398 Ga0495608_0003334 3300046511 Bacteria 11486
399 Ga0495616_0002637 3300046513 Bacteria 11790
400 Ga0495616_0007066 3300046513 Bacteria 6744
401 Ga0495620_0024367 3300046515 Bacteria 2878
402 Ga0495628_0003978 3300046516 Bacteria 13160
403 Ga0495628_0050622 3300046516 Bacteria 3285
404 Ga0495630_0236954 3300046517 Bacteria 1394
405 Ga0495631_0002010 3300046518 Bacteria 11851
406 Ga0495637_0004867 3300046520 Bacteria 6907
407 Ga0495666_0094367 3300046526 Bacteria 1411
408 Ga0495642_0006127 3300046528 Bacteria 4619
409 Ga0495652_0022688 3300046529 Bacteria 5570
410 Ga0495640_0017837 3300046533 Bacteria 5280
411 Ga0495640_0030674 3300046533 Bacteria 3846
412 Ga0495586_0006833 3300046535 Bacteria 6081
413 Ga0495587_0048534 3300046536 Bacteria 2514
414 Ga0495598_0043619 3300046537 Bacteria 1322
415 Ga0495621_0002691 3300046539 Bacteria 4816
416 Ga0495597_0001930 3300046542 Bacteria 13992
417 Ga0495645_0019723 3300046543 Bacteria 4857
418 Ga0495667_0052115 3300046559 Bacteria 2697
419 Ga0495656_0000202 3300046615 Bacteria 21338
420 Ga0495634_0001365 3300046642 Bacteria 22144
421 Ga0495625_0000637 3300046660 Bacteria 50416
422 Ga0495625_0119424 3300046660 Bacteria 1795
423 Ga0495588_0005864 3300046674 Bacteria 5500
424 Ga0495588_0029895 3300046674 Bacteria 2735
425 Ga0495588_0072893 3300046674 Bacteria 1787
426 Ga0495657_0057838 3300046675 Bacteria 2577
427 Ga0495657_0230675 3300046675 Bacteria 1120
428 Ga0495658_0011936 3300046683 Bacteria 4384
429 Ga0495658_0147668 3300046683 Bacteria 1442
430 Ga0495613_0029988 3300046689 Bacteria 4041
431 Ga0495624_0079348 3300046690 Bacteria 2036
432 Ga0495624_0105543 3300046690 Bacteria 1734
433 Ga0495670_0085716 3300046691 Bacteria 1608
434 Ga0495671_0005939 3300046692 Bacteria 7099
435 Ga0495671_0008248 3300046692 Bacteria 5872
436 Ga0495600_0012773 3300046809 Bacteria 5261
437 Ga0495604_0018102 3300047317 Bacteria 5639
438 Ga0495604_0236971 3300047317 Bacteria 1249
439 Ga0495636_0000875 3300047318 Bacteria 11128
440 Ga0495636_0008006 3300047318 Bacteria 4168
441 Ga0495676_0041433 3300047321 Bacteria 3790
442 Ga0495680_0000770 3300047322 Bacteria 35924
443 Ga0495680_0024114 3300047322 Bacteria 5049
444 Ga0495680_0081546 3300047322 Bacteria 2442
445 Ga0495677_0015280 3300047445 Bacteria 2790
446 Ga0495685_001591 3300047447 Bacteria 6993
447 Ga0495684_0078975 3300047471 Bacteria 2498
448 Ga0495593_0034289 3300047673 Bacteria 2761
449 Ga0495614_0019254 3300048089 Bacteria 2954
450 Ga0496100_0143066 3300048903 Bacteria 1697
451 Ga0496101_0001014 3300048904 Bacteria 16554
452 Ga0496102_0233122 3300048905 Bacteria 1735
453 Ga0496102_0350559 3300048905 Bacteria 1390
454 Ga0496103_0114364 3300048906 Bacteria 1715
455 Ga0496104_0007646 3300048907 Bacteria 9569
456 Ga0496105_0020999 3300048908 Bacteria 5281
457 Ga0496107_0132292 3300048910 Bacteria 1842
458 Ga0496109_0195159 3300048912 Bacteria 1903
459 Ga0496110_0101400 3300048913 Bacteria 2580
460 Ga0496114_0146016 3300048917 Bacteria 2050
461 Ga0496116_0003784 3300048919 Bacteria 14789
462 Ga0496116_0013289 3300048919 Bacteria 6652
463 Ga0496116_0030075 3300048919 Bacteria 3907
464 Ga0496117_0040746 3300048920 Bacteria 3411
465 Ga0496117_0043935 3300048920 Bacteria 3241
466 Ga0496117_0072694 3300048920 Bacteria 2297
467 Ga0496117_0110202 3300048920 Bacteria 1717
468 Ga0496118_0026715 3300048921 Bacteria 4908
469 Ga0496121_0039089 3300048924 Bacteria 4188
470 Ga0496122_0000103 3300048925 Bacteria 196819
471 Ga0496122_0001935 3300048925 Bacteria 31174
472 Ga0496123_0000261 3300048926 Bacteria 106547
473 Ga0496123_0002072 3300048926 Bacteria 25819
474 Ga0496123_0033921 3300048926 Bacteria 3666
475 Ga0496123_0108450 3300048926 Bacteria 1594
476 Ga0496124_0030634 3300048927 Bacteria 4772
477 Ga0496124_0084452 3300048927 Bacteria 2603
478 Ga0496124_0150339 3300048927 Bacteria 1827
479 Ga0496125_0085355 3300048928 Bacteria 2392
480 Ga0496126_0000031 3300048929 Bacteria 373371
481 Ga0501031_0001649 3300049568 Bacteria 14009
482 Ga0501034_0000379 3300049571 Bacteria 75837
483 Ga0501036_0292350 3300049572 Bacteria 1363
484 Ga0501039_0029736 3300049575 Bacteria 4209
485 Ga0501039_0064288 3300049575 Bacteria 2844
486 Ga0501040_0004819 3300049576 Bacteria 8742
487 Ga0501040_0050174 3300049576 Bacteria 2854
488 Ga0501041_0164151 3300049577 Bacteria 1389
489 Ga0501048_0063228 3300049582 Bacteria 2618
490 Ga0501048_0205713 3300049582 Bacteria 1396
491 Ga0501071_0327833 3300049587 Bacteria 1163
492 Ga0501072_0201153 3300049588 Bacteria 1588
493 Ga0501072_0351768 3300049588 Bacteria 1170
494 Ga0501074_0071657 3300049590 Bacteria 2491
495 Ga0501075_0011392 3300049591 Bacteria 6294
496 Ga0501076_0257511 3300049592 Bacteria 1428
497 Ga0501225_0009408 3300049705 Bacteria 2783
498 Ga0501079_0284597 3300049741 Bacteria 1293
499 Ga0501081_0011943 3300049743 Bacteria 5691
500 Ga0501262_000697 3300049759 Bacteria 3892
501 Ga0501269_010129 3300049766 Bacteria 1144
502 Ga0501045_0034151 3300049824 Bacteria 3691
503 nmdc:mga03683_8387_c1 3300050489 Bacteria 3633
504 nmdc:mga03n38_8334_c1 3300050490 Bacteria 3716
505 nmdc:mga00v17_9577_c1 3300050491 Bacteria 5248
506 nmdc:mga0k408_46207_c1 3300050493 Bacteria 2514
507 nmdc:mga0k408_517_c2 3300050493 Bacteria 17857
508 nmdc:mga06z11_111659_c1 3300050494 Bacteria 1514
509 nmdc:mga06z11_51836_c1 3300050494 Bacteria 2102
510 nmdc:mga07m45_1912_c1 3300050496 Bacteria 9618
511 nmdc:mga07m45_28493_c1 3300050496 Bacteria 3083
512 nmdc:mga07m45_34770_c1 3300050496 Bacteria 2802
513 nmdc:mga07m45_7137_c1 3300050496 Bacteria 5690
514 nmdc:mga05p37_61455_c1 3300050507 Bacteria 4624
515 nmdc:mga0qj67_99109_c1 3300050509 Bacteria 2348
516 nmdc:mga08y16_116148_c1 3300050511 Bacteria 2786
517 nmdc:mga0n895_505227_c1 3300050512 Bacteria 1218
518 nmdc:mga0n895_518091_c1 3300050512 Bacteria 1200
519 nmdc:mga0n895_90_c1 3300050512 Bacteria 52593
520 nmdc:mga0rr50_924_c1 3300050513 Bacteria 15875
521 nmdc:mga08x19_1368_c1 3300050514 Bacteria 15087
522 nmdc:mga08x19_22330_c1 3300050514 Bacteria 3918
523 nmdc:mga08x19_67157_c1 3300050514 Bacteria 2332
524 nmdc:mga0a205_117014_c1 3300050515 Bacteria 2564
525 nmdc:mga0a205_758298_c1 3300050515 Bacteria 819
526 Ga0495601_0142552 3300053077 Bacteria 1563
527 Ga0495601_0191360 3300053077 Bacteria 1337
528 Ga0500610_0160959 3300053079 Bacteria 1116
529 Ga0500643_011857 3300053087 Bacteria 3154
530 Ga0500644_0001247 3300053088 Bacteria 6981
531 Ga0500651_0000029 3300053093 Bacteria 113528
532 Ga0500571_001234 3300053110 Bacteria 11738
533 Ga0500593_000729 3300053117 Bacteria 12456
534 Ga0500594_0006928 3300053118 Bacteria 2555
535 Ga0500607_004123 3300053121 Bacteria 10147
536 Ga0500655_000253 3300053133 Bacteria 12573
537 Ga0500559_0006765 3300053136 Bacteria 5145
538 Ga0500568_0018165 3300053139 Bacteria 3084
539 Ga0500573_0021414 3300053140 Bacteria 3705
540 Ga0500574_001481 3300053141 Bacteria 3516
541 Ga0500627_0001256 3300053158 Bacteria 7015
542 Ga0500634_0018405 3300053161 Bacteria 3751
543 Ga0500645_000413 3300053730 Bacteria 29917
544 Ga0590074_021286 3300059423 Bacteria 1118
545 Ga0590075_009163 3300059424 Bacteria 2369
546 Ga0590075_016770 3300059424 Bacteria 1803
547 Ga0590077_021359 3300059426 Bacteria 1378

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10241256 Ga0307406_102412562 242
2 3300050515 nmdc:mga0a205_758298_c1 nmdc:mga0a205_758298_c1_26_784 243
3 3300049588 Ga0501072_0351768 Ga0501072_0351768_390_1154 254
4 3300049587 Ga0501071_0327833 Ga0501071_0327833_15_782 255
5 3300005406 Ga0070703_10061474 Ga0070703_100614741 257
6 3300035117 Ga0373953_0005311 Ga0373953_0005311_2162_2950 262
7 3300059426 Ga0590077_021359 Ga0590077_021359_361_1269 264
8 3300047318 Ga0495636_0000875 Ga0495636_0000875_8719_9627 265
9 3300005536 Ga0070697_100003309 Ga0070697_1000033099 273
10 3300035724 Ga0373933_0005384 Ga0373933_0005384_55_963 275
11 3300047322 Ga0495680_0081546 Ga0495680_0081546_1440_2348 275
12 3300035119 Ga0373956_0005123 Ga0373956_0005123_1100_2008 276
13 3300035120 Ga0373957_0026221 Ga0373957_0026221_975_1883 276
14 3300036401 Ga0373937_0003159 Ga0373937_0003159_1733_2641 276
15 3300039438 Ga0436360_1217697 Ga0436360_1217697_516_1427 276
16 3300047322 Ga0495680_0024114 Ga0495680_0024114_1270_2178 276
17 3300013102 Ga0157371_10000123 Ga0157371_1000012327 279
18 3300013307 Ga0157372_10000067 Ga0157372_1000006761 279
19 3300045976 Ga0466967_0088801 Ga0466967_0088801_497_1381 279
20 3300006844 Ga0075428_100072011 Ga0075428_1000720112 280
21 3300006880 Ga0075429_100066161 Ga0075429_1000661611 280
22 3300027682 Ga0209971_1008251 Ga0209971_10082515 280
23 3300041408 Ga0439453_0016796 Ga0439453_0016796_338_1246 280
24 3300042001 Ga0439441_001340 Ga0439441_001340_133_1041 280
25 3300042003 Ga0439443_005115 Ga0439443_005115_181_1089 280
26 3300042437 Ga0439444_0008944 Ga0439444_0008944_172_1080 280
27 3300042461 Ga0439460_0005393 Ga0439460_0005393_510_1418 280
28 3300050507 nmdc:mga05p37_61455_c1 nmdc:mga05p37_61455_c1_1599_2507 280
29 3300050509 nmdc:mga0qj67_99109_c1 nmdc:mga0qj67_99109_c1_1301_2209 280
30 3300009147 Ga0114129_10167578 Ga0114129_101675786 281
31 3300034957 Ga0373938_0015789 Ga0373938_0015789_568_1440 281
32 3300049592 Ga0501076_0257511 Ga0501076_0257511_31_903 281
33 3300003761 Ga0055535_1002162 Ga0055535_10021627 282
34 3300003762 Ga0055542_1000087 Ga0055542_1000087101 282
35 3300003773 Ga0055537_1000490 Ga0055537_10004906 282
36 3300003790 Ga0055528_1000242 Ga0055528_100024246 282
37 3300048907 Ga0496104_0007646 Ga0496104_0007646_21_869 282
38 3300048917 Ga0496114_0146016 Ga0496114_0146016_32_880 282
39 3300049766 Ga0501269_010129 Ga0501269_010129_24_872 282
40 3300048927 Ga0496124_0030634 Ga0496124_0030634_1281_2141 286
41 3300005334 Ga0068869_100020707 Ga0068869_1000207074 287
42 iso_pu_bacteria 2728369097 2729146964 288
43 iso_pu_bacteria 3007252601 3007256376 288
44 iso_pu_bacteria 639633007 639786227 288
45 3300005406 Ga0070703_10033858 Ga0070703_100338582 290
46 iso_pu_bacteria 2513237150 2513952890 290
47 iso_pu_bacteria 2513237165 2514042405 290
48 iso_pu_bacteria 2596583598 2597028778 290
49 iso_pu_bacteria 2599185178 2599445461 290
50 iso_pu_bacteria 2834641062 2834641836 290
51 iso_pu_bacteria 2858688981 2858695136 290
52 iso_pu_bacteria 2885266251 2885266888 290
53 iso_pu_bacteria 2928058823 2928062793 290
54 iso_pu_bacteria 8003400568 8003404620 290
55 3300006173 Ga0070716_100044268 Ga0070716_1000442682 291
56 3300006195 Ga0075366_10000517 Ga0075366_1000051712 291
57 3300021361 Ga0213872_10157299 Ga0213872_101572991 291
58 3300025939 Ga0207665_10081418 Ga0207665_100814182 291
59 3300039447 Ga0436361_0928448 Ga0436361_0928448_290_1165 291
60 3300046537 Ga0495598_0043619 Ga0495598_0043619_267_1145 291
61 3300050493 nmdc:mga0k408_517_c2 nmdc:mga0k408_517_c2_11646_12524 291
62 iso_pu_bacteria 2904479285 2904482637 291
63 iso_pu_bacteria 2939631187 2939635651 291
64 3300005458 Ga0070681_10183863 Ga0070681_101838632 292
65 3300025912 Ga0207707_10326222 Ga0207707_103262222 292
66 3300031250 Ga0265331_10066245 Ga0265331_100662452 292
67 3300031665 Ga0316575_10000472 Ga0316575_1000047211 292
68 3300032133 Ga0316583_10000683 Ga0316583_100006833 292
69 3300035112 Ga0373932_0071142 Ga0373932_0071142_144_1022 292
70 3300045051 Ga0451576_0134427 Ga0451576_0134427_592_1497 292
71 iso_pu_bacteria 2513020051 2513230264 292
72 iso_pu_bacteria 2599185214 2599624005 292
73 iso_pu_bacteria 2599185226 2599672016 292
74 iso_pu_bacteria 2599185227 2599681902 292
75 iso_pu_bacteria 2599185229 2599693915 292
76 iso_pu_bacteria 2643221628 2644162815 292
77 iso_pu_bacteria 2643221658 2644328766 292
78 iso_pu_bacteria 2643221672 2644398092 292
79 iso_pu_bacteria 2643221683 2644469204 292
80 iso_pu_bacteria 2738541277 2738719987 292
81 iso_pu_bacteria 2738541307 2738881488 292
82 iso_pu_bacteria 2738543019 2739279186 292
83 iso_pu_bacteria 2818991446 2819596457 292
84 iso_pu_bacteria 2831265667 2831270212 292
85 iso_pu_bacteria 2838054893 2838059983 292
86 iso_pu_bacteria 2842677519 2842682385 292
87 iso_pu_bacteria 2842733646 2842735979 292
88 iso_pu_bacteria 2842747753 2842748322 292
89 iso_pu_bacteria 2885192300 2885196188 292
90 iso_pu_bacteria 2885198086 2885199591 292
91 iso_pu_bacteria 2885211737 2885213136 292
92 iso_pu_bacteria 2899924645 2899931170 292
93 iso_pu_bacteria 2904449895 2904454829 292
94 iso_pu_bacteria 2904456579 2904462598 292
95 iso_pu_bacteria 2904541872 2904546811 292
96 iso_pu_bacteria 2919462493 2919464039 292
97 iso_pu_bacteria 2928037797 2928038053 292
98 iso_pu_bacteria 2928044640 2928046341 292
99 iso_pu_bacteria 2928051484 2928054033 292
100 iso_pu_bacteria 2928064002 2928065786 292
101 iso_pu_bacteria 2928070936 2928077891 292
102 iso_pu_bacteria 2928084124 2928088673 292
103 iso_pu_bacteria 2929160207 2929164284 292
104 iso_pu_bacteria 2929520902 2929523864 292
105 iso_pu_bacteria 2945909444 2945913046 292
106 iso_pu_bacteria 2945945610 2945946851 292
107 iso_pu_bacteria 2945972063 2945976568 292
108 iso_pu_bacteria 2945984333 2945984670 292
109 iso_pu_bacteria 2954767861 2954771601 292
110 3300003203 JGI25406J46586_10015910 JGI25406J46586_100159102 293
111 3300005293 Ga0065715_10139916 Ga0065715_101399162 293
112 3300005336 Ga0070680_100112944 Ga0070680_1001129442 293
113 3300005340 Ga0070689_100049510 Ga0070689_1000495103 293
114 3300005341 Ga0070691_10047960 Ga0070691_100479603 293
115 3300005435 Ga0070714_100077358 Ga0070714_1000773582 293
116 3300005436 Ga0070713_100473532 Ga0070713_1004735322 293
117 3300005444 Ga0070694_100133563 Ga0070694_1001335632 293
118 3300005444 Ga0070694_100151422 Ga0070694_1001514222 293
119 3300005444 Ga0070694_100159303 Ga0070694_1001593032 293
120 3300005518 Ga0070699_100003963 Ga0070699_10000396310 293
121 3300005518 Ga0070699_100023179 Ga0070699_1000231793 293
122 3300005530 Ga0070679_100298176 Ga0070679_1002981762 293
123 3300005545 Ga0070695_100002731 Ga0070695_1000027315 293
124 3300005546 Ga0070696_100000523 Ga0070696_1000005234 293
125 3300005547 Ga0070693_100364057 Ga0070693_1003640571 293
126 3300005549 Ga0070704_100009813 Ga0070704_1000098135 293
127 3300005549 Ga0070704_100265913 Ga0070704_1002659132 293
128 3300005985 Ga0081539_10000668 Ga0081539_1000066820 293
129 3300006051 Ga0075364_10052235 Ga0075364_100522353 293
130 3300006847 Ga0075431_100030053 Ga0075431_1000300532 293
131 3300006871 Ga0075434_100000083 Ga0075434_10000008329 293
132 3300006871 Ga0075434_100023583 Ga0075434_1000235832 293
133 3300006871 Ga0075434_100037499 Ga0075434_1000374991 293
134 3300006880 Ga0075429_100127368 Ga0075429_1001273682 293
135 3300006914 Ga0075436_100022009 Ga0075436_1000220092 293
136 3300006914 Ga0075436_100027856 Ga0075436_1000278564 293
137 3300006914 Ga0075436_100042280 Ga0075436_1000422802 293
138 3300007076 Ga0075435_100004854 Ga0075435_1000048546 293
139 3300007076 Ga0075435_100101313 Ga0075435_1001013132 293
140 3300009094 Ga0111539_10048579 Ga0111539_100485794 293
141 3300009147 Ga0114129_10452062 Ga0114129_104520622 293
142 3300025912 Ga0207707_10016765 Ga0207707_100167652 293
143 3300025917 Ga0207660_10027059 Ga0207660_100270595 293
144 3300025917 Ga0207660_10055123 Ga0207660_100551232 293
145 3300025921 Ga0207652_10280342 Ga0207652_102803422 293
146 3300026075 Ga0207708_10207519 Ga0207708_102075192 293
147 3300027360 Ga0209969_1002647 Ga0209969_10026474 293
148 3300027471 Ga0209995_1017097 Ga0209995_10170972 293
149 3300027526 Ga0209968_1008420 Ga0209968_10084202 293
150 3300027543 Ga0209999_1022464 Ga0209999_10224642 293
151 3300027907 Ga0207428_10277844 Ga0207428_102778442 293
152 3300032002 Ga0307416_100620116 Ga0307416_1006201161 293
153 3300035117 Ga0373953_0095300 Ga0373953_0095300_325_1233 293
154 3300035118 Ga0373954_0000012 Ga0373954_0000012_50561_51469 293
155 3300035172 Ga0373955_0154793 Ga0373955_0154793_359_1267 293
156 3300035691 Ga0373931_0083084 Ga0373931_0083084_277_1185 293
157 3300035724 Ga0373933_0034499 Ga0373933_0034499_854_1762 293
158 3300036401 Ga0373937_0001168 Ga0373937_0001168_4720_5628 293
159 3300036401 Ga0373937_0034989 Ga0373937_0034989_101_1009 293
160 3300039110 Ga0400487_47147 Ga0400487_47147_278_1159 293
161 3300042156 Ga0439446_0000219 Ga0439446_0000219_5551_6459 293
162 3300042436 Ga0439435_0001848 Ga0439435_0001848_722_1630 293
163 3300044683 Ga0466965_0062588 Ga0466965_0062588_523_1404 293
164 3300044901 Ga0466960_0154459 Ga0466960_0154459_18_899 293
165 3300045051 Ga0451576_0044853 Ga0451576_0044853_2216_3124 293
166 3300045051 Ga0451576_0072775 Ga0451576_0072775_173_1093 293
167 3300046454 Ga0495592_0001196 Ga0495592_0001196_16058_16966 293
168 3300046476 Ga0495662_0021823 Ga0495662_0021823_762_1670 293
169 3300046506 Ga0495583_0001878 Ga0495583_0001878_5658_6542 293
170 3300046506 Ga0495583_0029247 Ga0495583_0029247_1196_2080 293
171 3300046511 Ga0495608_0003334 Ga0495608_0003334_10201_11109 293
172 3300046516 Ga0495628_0003978 Ga0495628_0003978_2037_2945 293
173 3300046516 Ga0495628_0050622 Ga0495628_0050622_1342_2250 293
174 3300046517 Ga0495630_0236954 Ga0495630_0236954_423_1331 293
175 3300046526 Ga0495666_0094367 Ga0495666_0094367_244_1152 293
176 3300046529 Ga0495652_0022688 Ga0495652_0022688_308_1216 293
177 3300046533 Ga0495640_0017837 Ga0495640_0017837_2071_2979 293
178 3300046533 Ga0495640_0030674 Ga0495640_0030674_101_1009 293
179 3300046535 Ga0495586_0006833 Ga0495586_0006833_3011_3919 293
180 3300046536 Ga0495587_0048534 Ga0495587_0048534_1159_2067 293
181 3300046543 Ga0495645_0019723 Ga0495645_0019723_3573_4481 293
182 3300046559 Ga0495667_0052115 Ga0495667_0052115_1340_2248 293
183 3300046642 Ga0495634_0001365 Ga0495634_0001365_15204_16112 293
184 3300046674 Ga0495588_0072893 Ga0495588_0072893_432_1316 293
185 3300046675 Ga0495657_0230675 Ga0495657_0230675_194_1102 293
186 3300046683 Ga0495658_0147668 Ga0495658_0147668_99_1007 293
187 3300046689 Ga0495613_0029988 Ga0495613_0029988_358_1266 293
188 3300046690 Ga0495624_0079348 Ga0495624_0079348_800_1708 293
189 3300046809 Ga0495600_0012773 Ga0495600_0012773_225_1133 293
190 3300047317 Ga0495604_0018102 Ga0495604_0018102_2873_3781 293
191 3300047317 Ga0495604_0236971 Ga0495604_0236971_36_944 293
192 3300047322 Ga0495680_0000770 Ga0495680_0000770_14946_15854 293
193 3300047471 Ga0495684_0078975 Ga0495684_0078975_145_1053 293
194 3300048905 Ga0496102_0233122 Ga0496102_0233122_41_925 293
195 3300048912 Ga0496109_0195159 Ga0496109_0195159_502_1383 293
196 3300049572 Ga0501036_0292350 Ga0501036_0292350_47_955 293
197 3300049575 Ga0501039_0029736 Ga0501039_0029736_1375_2283 293
198 3300049575 Ga0501039_0064288 Ga0501039_0064288_1842_2762 293
199 3300049576 Ga0501040_0004819 Ga0501040_0004819_1531_2451 293
200 3300049576 Ga0501040_0050174 Ga0501040_0050174_370_1278 293
201 3300049577 Ga0501041_0164151 Ga0501041_0164151_365_1273 293
202 3300049582 Ga0501048_0063228 Ga0501048_0063228_181_1101 293
203 3300049582 Ga0501048_0205713 Ga0501048_0205713_388_1296 293
204 3300049588 Ga0501072_0201153 Ga0501072_0201153_182_1102 293
205 3300049590 Ga0501074_0071657 Ga0501074_0071657_352_1260 293
206 3300049591 Ga0501075_0011392 Ga0501075_0011392_3444_4352 293
207 3300049741 Ga0501079_0284597 Ga0501079_0284597_233_1141 293
208 3300049743 Ga0501081_0011943 Ga0501081_0011943_828_1736 293
209 3300049824 Ga0501045_0034151 Ga0501045_0034151_365_1273 293
210 3300050511 nmdc:mga08y16_116148_c1 nmdc:mga08y16_116148_c1_1130_2038 293
211 3300050512 nmdc:mga0n895_505227_c1 nmdc:mga0n895_505227_c1_239_1147 293
212 3300050512 nmdc:mga0n895_518091_c1 nmdc:mga0n895_518091_c1_66_974 293
213 3300050512 nmdc:mga0n895_90_c1 nmdc:mga0n895_90_c1_20438_21358 293
214 3300050513 nmdc:mga0rr50_924_c1 nmdc:mga0rr50_924_c1_4142_5062 293
215 3300050514 nmdc:mga08x19_1368_c1 nmdc:mga08x19_1368_c1_11067_11975 293
216 3300050514 nmdc:mga08x19_22330_c1 nmdc:mga08x19_22330_c1_128_1036 293
217 3300050514 nmdc:mga08x19_67157_c1 nmdc:mga08x19_67157_c1_470_1378 293
218 3300050515 nmdc:mga0a205_117014_c1 nmdc:mga0a205_117014_c1_536_1444 293
219 3300053077 Ga0495601_0142552 Ga0495601_0142552_481_1389 293
220 3300053077 Ga0495601_0191360 Ga0495601_0191360_418_1326 293
221 iso_pu_bacteria 2738543013 2739249856 293
222 3300002704 JGI25155J39150_1000079 JGI25155J39150_100007928 294
223 3300002705 JGI25156J39149_1000125 JGI25156J39149_100012528 294
224 3300002738 JGI25154J39366_1000141 JGI25154J39366_100014126 294
225 3300002741 JGI25157J39369_1000159 JGI25157J39369_100015928 294
226 3300002774 JGI25150J39212_1002448 JGI25150J39212_10024482 294
227 3300002987 JGI25159J45721_1000638 JGI25159J45721_100063811 294
228 3300002987 JGI25159J45721_1001149 JGI25159J45721_100114911 294
229 3300002987 JGI25159J45721_1003507 JGI25159J45721_10035072 294
230 3300003187 JGI25151J46595_10002430 JGI25151J46595_100024301 294
231 3300003187 JGI25151J46595_10011650 JGI25151J46595_100116502 294
232 3300003187 JGI25151J46595_10030161 JGI25151J46595_100301612 294
233 3300003187 JGI25151J46595_10068115 JGI25151J46595_100681151 294
234 3300003215 JGI25153J46596_10056704 JGI25153J46596_100567041 294
235 3300003354 JGI25160J50197_1000067 JGI25160J50197_100006784 294
236 3300003374 JGI25161J50226_1000035 JGI25161J50226_1000035105 294
237 3300003771 Ga0055526_1001094 Ga0055526_10010944 294
238 3300003773 Ga0055537_1002621 Ga0055537_10026212 294
239 3300003773 Ga0055537_1004715 Ga0055537_10047151 294
240 3300003775 Ga0055524_1000006 Ga0055524_100000681 294
241 3300003775 Ga0055524_1000360 Ga0055524_10003601 294
242 3300003775 Ga0055524_1001538 Ga0055524_10015384 294
243 3300003775 Ga0055524_1032458 Ga0055524_10324581 294
244 3300003781 Ga0055536_1001210 Ga0055536_10012104 294
245 3300003781 Ga0055536_1011696 Ga0055536_10116963 294
246 3300003784 Ga0055534_1001178 Ga0055534_100117812 294
247 3300003784 Ga0055534_1002450 Ga0055534_10024507 294
248 3300003784 Ga0055534_1019507 Ga0055534_10195071 294
249 3300003790 Ga0055528_1000374 Ga0055528_100037412 294
250 3300003791 Ga0055530_10000346 Ga0055530_1000034629 294
251 3300003791 Ga0055530_10031413 Ga0055530_100314132 294
252 3300003792 Ga0055540_1000005 Ga0055540_1000005233 294
253 3300003792 Ga0055540_1021135 Ga0055540_10211352 294
254 3300003794 Ga0055531_10000604 Ga0055531_1000060419 294
255 3300003794 Ga0055531_10000705 Ga0055531_100007055 294
256 3300004625 Ga0055543_1001289 Ga0055543_100128911 294
257 3300005262 Ga0065165_1013863 Ga0065165_10138635 294
258 3300005262 Ga0065165_1013875 Ga0065165_10138755 294
259 3300006058 Ga0075432_10014721 Ga0075432_100147212 294
260 3300006177 Ga0075362_10039428 Ga0075362_100394282 294
261 3300006353 Ga0075370_10163309 Ga0075370_101633092 294
262 3300006946 Ga0079104_1000002 Ga0079104_1000002148 294
263 3300006948 Ga0099826_10000004 Ga0099826_10000004441 294
264 3300006948 Ga0099826_10189649 Ga0099826_101896492 294
265 3300009011 Ga0105251_10049307 Ga0105251_100493072 294
266 3300009092 Ga0105250_10004264 Ga0105250_100042645 294
267 3300009148 Ga0105243_10002300 Ga0105243_100023007 294
268 3300009176 Ga0105242_10017149 Ga0105242_100171495 294
269 3300021361 Ga0213872_10001797 Ga0213872_100017972 294
270 3300025206 Ga0209435_100001 Ga0209435_10000125 294
271 3300025245 Ga0207425_1000863 Ga0207425_10008636 294
272 3300025245 Ga0207425_1002398 Ga0207425_10023987 294
273 3300025246 Ga0209646_1000001 Ga0209646_1000001394 294
274 3300025250 Ga0209026_1000003 Ga0209026_100000325 294
275 3300025256 Ga0209759_1000001 Ga0209759_100000125 294
276 3300025263 Ga0209565_1000124 Ga0209565_100012412 294
277 3300025263 Ga0209565_1000235 Ga0209565_100023549 294
278 3300025263 Ga0209565_1000498 Ga0209565_100049816 294
279 3300025263 Ga0209565_1008861 Ga0209565_10088612 294
280 3300025273 Ga0209673_1000043 Ga0209673_1000043171 294
281 3300025284 Ga0209130_1000442 Ga0209130_100044227 294
282 3300025284 Ga0209130_1000620 Ga0209130_100062019 294
283 3300025291 Ga0209675_1000125 Ga0209675_10001251 294
284 3300025291 Ga0209675_1000309 Ga0209675_10003098 294
285 3300025291 Ga0209675_1000312 Ga0209675_10003121 294
286 3300025291 Ga0209675_1007688 Ga0209675_10076885 294
287 3300025292 Ga0209676_1000007 Ga0209676_1000007466 294
288 3300025292 Ga0209676_1000014 Ga0209676_100001493 294
289 3300025292 Ga0209676_1009837 Ga0209676_10098372 294
290 3300025294 Ga0209025_1000232 Ga0209025_1000232115 294
291 3300025294 Ga0209025_1000246 Ga0209025_1000246150 294
292 3300025294 Ga0209025_1001132 Ga0209025_100113224 294
293 3300025294 Ga0209025_1001880 Ga0209025_100188010 294
294 3300025294 Ga0209025_1002427 Ga0209025_100242711 294
295 3300025294 Ga0209025_1004916 Ga0209025_10049165 294
296 3300025295 Ga0209564_1000268 Ga0209564_100026812 294
297 3300025295 Ga0209564_1000476 Ga0209564_100047611 294
298 3300025295 Ga0209564_1001012 Ga0209564_100101224 294
299 3300025295 Ga0209564_1003314 Ga0209564_100331411 294
300 3300025295 Ga0209564_1052362 Ga0209564_10523621 294
301 3300025297 Ga0209758_1004677 Ga0209758_10046777 294
302 3300025297 Ga0209758_1054966 Ga0209758_10549661 294
303 3300025298 Ga0209050_1000003 Ga0209050_10000031042 294
304 3300025298 Ga0209050_1004391 Ga0209050_100439111 294
305 3300025299 Ga0209256_1000001 Ga0209256_10000011048 294
306 3300025299 Ga0209256_1000291 Ga0209256_100029138 294
307 3300025299 Ga0209256_1000700 Ga0209256_100070037 294
308 3300025302 Ga0207426_1000247 Ga0207426_100024734 294
309 3300025302 Ga0207426_1002558 Ga0207426_10025588 294
310 3300025303 Ga0209051_1000003 Ga0209051_10000031042 294
311 3300025303 Ga0209051_1000320 Ga0209051_100032055 294
312 3300025303 Ga0209051_1043024 Ga0209051_10430241 294
313 3300025304 Ga0209257_1000020 Ga0209257_1000020466 294
314 3300025304 Ga0209257_1000161 Ga0209257_100016180 294
315 3300025304 Ga0209257_1017645 Ga0209257_10176453 294
316 3300025711 Ga0207696_1003880 Ga0207696_10038805 294
317 3300025909 Ga0207705_10233764 Ga0207705_102337642 294
318 3300025934 Ga0207686_10035403 Ga0207686_100354034 294
319 3300025935 Ga0207709_10000015 Ga0207709_10000015143 294
320 3300027111 Ga0209281_1000007 Ga0209281_1000007366 294
321 3300027666 Ga0209282_1000027 Ga0209282_100002748 294
322 3300027907 Ga0207428_10277477 Ga0207428_102774772 294
323 3300028786 Ga0307517_10243831 Ga0307517_102438311 294
324 3300031456 Ga0307513_10000054 Ga0307513_10000054112 294
325 3300031548 Ga0307408_100000617 Ga0307408_10000061711 294
326 3300031548 Ga0307408_100008657 Ga0307408_1000086573 294
327 3300031731 Ga0307405_10089794 Ga0307405_100897942 294
328 3300031901 Ga0307406_10001016 Ga0307406_100010167 294
329 3300036647 Ga0316582_0084073 Ga0316582_0084073_424_1317 294
330 3300039447 Ga0436361_1152527 Ga0436361_1152527_18379_19275 294
331 3300041459 Ga0451800_0811317 Ga0451800_0811317_26_910 294
332 3300046474 Ga0495605_0002853 Ga0495605_0002853_453_1337 294
333 3300046500 Ga0495596_0000335 Ga0495596_0000335_18764_19648 294
334 3300046500 Ga0495596_0032243 Ga0495596_0032243_292_1197 294
335 3300046507 Ga0495606_0012887 Ga0495606_0012887_1766_2671 294
336 3300046513 Ga0495616_0007066 Ga0495616_0007066_4352_5236 294
337 3300046542 Ga0495597_0001930 Ga0495597_0001930_3721_4617 294
338 3300046692 Ga0495671_0005939 Ga0495671_0005939_615_1499 294
339 3300047318 Ga0495636_0008006 Ga0495636_0008006_1075_1959 294
340 3300047447 Ga0495685_001591 Ga0495685_001591_2354_3238 294
341 3300048919 Ga0496116_0003784 Ga0496116_0003784_1395_2279 294
342 3300048919 Ga0496116_0013289 Ga0496116_0013289_957_1841 294
343 3300048925 Ga0496122_0001935 Ga0496122_0001935_18763_19647 294
344 3300048926 Ga0496123_0002072 Ga0496123_0002072_17952_18836 294
345 3300048926 Ga0496123_0033921 Ga0496123_0033921_1773_2669 294
346 3300048929 Ga0496126_0000031 Ga0496126_0000031_192638_193543 294
347 3300049571 Ga0501034_0000379 Ga0501034_0000379_63972_64856 294
348 3300050491 nmdc:mga00v17_9577_c1 nmdc:mga00v17_9577_c1_2259_3143 294
349 3300053088 Ga0500644_0001247 Ga0500644_0001247_4003_4887 294
350 3300053117 Ga0500593_000729 Ga0500593_000729_4386_5270 294
351 3300053730 Ga0500645_000413 Ga0500645_000413_24801_25685 294
352 iso_pu_bacteria 2547132374 2548500123 294
353 iso_pu_bacteria 2643221570 2643864837 294
354 iso_pu_bacteria 2643221596 2643991200 294
355 iso_pu_bacteria 2643221609 2644059903 294
356 iso_pu_bacteria 2643221611 2644074476 294
357 iso_pu_bacteria 2643221652 2644293927 294
358 iso_pu_bacteria 2643221717 2644644557 294
359 iso_pu_bacteria 2721755523 2722882399 294
360 iso_pu_bacteria 2738543012 2739241428 294
361 iso_pu_bacteria 2816332133 2816473592 294
362 iso_pu_bacteria 2839138175 2839142130 294
363 iso_pu_bacteria 2842718218 2842719036 294
364 iso_pu_bacteria 2900577576 2900581153 294
365 iso_pu_bacteria 2990710928 2990711719 294
366 iso_pu_bacteria 644736347 644747495 294
367 3300005577 Ga0068857_100559028 Ga0068857_1005590281 295
368 3300009174 Ga0105241_10156974 Ga0105241_101569743 295
369 3300010375 Ga0105239_10572032 Ga0105239_105720322 295
370 3300013297 Ga0157378_10516983 Ga0157378_105169831 295
371 3300013308 Ga0157375_10514764 Ga0157375_105147642 295
372 3300025942 Ga0207689_10246913 Ga0207689_102469132 295
373 3300027614 Ga0209970_1002734 Ga0209970_10027343 295
374 3300037312 Ga0395899_0005385 Ga0395899_0005385_709_1596 295
375 3300037418 Ga0395900_0001269 Ga0395900_0001269_24718_25605 295
376 3300037418 Ga0395900_0094874 Ga0395900_0094874_716_1603 295
377 3300037418 Ga0395900_0409209 Ga0395900_0409209_99_986 295
378 3300037466 Ga0395898_0048848 Ga0395898_0048848_2402_3289 295
379 3300037466 Ga0395898_0084784 Ga0395898_0084784_122_1009 295
380 3300037471 Ga0395905_0035418 Ga0395905_0035418_2790_3677 295
381 3300037471 Ga0395905_0170776 Ga0395905_0170776_816_1703 295
382 3300038443 Ga0395901_0290923 Ga0395901_0290923_476_1363 295
383 3300038443 Ga0395901_0334647 Ga0395901_0334647_525_1412 295
384 3300038443 Ga0395901_0353963 Ga0395901_0353963_430_1317 295
385 3300041411 Ga0439466_0041716 Ga0439466_0041716_314_1201 295
386 3300042007 Ga0439449_0000469 Ga0439449_0000469_10164_11051 295
387 3300042156 Ga0439446_0013925 Ga0439446_0013925_737_1624 295
388 3300042185 Ga0450909_006951 Ga0450909_006951_640_1527 295
389 3300042439 Ga0439464_0022711 Ga0439464_0022711_335_1222 295
390 3300042876 Ga0451577_0000142 Ga0451577_0000142_39804_40691 295
391 3300044673 Ga0453683_0001682 Ga0453683_0001682_16250_17137 295
392 3300044712 Ga0453684_0000126 Ga0453684_0000126_215601_216488 295
393 3300046528 Ga0495642_0006127 Ga0495642_0006127_1970_2857 295
394 3300047445 Ga0495677_0015280 Ga0495677_0015280_1734_2621 295
395 3300049568 Ga0501031_0001649 Ga0501031_0001649_5791_6690 295
396 3300050494 nmdc:mga06z11_111659_c1 nmdc:mga06z11_111659_c1_160_1047 295
397 3300059423 Ga0590074_021286 Ga0590074_021286_46_933 295
398 3300059424 Ga0590075_009163 Ga0590075_009163_1220_2107 295
399 3300059424 Ga0590075_016770 Ga0590075_016770_736_1623 295
400 iso_pu_bacteria 2894023352 2894024546 295
401 3300001989 JGI24739J22299_10037077 JGI24739J22299_100370772 296
402 3300002739 JGI25158J39367_1002898 JGI25158J39367_10028984 296
403 3300002773 JGI25152J39213_1023049 JGI25152J39213_10230491 296
404 3300002774 JGI25150J39212_1005975 JGI25150J39212_10059754 296
405 3300002987 JGI25159J45721_1010700 JGI25159J45721_10107001 296
406 3300003187 JGI25151J46595_10007994 JGI25151J46595_100079945 296
407 3300003578 Ga0006562J51391_1036758 Ga0006562J51391_10367582 296
408 3300003578 Ga0006562J51391_1036760 Ga0006562J51391_10367602 296
409 3300003578 Ga0006562J51391_1114748 Ga0006562J51391_11147481 296
410 3300003578 Ga0006562J51391_1114752 Ga0006562J51391_11147522 296
411 3300003781 Ga0055536_1003127 Ga0055536_10031271 296
412 3300003784 Ga0055534_1000042 Ga0055534_100004291 296
413 3300003784 Ga0055534_1000722 Ga0055534_10007222 296
414 3300003784 Ga0055534_1005829 Ga0055534_10058292 296
415 3300003784 Ga0055534_1008709 Ga0055534_10087092 296
416 3300003792 Ga0055540_1013970 Ga0055540_10139704 296
417 3300003792 Ga0055540_1017045 Ga0055540_10170452 296
418 3300005327 Ga0070658_10096585 Ga0070658_100965852 296
419 3300005356 Ga0070674_100131131 Ga0070674_1001311313 296
420 3300005367 Ga0070667_100085849 Ga0070667_1000858494 296
421 3300005539 Ga0068853_100005208 Ga0068853_1000052086 296
422 3300005564 Ga0070664_100149065 Ga0070664_1001490651 296
423 3300005577 Ga0068857_100169700 Ga0068857_1001697004 296
424 3300005844 Ga0068862_100070359 Ga0068862_1000703592 296
425 3300006038 Ga0075365_10100765 Ga0075365_101007652 296
426 3300006048 Ga0075363_100034165 Ga0075363_1000341654 296
427 3300006048 Ga0075363_100066165 Ga0075363_1000661652 296
428 3300006051 Ga0075364_10034160 Ga0075364_100341603 296
429 3300006177 Ga0075362_10001536 Ga0075362_100015362 296
430 3300006177 Ga0075362_10025368 Ga0075362_100253683 296
431 3300006177 Ga0075362_10048826 Ga0075362_100488264 296
432 3300006178 Ga0075367_10105055 Ga0075367_101050552 296
433 3300006195 Ga0075366_10010971 Ga0075366_100109712 296
434 3300006195 Ga0075366_10047092 Ga0075366_100470924 296
435 3300006353 Ga0075370_10002974 Ga0075370_100029746 296
436 3300006353 Ga0075370_10008542 Ga0075370_100085423 296
437 3300006353 Ga0075370_10011368 Ga0075370_100113683 296
438 3300006353 Ga0075370_10063049 Ga0075370_100630492 296
439 3300006358 Ga0068871_100053786 Ga0068871_1000537863 296
440 3300009036 Ga0105244_10004693 Ga0105244_100046938 296
441 3300009148 Ga0105243_10009710 Ga0105243_100097108 296
442 3300013100 Ga0157373_10027789 Ga0157373_100277891 296
443 3300013104 Ga0157370_10037489 Ga0157370_100374895 296
444 3300013105 Ga0157369_10013458 Ga0157369_100134584 296
445 3300013306 Ga0163162_10024877 Ga0163162_100248775 296
446 3300014497 Ga0182008_10000838 Ga0182008_100008387 296
447 3300014497 Ga0182008_10003873 Ga0182008_100038732 296
448 3300014497 Ga0182008_10011535 Ga0182008_100115354 296
449 3300014497 Ga0182008_10055610 Ga0182008_100556102 296
450 3300015261 Ga0182006_1002216 Ga0182006_10022164 296
451 3300015261 Ga0182006_1056801 Ga0182006_10568011 296
452 3300015262 Ga0182007_10000601 Ga0182007_1000060111 296
453 3300015262 Ga0182007_10000825 Ga0182007_1000082517 296
454 3300015683 Ga0183362_10003 Ga0183362_1000366 296
455 3300017792 Ga0163161_10011479 Ga0163161_100114793 296
456 3300017792 Ga0163161_10092071 Ga0163161_100920713 296
457 3300017792 Ga0163161_10161761 Ga0163161_101617612 296
458 3300025208 Ga0209436_107649 Ga0209436_1076491 296
459 3300025228 Ga0209672_101515 Ga0209672_1015157 296
460 3300025229 Ga0209147_103861 Ga0209147_1038612 296
461 3300025242 Ga0209258_100199 Ga0209258_1001997 296
462 3300025245 Ga0207425_1004716 Ga0207425_10047166 296
463 3300025254 Ga0209148_1000179 Ga0209148_10001797 296
464 3300025258 Ga0209129_1000071 Ga0209129_1000071126 296
465 3300025258 Ga0209129_1001902 Ga0209129_10019025 296
466 3300025263 Ga0209565_1000083 Ga0209565_100008392 296
467 3300025263 Ga0209565_1002195 Ga0209565_10021954 296
468 3300025273 Ga0209673_1000534 Ga0209673_100053455 296
469 3300025273 Ga0209673_1001906 Ga0209673_10019065 296
470 3300025273 Ga0209673_1020278 Ga0209673_10202781 296
471 3300025273 Ga0209673_1033411 Ga0209673_10334112 296
472 3300025284 Ga0209130_1000773 Ga0209130_100077326 296
473 3300025284 Ga0209130_1002969 Ga0209130_10029697 296
474 3300025291 Ga0209675_1000081 Ga0209675_100008192 296
475 3300025291 Ga0209675_1002859 Ga0209675_10028596 296
476 3300025291 Ga0209675_1006924 Ga0209675_10069246 296
477 3300025292 Ga0209676_1000005 Ga0209676_100000557 296
478 3300025292 Ga0209676_1001007 Ga0209676_10010072 296
479 3300025292 Ga0209676_1003004 Ga0209676_10030042 296
480 3300025292 Ga0209676_1030273 Ga0209676_10302732 296
481 3300025294 Ga0209025_1000544 Ga0209025_100054411 296
482 3300025294 Ga0209025_1000854 Ga0209025_100085453 296
483 3300025294 Ga0209025_1004201 Ga0209025_10042015 296
484 3300025294 Ga0209025_1007365 Ga0209025_10073656 296
485 3300025294 Ga0209025_1010312 Ga0209025_10103122 296
486 3300025295 Ga0209564_1000239 Ga0209564_100023949 296
487 3300025295 Ga0209564_1031042 Ga0209564_10310421 296
488 3300025295 Ga0209564_1033743 Ga0209564_10337431 296
489 3300025297 Ga0209758_1000027 Ga0209758_1000027383 296
490 3300025297 Ga0209758_1003037 Ga0209758_10030376 296
491 3300025298 Ga0209050_1000007 Ga0209050_10000071041 296
492 3300025298 Ga0209050_1001089 Ga0209050_10010892 296
493 3300025299 Ga0209256_1000081 Ga0209256_1000081126 296
494 3300025299 Ga0209256_1027019 Ga0209256_10270191 296
495 3300025302 Ga0207426_1000027 Ga0207426_1000027348 296
496 3300025302 Ga0207426_1000614 Ga0207426_100061450 296
497 3300025303 Ga0209051_1000009 Ga0209051_100000957 296
498 3300025303 Ga0209051_1000347 Ga0209051_100034760 296
499 3300025303 Ga0209051_1000373 Ga0209051_100037337 296
500 3300025303 Ga0209051_1000553 Ga0209051_100055338 296
501 3300025303 Ga0209051_1002578 Ga0209051_10025782 296
502 3300025303 Ga0209051_1036022 Ga0209051_10360222 296
503 3300025304 Ga0209257_1000011 Ga0209257_100001131 296
504 3300025304 Ga0209257_1000449 Ga0209257_100044957 296
505 3300025321 Ga0207656_10026603 Ga0207656_100266032 296
506 3300025728 Ga0207655_1001731 Ga0207655_100173114 296
507 3300025913 Ga0207695_10223244 Ga0207695_102232442 296
508 3300025923 Ga0207681_10082163 Ga0207681_100821634 296
509 3300025933 Ga0207706_10006469 Ga0207706_1000646912 296
510 3300025935 Ga0207709_10001584 Ga0207709_1000158412 296
511 3300025935 Ga0207709_10010549 Ga0207709_100105492 296
512 3300025937 Ga0207669_10016406 Ga0207669_100164063 296
513 3300025960 Ga0207651_10094176 Ga0207651_100941762 296
514 3300026041 Ga0207639_10125879 Ga0207639_101258792 296
515 3300026089 Ga0207648_10075188 Ga0207648_100751884 296
516 3300026121 Ga0207683_10035294 Ga0207683_100352945 296
517 3300026121 Ga0207683_10176934 Ga0207683_101769341 296
518 3300026142 Ga0207698_10095965 Ga0207698_100959652 296
519 3300027666 Ga0209282_1023309 Ga0209282_10233092 296
520 3300028379 Ga0268266_10013638 Ga0268266_100136384 296
521 3300030732 Ga0316176_1066153 Ga0316176_10661538 296
522 3300030733 Ga0314311_1174773 Ga0314311_11747738 296
523 3300030744 Ga0316181_1035278 Ga0316181_10352786 296
524 3300031251 Ga0265327_10089230 Ga0265327_100892302 296
525 3300031649 Ga0307514_10088797 Ga0307514_100887972 296
526 3300031731 Ga0307405_10001308 Ga0307405_1000130810 296
527 3300031731 Ga0307405_10045486 Ga0307405_100454864 296
528 3300031901 Ga0307406_10000749 Ga0307406_100007496 296
529 3300031911 Ga0307412_10035707 Ga0307412_100357072 296
530 3300031911 Ga0307412_10081245 Ga0307412_100812452 296
531 3300031911 Ga0307412_10159158 Ga0307412_101591582 296
532 3300032002 Ga0307416_100081998 Ga0307416_1000819984 296
533 3300032004 Ga0307414_10358703 Ga0307414_103587031 296
534 3300032005 Ga0307411_10104682 Ga0307411_101046821 296
535 3300041407 Ga0439447_005612 Ga0439447_005612_107_997 296
536 3300041410 Ga0439461_0005991 Ga0439461_0005991_217_1107 296
537 3300041410 Ga0439461_0016872 Ga0439461_0016872_193_1083 296
538 3300041411 Ga0439466_0010309 Ga0439466_0010309_2413_3303 296
539 3300041411 Ga0439466_0012586 Ga0439466_0012586_1604_2494 296
540 3300041486 Ga0451807_2067542 Ga0451807_2067542_101_991 296
541 3300041997 Ga0439431_0001255 Ga0439431_0001255_2469_3359 296
542 3300041999 Ga0439433_0000519 Ga0439433_0000519_5468_6358 296
543 3300042002 Ga0439442_000506 Ga0439442_000506_2438_3328 296
544 3300042004 Ga0439445_0001045 Ga0439445_0001045_955_1845 296
545 3300042006 Ga0439432_006319 Ga0439432_006319_3224_4114 296
546 3300042007 Ga0439449_0000720 Ga0439449_0000720_8462_9352 296
547 3300042010 Ga0439452_002385 Ga0439452_002385_224_1114 296
548 3300042125 Ga0450923_015944 Ga0450923_015944_32_922 296
549 3300042131 Ga0450894_005188 Ga0450894_005188_662_1552 296
550 3300042134 Ga0450898_006727 Ga0450898_006727_599_1489 296
551 3300042145 Ga0450906_001292 Ga0450906_001292_1214_2104 296
552 3300042145 Ga0450906_003902 Ga0450906_003902_1466_2356 296
553 3300042185 Ga0450909_005997 Ga0450909_005997_80_970 296
554 3300042435 Ga0439434_0001219 Ga0439434_0001219_2970_3860 296
555 3300042435 Ga0439434_0008117 Ga0439434_0008117_83_973 296
556 3300042531 Ga0450918_000592 Ga0450918_000592_4982_5872 296
557 3300046513 Ga0495616_0002637 Ga0495616_0002637_3501_4391 296
558 3300046515 Ga0495620_0024367 Ga0495620_0024367_936_1826 296
559 3300046518 Ga0495631_0002010 Ga0495631_0002010_8130_9020 296
560 3300046520 Ga0495637_0004867 Ga0495637_0004867_493_1383 296
561 3300046539 Ga0495621_0002691 Ga0495621_0002691_405_1295 296
562 3300046615 Ga0495656_0000202 Ga0495656_0000202_3361_4251 296
563 3300046660 Ga0495625_0000637 Ga0495625_0000637_44738_45628 296
564 3300046660 Ga0495625_0119424 Ga0495625_0119424_20_910 296
565 3300046674 Ga0495588_0005864 Ga0495588_0005864_2134_3024 296
566 3300046674 Ga0495588_0029895 Ga0495588_0029895_16_906 296
567 3300046675 Ga0495657_0057838 Ga0495657_0057838_1076_2002 296
568 3300046683 Ga0495658_0011936 Ga0495658_0011936_1385_2275 296
569 3300046690 Ga0495624_0105543 Ga0495624_0105543_79_1005 296
570 3300046691 Ga0495670_0085716 Ga0495670_0085716_246_1136 296
571 3300046692 Ga0495671_0008248 Ga0495671_0008248_1487_2377 296
572 3300047321 Ga0495676_0041433 Ga0495676_0041433_704_1594 296
573 3300047673 Ga0495593_0034289 Ga0495593_0034289_705_1595 296
574 3300048089 Ga0495614_0019254 Ga0495614_0019254_687_1577 296
575 3300048903 Ga0496100_0143066 Ga0496100_0143066_540_1466 296
576 3300048904 Ga0496101_0001014 Ga0496101_0001014_12265_13191 296
577 3300048905 Ga0496102_0350559 Ga0496102_0350559_50_940 296
578 3300048906 Ga0496103_0114364 Ga0496103_0114364_413_1339 296
579 3300048908 Ga0496105_0020999 Ga0496105_0020999_1845_2771 296
580 3300048910 Ga0496107_0132292 Ga0496107_0132292_649_1575 296
581 3300048913 Ga0496110_0101400 Ga0496110_0101400_1055_1981 296
582 3300048919 Ga0496116_0030075 Ga0496116_0030075_2416_3306 296
583 3300048920 Ga0496117_0040746 Ga0496117_0040746_2377_3267 296
584 3300048920 Ga0496117_0043935 Ga0496117_0043935_320_1210 296
585 3300048920 Ga0496117_0072694 Ga0496117_0072694_693_1583 296
586 3300048920 Ga0496117_0110202 Ga0496117_0110202_217_1143 296
587 3300048921 Ga0496118_0026715 Ga0496118_0026715_3272_4162 296
588 3300048924 Ga0496121_0039089 Ga0496121_0039089_2935_3825 296
589 3300048925 Ga0496122_0000103 Ga0496122_0000103_165305_166231 296
590 3300048926 Ga0496123_0000261 Ga0496123_0000261_30021_30947 296
591 3300048926 Ga0496123_0108450 Ga0496123_0108450_165_1055 296
592 3300048927 Ga0496124_0084452 Ga0496124_0084452_872_1798 296
593 3300048927 Ga0496124_0150339 Ga0496124_0150339_102_992 296
594 3300048928 Ga0496125_0085355 Ga0496125_0085355_675_1565 296
595 3300049705 Ga0501225_0009408 Ga0501225_0009408_1381_2271 296
596 3300049759 Ga0501262_000697 Ga0501262_000697_2252_3142 296
597 3300050489 nmdc:mga03683_8387_c1 nmdc:mga03683_8387_c1_2411_3301 296
598 3300050490 nmdc:mga03n38_8334_c1 nmdc:mga03n38_8334_c1_1123_2013 296
599 3300050493 nmdc:mga0k408_46207_c1 nmdc:mga0k408_46207_c1_630_1520 296
600 3300050494 nmdc:mga06z11_51836_c1 nmdc:mga06z11_51836_c1_506_1396 296
601 3300050496 nmdc:mga07m45_1912_c1 nmdc:mga07m45_1912_c1_1579_2469 296
602 3300050496 nmdc:mga07m45_28493_c1 nmdc:mga07m45_28493_c1_793_1683 296
603 3300050496 nmdc:mga07m45_34770_c1 nmdc:mga07m45_34770_c1_1572_2462 296
604 3300050496 nmdc:mga07m45_7137_c1 nmdc:mga07m45_7137_c1_830_1720 296
605 3300053079 Ga0500610_0160959 Ga0500610_0160959_52_942 296
606 3300053087 Ga0500643_011857 Ga0500643_011857_2249_3139 296
607 3300053093 Ga0500651_0000029 Ga0500651_0000029_72793_73683 296
608 3300053110 Ga0500571_001234 Ga0500571_001234_2867_3757 296
609 3300053118 Ga0500594_0006928 Ga0500594_0006928_1570_2460 296
610 3300053121 Ga0500607_004123 Ga0500607_004123_3631_4521 296
611 3300053133 Ga0500655_000253 Ga0500655_000253_3686_4576 296
612 3300053136 Ga0500559_0006765 Ga0500559_0006765_97_1023 296
613 3300053139 Ga0500568_0018165 Ga0500568_0018165_2139_3029 296
614 3300053140 Ga0500573_0021414 Ga0500573_0021414_456_1382 296
615 3300053141 Ga0500574_001481 Ga0500574_001481_258_1148 296
616 3300053158 Ga0500627_0001256 Ga0500627_0001256_809_1699 296
617 3300053161 Ga0500634_0018405 Ga0500634_0018405_707_1597 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

3

275

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.9802 5 294
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9799 3 294
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9795 3 294
3pud-assembly1.cif.gz_A crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution 0.9783 3 294
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9775 3 295
ID Description Score Start End Superfamily
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9706 5 294 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9672 5 294 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9663 5 294 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9654 3 289 3.20.20.70
5f1uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9607 2 289 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A540WHZ1-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9848 135 294 GO:0005829
GO:0008840
GO:0044281
AF-A0A521ZAB2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9835 3 295 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2V9Y7R4-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9834 149 296 GO:0005829
GO:0008840
AF-A0A520RXY2-F1-model_v4 Dihydrodipicolinate synthase 0.9834 201 292 GO:0005829
GO:0008840
AF-A0A2P5KB96-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9816 3 295 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Feature Viewer

pLDDT pTM Quality
93.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map