F469660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 403 | 547 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0088801|Ga0466967_0088801_497_1381 |
| Length | 279 |
| Sequence | MTQISGSLVAIVTPMHEDGSLDFPSLRKLIDWHIDEGTDGIVIVGTSGESPTVSVEEHRELIRVAVEQANKRIPLTAYAKQVGADASLQVVPYYNKPTQEGMYLHFRKVAESVDLPVILYNVPGRTVADMTVETMLRLADVPGIIGVKEATGNIDRAAQLIKGAPASFKIYSGDDPTAIALMLLGGHGNISVTANVAPRAMHELCAAAMRGDVETARRIHMQLLSVHKNLFVESNPIPVKWALQAMGKMEGGIRLPLTPLAPQYHEVVRASLKDAGLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 6 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 12 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 15 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 16 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 17 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 18 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 21 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 22 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 23 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 24 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 25 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 26 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 27 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 28 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 29 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 30 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 31 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 32 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 33 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 34 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 35 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 36 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 37 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 38 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 39 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 40 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 41 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 42 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 43 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 44 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 45 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 46 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 47 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 48 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 49 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 50 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 51 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 52 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 53 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 54 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 55 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 56 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 57 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 58 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 59 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 60 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 61 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 62 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 63 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 64 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 65 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 66 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 67 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 68 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 69 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 70 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 71 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 72 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 73 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 74 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 75 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 76 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 77 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 78 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 80 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 81 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 82 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 83 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 125 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 157 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 219 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 220 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 226 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 251 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 252 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 253 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 254 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 255 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 261 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 262 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 269 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 276 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 343 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 346 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 347 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 386 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 390 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 394 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 395 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 399 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 402 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 403 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.01 |
| Metatranscriptomes | 0.65 |
| Isolates | 11.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.82 |
| Nodule | 1.94 |
| Rhizoplane | 2.76 |
| Rhizosphere | 53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10037077 | 3300001989 | Bacteria | 1644 |
| 2 | JGI25155J39150_1000079 | 3300002704 | Bacteria | 56287 |
| 3 | JGI25156J39149_1000125 | 3300002705 | Bacteria | 56308 |
| 4 | JGI25154J39366_1000141 | 3300002738 | Bacteria | 56305 |
| 5 | JGI25158J39367_1002898 | 3300002739 | Bacteria | 2712 |
| 6 | JGI25157J39369_1000159 | 3300002741 | Bacteria | 56308 |
| 7 | JGI25152J39213_1023049 | 3300002773 | Bacteria | 1066 |
| 8 | JGI25150J39212_1002448 | 3300002774 | Bacteria | 4607 |
| 9 | JGI25150J39212_1005975 | 3300002774 | Bacteria | 2556 |
| 10 | JGI25159J45721_1000638 | 3300002987 | Bacteria | 15559 |
| 11 | JGI25159J45721_1001149 | 3300002987 | Bacteria | 11309 |
| 12 | JGI25159J45721_1003507 | 3300002987 | Bacteria | 5532 |
| 13 | JGI25159J45721_1010700 | 3300002987 | Bacteria | 2311 |
| 14 | JGI25151J46595_10002430 | 3300003187 | Bacteria | 11222 |
| 15 | JGI25151J46595_10007994 | 3300003187 | Bacteria | 5128 |
| 16 | JGI25151J46595_10011650 | 3300003187 | Bacteria | 4035 |
| 17 | JGI25151J46595_10030161 | 3300003187 | Bacteria | 2136 |
| 18 | JGI25151J46595_10068115 | 3300003187 | Bacteria | 1093 |
| 19 | JGI25406J46586_10015910 | 3300003203 | Bacteria | 3155 |
| 20 | JGI25153J46596_10056704 | 3300003215 | Bacteria | 1088 |
| 21 | JGI25160J50197_1000067 | 3300003354 | Bacteria | 113436 |
| 22 | JGI25161J50226_1000035 | 3300003374 | Bacteria | 133666 |
| 23 | Ga0006562J51391_1036758 | 3300003578 | Bacteria | 2990 |
| 24 | Ga0006562J51391_1036760 | 3300003578 | Bacteria | 1880 |
| 25 | Ga0006562J51391_1114748 | 3300003578 | Bacteria | 2843 |
| 26 | Ga0006562J51391_1114752 | 3300003578 | Bacteria | 1480 |
| 27 | Ga0055535_1002162 | 3300003761 | Bacteria | 7614 |
| 28 | Ga0055542_1000087 | 3300003762 | Bacteria | 123666 |
| 29 | Ga0055526_1001094 | 3300003771 | Bacteria | 19717 |
| 30 | Ga0055537_1000490 | 3300003773 | Bacteria | 24227 |
| 31 | Ga0055537_1002621 | 3300003773 | Bacteria | 5881 |
| 32 | Ga0055537_1004715 | 3300003773 | Bacteria | 3830 |
| 33 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 34 | Ga0055524_1000360 | 3300003775 | Bacteria | 40907 |
| 35 | Ga0055524_1001538 | 3300003775 | Bacteria | 13046 |
| 36 | Ga0055524_1032458 | 3300003775 | Bacteria | 1479 |
| 37 | Ga0055536_1001210 | 3300003781 | Bacteria | 16014 |
| 38 | Ga0055536_1003127 | 3300003781 | Bacteria | 8989 |
| 39 | Ga0055536_1011696 | 3300003781 | Bacteria | 3332 |
| 40 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 41 | Ga0055534_1000722 | 3300003784 | Bacteria | 15998 |
| 42 | Ga0055534_1001178 | 3300003784 | Bacteria | 10992 |
| 43 | Ga0055534_1002450 | 3300003784 | Bacteria | 6412 |
| 44 | Ga0055534_1005829 | 3300003784 | Bacteria | 3222 |
| 45 | Ga0055534_1008709 | 3300003784 | Bacteria | 2273 |
| 46 | Ga0055534_1019507 | 3300003784 | Bacteria | 1162 |
| 47 | Ga0055528_1000242 | 3300003790 | Bacteria | 45905 |
| 48 | Ga0055528_1000374 | 3300003790 | Bacteria | 36367 |
| 49 | Ga0055530_10000346 | 3300003791 | Bacteria | 41934 |
| 50 | Ga0055530_10031413 | 3300003791 | Bacteria | 1394 |
| 51 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 52 | Ga0055540_1013970 | 3300003792 | Bacteria | 2421 |
| 53 | Ga0055540_1017045 | 3300003792 | Bacteria | 2041 |
| 54 | Ga0055540_1021135 | 3300003792 | Bacteria | 1699 |
| 55 | Ga0055531_10000604 | 3300003794 | Bacteria | 31172 |
| 56 | Ga0055531_10000705 | 3300003794 | Bacteria | 28429 |
| 57 | Ga0055543_1001289 | 3300004625 | Bacteria | 10317 |
| 58 | Ga0065165_1013863 | 3300005262 | Bacteria | 3169 |
| 59 | Ga0065165_1013875 | 3300005262 | Bacteria | 3167 |
| 60 | Ga0065715_10139916 | 3300005293 | Bacteria | 1869 |
| 61 | Ga0070658_10096585 | 3300005327 | Bacteria | 2440 |
| 62 | Ga0068869_100020707 | 3300005334 | Bacteria | 4514 |
| 63 | Ga0070680_100112944 | 3300005336 | Bacteria | 2262 |
| 64 | Ga0070689_100049510 | 3300005340 | Bacteria | 3244 |
| 65 | Ga0070691_10047960 | 3300005341 | Bacteria | 2032 |
| 66 | Ga0070674_100131131 | 3300005356 | Bacteria | 1869 |
| 67 | Ga0070667_100085849 | 3300005367 | Bacteria | 2700 |
| 68 | Ga0070703_10033858 | 3300005406 | Bacteria | 1557 |
| 69 | Ga0070703_10061474 | 3300005406 | Bacteria | 1230 |
| 70 | Ga0070714_100077358 | 3300005435 | Bacteria | 2890 |
| 71 | Ga0070713_100473532 | 3300005436 | Bacteria | 1179 |
| 72 | Ga0070694_100133563 | 3300005444 | Bacteria | 1796 |
| 73 | Ga0070694_100151422 | 3300005444 | Bacteria | 1694 |
| 74 | Ga0070694_100159303 | 3300005444 | Bacteria | 1655 |
| 75 | Ga0070681_10183863 | 3300005458 | Bacteria | 2011 |
| 76 | Ga0070699_100003963 | 3300005518 | Bacteria | 13087 |
| 77 | Ga0070699_100023179 | 3300005518 | Bacteria | 5349 |
| 78 | Ga0070679_100298176 | 3300005530 | Bacteria | 1563 |
| 79 | Ga0070697_100003309 | 3300005536 | Bacteria | 12379 |
| 80 | Ga0068853_100005208 | 3300005539 | Bacteria | 10169 |
| 81 | Ga0070695_100002731 | 3300005545 | Bacteria | 10229 |
| 82 | Ga0070696_100000523 | 3300005546 | Bacteria | 24329 |
| 83 | Ga0070693_100364057 | 3300005547 | Bacteria | 993 |
| 84 | Ga0070704_100009813 | 3300005549 | Bacteria | 5806 |
| 85 | Ga0070704_100265913 | 3300005549 | Bacteria | 1415 |
| 86 | Ga0070664_100149065 | 3300005564 | Bacteria | 2065 |
| 87 | Ga0068857_100169700 | 3300005577 | Bacteria | 1983 |
| 88 | Ga0068857_100559028 | 3300005577 | Bacteria | 1078 |
| 89 | Ga0068862_100070359 | 3300005844 | Bacteria | 3021 |
| 90 | Ga0081539_10000668 | 3300005985 | Bacteria | 68754 |
| 91 | Ga0075365_10100765 | 3300006038 | Bacteria | 1977 |
| 92 | Ga0075363_100034165 | 3300006048 | Bacteria | 2653 |
| 93 | Ga0075363_100066165 | 3300006048 | Bacteria | 1955 |
| 94 | Ga0075364_10034160 | 3300006051 | Bacteria | 3279 |
| 95 | Ga0075364_10052235 | 3300006051 | Bacteria | 2671 |
| 96 | Ga0075432_10014721 | 3300006058 | Bacteria | 2664 |
| 97 | Ga0070716_100044268 | 3300006173 | Bacteria | 2493 |
| 98 | Ga0075362_10001536 | 3300006177 | Bacteria | 7443 |
| 99 | Ga0075362_10025368 | 3300006177 | Bacteria | 2523 |
| 100 | Ga0075362_10039428 | 3300006177 | Bacteria | 2077 |
| 101 | Ga0075362_10048826 | 3300006177 | Bacteria | 1889 |
| 102 | Ga0075367_10105055 | 3300006178 | Bacteria | 1729 |
| 103 | Ga0075366_10000517 | 3300006195 | Bacteria | 17834 |
| 104 | Ga0075366_10010971 | 3300006195 | Bacteria | 5100 |
| 105 | Ga0075366_10047092 | 3300006195 | Bacteria | 2556 |
| 106 | Ga0075370_10002974 | 3300006353 | Bacteria | 7966 |
| 107 | Ga0075370_10008542 | 3300006353 | Bacteria | 5276 |
| 108 | Ga0075370_10011368 | 3300006353 | Bacteria | 4674 |
| 109 | Ga0075370_10063049 | 3300006353 | Bacteria | 2112 |
| 110 | Ga0075370_10163309 | 3300006353 | Bacteria | 1308 |
| 111 | Ga0068871_100053786 | 3300006358 | Bacteria | 3264 |
| 112 | Ga0075428_100072011 | 3300006844 | Bacteria | 3777 |
| 113 | Ga0075431_100030053 | 3300006847 | Bacteria | 5595 |
| 114 | Ga0075434_100000083 | 3300006871 | Bacteria | 51151 |
| 115 | Ga0075434_100023583 | 3300006871 | Bacteria | 5999 |
| 116 | Ga0075434_100037499 | 3300006871 | Bacteria | 4798 |
| 117 | Ga0075429_100066161 | 3300006880 | Bacteria | 3146 |
| 118 | Ga0075429_100127368 | 3300006880 | Bacteria | 2227 |
| 119 | Ga0075436_100022009 | 3300006914 | Bacteria | 4377 |
| 120 | Ga0075436_100027856 | 3300006914 | Bacteria | 3889 |
| 121 | Ga0075436_100042280 | 3300006914 | Bacteria | 3143 |
| 122 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 123 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 124 | Ga0099826_10189649 | 3300006948 | Bacteria | 1135 |
| 125 | Ga0075435_100004854 | 3300007076 | Bacteria | 9307 |
| 126 | Ga0075435_100101313 | 3300007076 | Bacteria | 2386 |
| 127 | Ga0105251_10049307 | 3300009011 | Bacteria | 2016 |
| 128 | Ga0105244_10004693 | 3300009036 | Bacteria | 9311 |
| 129 | Ga0105250_10004264 | 3300009092 | Bacteria | 6610 |
| 130 | Ga0111539_10048579 | 3300009094 | Bacteria | 5065 |
| 131 | Ga0114129_10167578 | 3300009147 | Bacteria | 2996 |
| 132 | Ga0114129_10452062 | 3300009147 | Bacteria | 1685 |
| 133 | Ga0105243_10002300 | 3300009148 | Bacteria | 16025 |
| 134 | Ga0105243_10009710 | 3300009148 | Bacteria | 7328 |
| 135 | Ga0105241_10156974 | 3300009174 | Bacteria | 1867 |
| 136 | Ga0105242_10017149 | 3300009176 | Bacteria | 5638 |
| 137 | Ga0105239_10572032 | 3300010375 | Bacteria | 1288 |
| 138 | Ga0157373_10027789 | 3300013100 | Bacteria | 4081 |
| 139 | Ga0157371_10000123 | 3300013102 | Bacteria | 118119 |
| 140 | Ga0157370_10037489 | 3300013104 | Bacteria | 4699 |
| 141 | Ga0157369_10013458 | 3300013105 | Bacteria | 9246 |
| 142 | Ga0157378_10516983 | 3300013297 | Bacteria | 1195 |
| 143 | Ga0163162_10024877 | 3300013306 | Bacteria | 5914 |
| 144 | Ga0157372_10000067 | 3300013307 | Bacteria | 111621 |
| 145 | Ga0157375_10514764 | 3300013308 | Bacteria | 1360 |
| 146 | Ga0182008_10000838 | 3300014497 | Bacteria | 21458 |
| 147 | Ga0182008_10003873 | 3300014497 | Bacteria | 8884 |
| 148 | Ga0182008_10011535 | 3300014497 | Bacteria | 4693 |
| 149 | Ga0182008_10055610 | 3300014497 | Bacteria | 1957 |
| 150 | Ga0182006_1002216 | 3300015261 | Bacteria | 10773 |
| 151 | Ga0182006_1056801 | 3300015261 | Bacteria | 1489 |
| 152 | Ga0182007_10000601 | 3300015262 | Bacteria | 21082 |
| 153 | Ga0182007_10000825 | 3300015262 | Bacteria | 17267 |
| 154 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 155 | Ga0163161_10011479 | 3300017792 | Bacteria | 6147 |
| 156 | Ga0163161_10092071 | 3300017792 | Bacteria | 2244 |
| 157 | Ga0163161_10161761 | 3300017792 | Bacteria | 1707 |
| 158 | Ga0213872_10001797 | 3300021361 | Bacteria | 13357 |
| 159 | Ga0213872_10157299 | 3300021361 | Bacteria | 990 |
| 160 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 161 | Ga0209436_107649 | 3300025208 | Bacteria | 2233 |
| 162 | Ga0209672_101515 | 3300025228 | Bacteria | 8079 |
| 163 | Ga0209147_103861 | 3300025229 | Bacteria | 2705 |
| 164 | Ga0209258_100199 | 3300025242 | Bacteria | 123718 |
| 165 | Ga0207425_1000863 | 3300025245 | Bacteria | 14839 |
| 166 | Ga0207425_1002398 | 3300025245 | Bacteria | 6625 |
| 167 | Ga0207425_1004716 | 3300025245 | Bacteria | 4023 |
| 168 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 169 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 170 | Ga0209148_1000179 | 3300025254 | Bacteria | 126083 |
| 171 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 172 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 173 | Ga0209129_1001902 | 3300025258 | Bacteria | 11014 |
| 174 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 175 | Ga0209565_1000124 | 3300025263 | Bacteria | 110789 |
| 176 | Ga0209565_1000235 | 3300025263 | Bacteria | 60351 |
| 177 | Ga0209565_1000498 | 3300025263 | Bacteria | 28727 |
| 178 | Ga0209565_1002195 | 3300025263 | Bacteria | 7317 |
| 179 | Ga0209565_1008861 | 3300025263 | Bacteria | 2604 |
| 180 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 181 | Ga0209673_1000534 | 3300025273 | Bacteria | 62274 |
| 182 | Ga0209673_1001906 | 3300025273 | Bacteria | 16707 |
| 183 | Ga0209673_1020278 | 3300025273 | Bacteria | 2359 |
| 184 | Ga0209673_1033411 | 3300025273 | Bacteria | 1569 |
| 185 | Ga0209130_1000442 | 3300025284 | Bacteria | 43829 |
| 186 | Ga0209130_1000620 | 3300025284 | Bacteria | 33992 |
| 187 | Ga0209130_1000773 | 3300025284 | Bacteria | 27625 |
| 188 | Ga0209130_1002969 | 3300025284 | Bacteria | 7705 |
| 189 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 190 | Ga0209675_1000125 | 3300025291 | Bacteria | 105527 |
| 191 | Ga0209675_1000309 | 3300025291 | Bacteria | 44113 |
| 192 | Ga0209675_1000312 | 3300025291 | Bacteria | 43634 |
| 193 | Ga0209675_1002859 | 3300025291 | Bacteria | 8569 |
| 194 | Ga0209675_1006924 | 3300025291 | Bacteria | 4447 |
| 195 | Ga0209675_1007688 | 3300025291 | Bacteria | 4083 |
| 196 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 197 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 198 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 199 | Ga0209676_1001007 | 3300025292 | Bacteria | 33026 |
| 200 | Ga0209676_1003004 | 3300025292 | Bacteria | 10965 |
| 201 | Ga0209676_1009837 | 3300025292 | Bacteria | 4067 |
| 202 | Ga0209676_1030273 | 3300025292 | Bacteria | 1657 |
| 203 | Ga0209025_1000232 | 3300025294 | Bacteria | 130663 |
| 204 | Ga0209025_1000246 | 3300025294 | Bacteria | 127684 |
| 205 | Ga0209025_1000544 | 3300025294 | Bacteria | 70638 |
| 206 | Ga0209025_1000854 | 3300025294 | Bacteria | 48260 |
| 207 | Ga0209025_1001132 | 3300025294 | Bacteria | 38158 |
| 208 | Ga0209025_1001880 | 3300025294 | Bacteria | 24550 |
| 209 | Ga0209025_1002427 | 3300025294 | Bacteria | 19781 |
| 210 | Ga0209025_1004201 | 3300025294 | Bacteria | 12707 |
| 211 | Ga0209025_1004916 | 3300025294 | Bacteria | 11238 |
| 212 | Ga0209025_1007365 | 3300025294 | Bacteria | 8232 |
| 213 | Ga0209025_1010312 | 3300025294 | Bacteria | 6347 |
| 214 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 215 | Ga0209564_1000268 | 3300025295 | Bacteria | 109101 |
| 216 | Ga0209564_1000476 | 3300025295 | Bacteria | 67062 |
| 217 | Ga0209564_1001012 | 3300025295 | Bacteria | 34912 |
| 218 | Ga0209564_1003314 | 3300025295 | Bacteria | 11188 |
| 219 | Ga0209564_1031042 | 3300025295 | Bacteria | 1642 |
| 220 | Ga0209564_1033743 | 3300025295 | Bacteria | 1515 |
| 221 | Ga0209564_1052362 | 3300025295 | Bacteria | 982 |
| 222 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 223 | Ga0209758_1003037 | 3300025297 | Bacteria | 15990 |
| 224 | Ga0209758_1004677 | 3300025297 | Bacteria | 11192 |
| 225 | Ga0209758_1054966 | 3300025297 | Bacteria | 1356 |
| 226 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 227 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 228 | Ga0209050_1001089 | 3300025298 | Bacteria | 33034 |
| 229 | Ga0209050_1004391 | 3300025298 | Bacteria | 9566 |
| 230 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 231 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 232 | Ga0209256_1000291 | 3300025299 | Bacteria | 88153 |
| 233 | Ga0209256_1000700 | 3300025299 | Bacteria | 44602 |
| 234 | Ga0209256_1027019 | 3300025299 | Bacteria | 1642 |
| 235 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 236 | Ga0207426_1000247 | 3300025302 | Bacteria | 119659 |
| 237 | Ga0207426_1000614 | 3300025302 | Bacteria | 45951 |
| 238 | Ga0207426_1002558 | 3300025302 | Bacteria | 11384 |
| 239 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 240 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 241 | Ga0209051_1000320 | 3300025303 | Bacteria | 72764 |
| 242 | Ga0209051_1000347 | 3300025303 | Bacteria | 68841 |
| 243 | Ga0209051_1000373 | 3300025303 | Bacteria | 64348 |
| 244 | Ga0209051_1000553 | 3300025303 | Bacteria | 45537 |
| 245 | Ga0209051_1002578 | 3300025303 | Bacteria | 12758 |
| 246 | Ga0209051_1036022 | 3300025303 | Bacteria | 1833 |
| 247 | Ga0209051_1043024 | 3300025303 | Bacteria | 1589 |
| 248 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 249 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 250 | Ga0209257_1000161 | 3300025304 | Bacteria | 176089 |
| 251 | Ga0209257_1000449 | 3300025304 | Bacteria | 77522 |
| 252 | Ga0209257_1017645 | 3300025304 | Bacteria | 2798 |
| 253 | Ga0207656_10026603 | 3300025321 | Bacteria | 2361 |
| 254 | Ga0207696_1003880 | 3300025711 | Bacteria | 6616 |
| 255 | Ga0207655_1001731 | 3300025728 | Bacteria | 19151 |
| 256 | Ga0207705_10233764 | 3300025909 | Bacteria | 1399 |
| 257 | Ga0207707_10016765 | 3300025912 | Bacteria | 6382 |
| 258 | Ga0207707_10326222 | 3300025912 | Bacteria | 1325 |
| 259 | Ga0207695_10223244 | 3300025913 | Bacteria | 1791 |
| 260 | Ga0207660_10027059 | 3300025917 | Bacteria | 3910 |
| 261 | Ga0207660_10055123 | 3300025917 | Bacteria | 2839 |
| 262 | Ga0207652_10280342 | 3300025921 | Bacteria | 1503 |
| 263 | Ga0207681_10082163 | 3300025923 | Bacteria | 2277 |
| 264 | Ga0207706_10006469 | 3300025933 | Bacteria | 10879 |
| 265 | Ga0207686_10035403 | 3300025934 | Bacteria | 2997 |
| 266 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 267 | Ga0207709_10001584 | 3300025935 | Bacteria | 15523 |
| 268 | Ga0207709_10010549 | 3300025935 | Bacteria | 5088 |
| 269 | Ga0207669_10016406 | 3300025937 | Bacteria | 3762 |
| 270 | Ga0207665_10081418 | 3300025939 | Bacteria | 2229 |
| 271 | Ga0207689_10246913 | 3300025942 | Bacteria | 1476 |
| 272 | Ga0207651_10094176 | 3300025960 | Bacteria | 2202 |
| 273 | Ga0207639_10125879 | 3300026041 | Bacteria | 2113 |
| 274 | Ga0207708_10207519 | 3300026075 | Bacteria | 1565 |
| 275 | Ga0207648_10075188 | 3300026089 | Bacteria | 2945 |
| 276 | Ga0207683_10035294 | 3300026121 | Bacteria | 4348 |
| 277 | Ga0207683_10176934 | 3300026121 | Bacteria | 1934 |
| 278 | Ga0207698_10095965 | 3300026142 | Bacteria | 2442 |
| 279 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 280 | Ga0209969_1002647 | 3300027360 | Bacteria | 2480 |
| 281 | Ga0209995_1017097 | 3300027471 | Bacteria | 1193 |
| 282 | Ga0209968_1008420 | 3300027526 | Bacteria | 1571 |
| 283 | Ga0209999_1022464 | 3300027543 | Bacteria | 1161 |
| 284 | Ga0209970_1002734 | 3300027614 | Bacteria | 2981 |
| 285 | Ga0209282_1000027 | 3300027666 | Bacteria | 159842 |
| 286 | Ga0209282_1023309 | 3300027666 | Bacteria | 3893 |
| 287 | Ga0209971_1008251 | 3300027682 | Bacteria | 2470 |
| 288 | Ga0207428_10277477 | 3300027907 | Bacteria | 1245 |
| 289 | Ga0207428_10277844 | 3300027907 | Bacteria | 1244 |
| 290 | Ga0268266_10013638 | 3300028379 | Bacteria | 6999 |
| 291 | Ga0307517_10243831 | 3300028786 | Bacteria | 1063 |
| 292 | Ga0316176_1066153 | 3300030732 | Bacteria | 6972 |
| 293 | Ga0314311_1174773 | 3300030733 | Bacteria | 6162 |
| 294 | Ga0316181_1035278 | 3300030744 | Bacteria | 8135 |
| 295 | Ga0265331_10066245 | 3300031250 | Bacteria | 1697 |
| 296 | Ga0265327_10089230 | 3300031251 | Bacteria | 1506 |
| 297 | Ga0307513_10000054 | 3300031456 | Bacteria | 148887 |
| 298 | Ga0307408_100000617 | 3300031548 | Bacteria | 30246 |
| 299 | Ga0307408_100008657 | 3300031548 | Bacteria | 6720 |
| 300 | Ga0307514_10088797 | 3300031649 | Bacteria | 2261 |
| 301 | Ga0316575_10000472 | 3300031665 | Bacteria | 11577 |
| 302 | Ga0307405_10001308 | 3300031731 | Bacteria | 10408 |
| 303 | Ga0307405_10045486 | 3300031731 | Bacteria | 2690 |
| 304 | Ga0307405_10089794 | 3300031731 | Bacteria | 2031 |
| 305 | Ga0307406_10000749 | 3300031901 | Bacteria | 18227 |
| 306 | Ga0307406_10001016 | 3300031901 | Bacteria | 15602 |
| 307 | Ga0307406_10241256 | 3300031901 | Bacteria | 1356 |
| 308 | Ga0307412_10035707 | 3300031911 | Bacteria | 3178 |
| 309 | Ga0307412_10081245 | 3300031911 | Bacteria | 2241 |
| 310 | Ga0307412_10159158 | 3300031911 | Bacteria | 1675 |
| 311 | Ga0307416_100081998 | 3300032002 | Bacteria | 2730 |
| 312 | Ga0307416_100620116 | 3300032002 | Bacteria | 1163 |
| 313 | Ga0307414_10358703 | 3300032004 | Bacteria | 1253 |
| 314 | Ga0307411_10104682 | 3300032005 | Bacteria | 2010 |
| 315 | Ga0316583_10000683 | 3300032133 | Bacteria | 10431 |
| 316 | Ga0373938_0015789 | 3300034957 | Bacteria | 1468 |
| 317 | Ga0373932_0071142 | 3300035112 | Bacteria | 1079 |
| 318 | Ga0373953_0005311 | 3300035117 | Bacteria | 4170 |
| 319 | Ga0373953_0095300 | 3300035117 | Bacteria | 1248 |
| 320 | Ga0373954_0000012 | 3300035118 | Bacteria | 73616 |
| 321 | Ga0373956_0005123 | 3300035119 | Bacteria | 5245 |
| 322 | Ga0373957_0026221 | 3300035120 | Bacteria | 2106 |
| 323 | Ga0373955_0154793 | 3300035172 | Bacteria | 1350 |
| 324 | Ga0373931_0083084 | 3300035691 | Bacteria | 1771 |
| 325 | Ga0373933_0005384 | 3300035724 | Bacteria | 6968 |
| 326 | Ga0373933_0034499 | 3300035724 | Bacteria | 2949 |
| 327 | Ga0373937_0001168 | 3300036401 | Bacteria | 22061 |
| 328 | Ga0373937_0003159 | 3300036401 | Bacteria | 13788 |
| 329 | Ga0373937_0034989 | 3300036401 | Bacteria | 4569 |
| 330 | Ga0316582_0084073 | 3300036647 | Bacteria | 2083 |
| 331 | Ga0395899_0005385 | 3300037312 | Bacteria | 9941 |
| 332 | Ga0395900_0001269 | 3300037418 | Bacteria | 30864 |
| 333 | Ga0395900_0094874 | 3300037418 | Bacteria | 3065 |
| 334 | Ga0395900_0409209 | 3300037418 | Bacteria | 1319 |
| 335 | Ga0395898_0048848 | 3300037466 | Bacteria | 4147 |
| 336 | Ga0395898_0084784 | 3300037466 | Bacteria | 3054 |
| 337 | Ga0395905_0035418 | 3300037471 | Bacteria | 4687 |
| 338 | Ga0395905_0170776 | 3300037471 | Bacteria | 2042 |
| 339 | Ga0395901_0290923 | 3300038443 | Bacteria | 1695 |
| 340 | Ga0395901_0334647 | 3300038443 | Bacteria | 1564 |
| 341 | Ga0395901_0353963 | 3300038443 | Bacteria | 1515 |
| 342 | Ga0400487_47147 | 3300039110 | Bacteria | 5996 |
| 343 | Ga0436360_1217697 | 3300039438 | Bacteria | 1732 |
| 344 | Ga0436361_0928448 | 3300039447 | Bacteria | 1184 |
| 345 | Ga0436361_1152527 | 3300039447 | Bacteria | 20391 |
| 346 | Ga0439447_005612 | 3300041407 | Bacteria | 4153 |
| 347 | Ga0439453_0016796 | 3300041408 | Bacteria | 1279 |
| 348 | Ga0439461_0005991 | 3300041410 | Bacteria | 2102 |
| 349 | Ga0439461_0016872 | 3300041410 | Bacteria | 1414 |
| 350 | Ga0439466_0010309 | 3300041411 | Bacteria | 3474 |
| 351 | Ga0439466_0012586 | 3300041411 | Bacteria | 3114 |
| 352 | Ga0439466_0041716 | 3300041411 | Bacteria | 1530 |
| 353 | Ga0451800_0811317 | 3300041459 | Bacteria | 1541 |
| 354 | Ga0451807_2067542 | 3300041486 | Bacteria | 1242 |
| 355 | Ga0439431_0001255 | 3300041997 | Bacteria | 5559 |
| 356 | Ga0439433_0000519 | 3300041999 | Bacteria | 7235 |
| 357 | Ga0439441_001340 | 3300042001 | Bacteria | 3184 |
| 358 | Ga0439442_000506 | 3300042002 | Bacteria | 8767 |
| 359 | Ga0439443_005115 | 3300042003 | Bacteria | 1742 |
| 360 | Ga0439445_0001045 | 3300042004 | Bacteria | 5910 |
| 361 | Ga0439432_006319 | 3300042006 | Bacteria | 4237 |
| 362 | Ga0439449_0000469 | 3300042007 | Bacteria | 15091 |
| 363 | Ga0439449_0000720 | 3300042007 | Bacteria | 12664 |
| 364 | Ga0439452_002385 | 3300042010 | Bacteria | 6968 |
| 365 | Ga0450923_015944 | 3300042125 | Bacteria | 1410 |
| 366 | Ga0450894_005188 | 3300042131 | Bacteria | 1685 |
| 367 | Ga0450898_006727 | 3300042134 | Bacteria | 1774 |
| 368 | Ga0450906_001292 | 3300042145 | Bacteria | 5495 |
| 369 | Ga0450906_003902 | 3300042145 | Bacteria | 3160 |
| 370 | Ga0439446_0000219 | 3300042156 | Bacteria | 10507 |
| 371 | Ga0439446_0013925 | 3300042156 | Bacteria | 2213 |
| 372 | Ga0450909_005997 | 3300042185 | Bacteria | 1754 |
| 373 | Ga0450909_006951 | 3300042185 | Bacteria | 1633 |
| 374 | Ga0439434_0001219 | 3300042435 | Bacteria | 7405 |
| 375 | Ga0439434_0008117 | 3300042435 | Bacteria | 3078 |
| 376 | Ga0439435_0001848 | 3300042436 | Bacteria | 4042 |
| 377 | Ga0439444_0008944 | 3300042437 | Bacteria | 1569 |
| 378 | Ga0439464_0022711 | 3300042439 | Bacteria | 1730 |
| 379 | Ga0439460_0005393 | 3300042461 | Bacteria | 3135 |
| 380 | Ga0450918_000592 | 3300042531 | Bacteria | 7761 |
| 381 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 382 | Ga0453683_0001682 | 3300044673 | Bacteria | 18444 |
| 383 | Ga0466965_0062588 | 3300044683 | Bacteria | 1861 |
| 384 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 385 | Ga0466960_0154459 | 3300044901 | Bacteria | 1228 |
| 386 | Ga0451576_0044853 | 3300045051 | Bacteria | 4658 |
| 387 | Ga0451576_0072775 | 3300045051 | Bacteria | 3576 |
| 388 | Ga0451576_0134427 | 3300045051 | Bacteria | 2579 |
| 389 | Ga0466967_0088801 | 3300045976 | Bacteria | 2805 |
| 390 | Ga0495592_0001196 | 3300046454 | Bacteria | 18024 |
| 391 | Ga0495605_0002853 | 3300046474 | Bacteria | 10517 |
| 392 | Ga0495662_0021823 | 3300046476 | Bacteria | 3094 |
| 393 | Ga0495596_0000335 | 3300046500 | Bacteria | 30658 |
| 394 | Ga0495596_0032243 | 3300046500 | Bacteria | 2090 |
| 395 | Ga0495583_0001878 | 3300046506 | Bacteria | 19527 |
| 396 | Ga0495583_0029247 | 3300046506 | Bacteria | 2698 |
| 397 | Ga0495606_0012887 | 3300046507 | Bacteria | 6656 |
| 398 | Ga0495608_0003334 | 3300046511 | Bacteria | 11486 |
| 399 | Ga0495616_0002637 | 3300046513 | Bacteria | 11790 |
| 400 | Ga0495616_0007066 | 3300046513 | Bacteria | 6744 |
| 401 | Ga0495620_0024367 | 3300046515 | Bacteria | 2878 |
| 402 | Ga0495628_0003978 | 3300046516 | Bacteria | 13160 |
| 403 | Ga0495628_0050622 | 3300046516 | Bacteria | 3285 |
| 404 | Ga0495630_0236954 | 3300046517 | Bacteria | 1394 |
| 405 | Ga0495631_0002010 | 3300046518 | Bacteria | 11851 |
| 406 | Ga0495637_0004867 | 3300046520 | Bacteria | 6907 |
| 407 | Ga0495666_0094367 | 3300046526 | Bacteria | 1411 |
| 408 | Ga0495642_0006127 | 3300046528 | Bacteria | 4619 |
| 409 | Ga0495652_0022688 | 3300046529 | Bacteria | 5570 |
| 410 | Ga0495640_0017837 | 3300046533 | Bacteria | 5280 |
| 411 | Ga0495640_0030674 | 3300046533 | Bacteria | 3846 |
| 412 | Ga0495586_0006833 | 3300046535 | Bacteria | 6081 |
| 413 | Ga0495587_0048534 | 3300046536 | Bacteria | 2514 |
| 414 | Ga0495598_0043619 | 3300046537 | Bacteria | 1322 |
| 415 | Ga0495621_0002691 | 3300046539 | Bacteria | 4816 |
| 416 | Ga0495597_0001930 | 3300046542 | Bacteria | 13992 |
| 417 | Ga0495645_0019723 | 3300046543 | Bacteria | 4857 |
| 418 | Ga0495667_0052115 | 3300046559 | Bacteria | 2697 |
| 419 | Ga0495656_0000202 | 3300046615 | Bacteria | 21338 |
| 420 | Ga0495634_0001365 | 3300046642 | Bacteria | 22144 |
| 421 | Ga0495625_0000637 | 3300046660 | Bacteria | 50416 |
| 422 | Ga0495625_0119424 | 3300046660 | Bacteria | 1795 |
| 423 | Ga0495588_0005864 | 3300046674 | Bacteria | 5500 |
| 424 | Ga0495588_0029895 | 3300046674 | Bacteria | 2735 |
| 425 | Ga0495588_0072893 | 3300046674 | Bacteria | 1787 |
| 426 | Ga0495657_0057838 | 3300046675 | Bacteria | 2577 |
| 427 | Ga0495657_0230675 | 3300046675 | Bacteria | 1120 |
| 428 | Ga0495658_0011936 | 3300046683 | Bacteria | 4384 |
| 429 | Ga0495658_0147668 | 3300046683 | Bacteria | 1442 |
| 430 | Ga0495613_0029988 | 3300046689 | Bacteria | 4041 |
| 431 | Ga0495624_0079348 | 3300046690 | Bacteria | 2036 |
| 432 | Ga0495624_0105543 | 3300046690 | Bacteria | 1734 |
| 433 | Ga0495670_0085716 | 3300046691 | Bacteria | 1608 |
| 434 | Ga0495671_0005939 | 3300046692 | Bacteria | 7099 |
| 435 | Ga0495671_0008248 | 3300046692 | Bacteria | 5872 |
| 436 | Ga0495600_0012773 | 3300046809 | Bacteria | 5261 |
| 437 | Ga0495604_0018102 | 3300047317 | Bacteria | 5639 |
| 438 | Ga0495604_0236971 | 3300047317 | Bacteria | 1249 |
| 439 | Ga0495636_0000875 | 3300047318 | Bacteria | 11128 |
| 440 | Ga0495636_0008006 | 3300047318 | Bacteria | 4168 |
| 441 | Ga0495676_0041433 | 3300047321 | Bacteria | 3790 |
| 442 | Ga0495680_0000770 | 3300047322 | Bacteria | 35924 |
| 443 | Ga0495680_0024114 | 3300047322 | Bacteria | 5049 |
| 444 | Ga0495680_0081546 | 3300047322 | Bacteria | 2442 |
| 445 | Ga0495677_0015280 | 3300047445 | Bacteria | 2790 |
| 446 | Ga0495685_001591 | 3300047447 | Bacteria | 6993 |
| 447 | Ga0495684_0078975 | 3300047471 | Bacteria | 2498 |
| 448 | Ga0495593_0034289 | 3300047673 | Bacteria | 2761 |
| 449 | Ga0495614_0019254 | 3300048089 | Bacteria | 2954 |
| 450 | Ga0496100_0143066 | 3300048903 | Bacteria | 1697 |
| 451 | Ga0496101_0001014 | 3300048904 | Bacteria | 16554 |
| 452 | Ga0496102_0233122 | 3300048905 | Bacteria | 1735 |
| 453 | Ga0496102_0350559 | 3300048905 | Bacteria | 1390 |
| 454 | Ga0496103_0114364 | 3300048906 | Bacteria | 1715 |
| 455 | Ga0496104_0007646 | 3300048907 | Bacteria | 9569 |
| 456 | Ga0496105_0020999 | 3300048908 | Bacteria | 5281 |
| 457 | Ga0496107_0132292 | 3300048910 | Bacteria | 1842 |
| 458 | Ga0496109_0195159 | 3300048912 | Bacteria | 1903 |
| 459 | Ga0496110_0101400 | 3300048913 | Bacteria | 2580 |
| 460 | Ga0496114_0146016 | 3300048917 | Bacteria | 2050 |
| 461 | Ga0496116_0003784 | 3300048919 | Bacteria | 14789 |
| 462 | Ga0496116_0013289 | 3300048919 | Bacteria | 6652 |
| 463 | Ga0496116_0030075 | 3300048919 | Bacteria | 3907 |
| 464 | Ga0496117_0040746 | 3300048920 | Bacteria | 3411 |
| 465 | Ga0496117_0043935 | 3300048920 | Bacteria | 3241 |
| 466 | Ga0496117_0072694 | 3300048920 | Bacteria | 2297 |
| 467 | Ga0496117_0110202 | 3300048920 | Bacteria | 1717 |
| 468 | Ga0496118_0026715 | 3300048921 | Bacteria | 4908 |
| 469 | Ga0496121_0039089 | 3300048924 | Bacteria | 4188 |
| 470 | Ga0496122_0000103 | 3300048925 | Bacteria | 196819 |
| 471 | Ga0496122_0001935 | 3300048925 | Bacteria | 31174 |
| 472 | Ga0496123_0000261 | 3300048926 | Bacteria | 106547 |
| 473 | Ga0496123_0002072 | 3300048926 | Bacteria | 25819 |
| 474 | Ga0496123_0033921 | 3300048926 | Bacteria | 3666 |
| 475 | Ga0496123_0108450 | 3300048926 | Bacteria | 1594 |
| 476 | Ga0496124_0030634 | 3300048927 | Bacteria | 4772 |
| 477 | Ga0496124_0084452 | 3300048927 | Bacteria | 2603 |
| 478 | Ga0496124_0150339 | 3300048927 | Bacteria | 1827 |
| 479 | Ga0496125_0085355 | 3300048928 | Bacteria | 2392 |
| 480 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 481 | Ga0501031_0001649 | 3300049568 | Bacteria | 14009 |
| 482 | Ga0501034_0000379 | 3300049571 | Bacteria | 75837 |
| 483 | Ga0501036_0292350 | 3300049572 | Bacteria | 1363 |
| 484 | Ga0501039_0029736 | 3300049575 | Bacteria | 4209 |
| 485 | Ga0501039_0064288 | 3300049575 | Bacteria | 2844 |
| 486 | Ga0501040_0004819 | 3300049576 | Bacteria | 8742 |
| 487 | Ga0501040_0050174 | 3300049576 | Bacteria | 2854 |
| 488 | Ga0501041_0164151 | 3300049577 | Bacteria | 1389 |
| 489 | Ga0501048_0063228 | 3300049582 | Bacteria | 2618 |
| 490 | Ga0501048_0205713 | 3300049582 | Bacteria | 1396 |
| 491 | Ga0501071_0327833 | 3300049587 | Bacteria | 1163 |
| 492 | Ga0501072_0201153 | 3300049588 | Bacteria | 1588 |
| 493 | Ga0501072_0351768 | 3300049588 | Bacteria | 1170 |
| 494 | Ga0501074_0071657 | 3300049590 | Bacteria | 2491 |
| 495 | Ga0501075_0011392 | 3300049591 | Bacteria | 6294 |
| 496 | Ga0501076_0257511 | 3300049592 | Bacteria | 1428 |
| 497 | Ga0501225_0009408 | 3300049705 | Bacteria | 2783 |
| 498 | Ga0501079_0284597 | 3300049741 | Bacteria | 1293 |
| 499 | Ga0501081_0011943 | 3300049743 | Bacteria | 5691 |
| 500 | Ga0501262_000697 | 3300049759 | Bacteria | 3892 |
| 501 | Ga0501269_010129 | 3300049766 | Bacteria | 1144 |
| 502 | Ga0501045_0034151 | 3300049824 | Bacteria | 3691 |
| 503 | nmdc:mga03683_8387_c1 | 3300050489 | Bacteria | 3633 |
| 504 | nmdc:mga03n38_8334_c1 | 3300050490 | Bacteria | 3716 |
| 505 | nmdc:mga00v17_9577_c1 | 3300050491 | Bacteria | 5248 |
| 506 | nmdc:mga0k408_46207_c1 | 3300050493 | Bacteria | 2514 |
| 507 | nmdc:mga0k408_517_c2 | 3300050493 | Bacteria | 17857 |
| 508 | nmdc:mga06z11_111659_c1 | 3300050494 | Bacteria | 1514 |
| 509 | nmdc:mga06z11_51836_c1 | 3300050494 | Bacteria | 2102 |
| 510 | nmdc:mga07m45_1912_c1 | 3300050496 | Bacteria | 9618 |
| 511 | nmdc:mga07m45_28493_c1 | 3300050496 | Bacteria | 3083 |
| 512 | nmdc:mga07m45_34770_c1 | 3300050496 | Bacteria | 2802 |
| 513 | nmdc:mga07m45_7137_c1 | 3300050496 | Bacteria | 5690 |
| 514 | nmdc:mga05p37_61455_c1 | 3300050507 | Bacteria | 4624 |
| 515 | nmdc:mga0qj67_99109_c1 | 3300050509 | Bacteria | 2348 |
| 516 | nmdc:mga08y16_116148_c1 | 3300050511 | Bacteria | 2786 |
| 517 | nmdc:mga0n895_505227_c1 | 3300050512 | Bacteria | 1218 |
| 518 | nmdc:mga0n895_518091_c1 | 3300050512 | Bacteria | 1200 |
| 519 | nmdc:mga0n895_90_c1 | 3300050512 | Bacteria | 52593 |
| 520 | nmdc:mga0rr50_924_c1 | 3300050513 | Bacteria | 15875 |
| 521 | nmdc:mga08x19_1368_c1 | 3300050514 | Bacteria | 15087 |
| 522 | nmdc:mga08x19_22330_c1 | 3300050514 | Bacteria | 3918 |
| 523 | nmdc:mga08x19_67157_c1 | 3300050514 | Bacteria | 2332 |
| 524 | nmdc:mga0a205_117014_c1 | 3300050515 | Bacteria | 2564 |
| 525 | nmdc:mga0a205_758298_c1 | 3300050515 | Bacteria | 819 |
| 526 | Ga0495601_0142552 | 3300053077 | Bacteria | 1563 |
| 527 | Ga0495601_0191360 | 3300053077 | Bacteria | 1337 |
| 528 | Ga0500610_0160959 | 3300053079 | Bacteria | 1116 |
| 529 | Ga0500643_011857 | 3300053087 | Bacteria | 3154 |
| 530 | Ga0500644_0001247 | 3300053088 | Bacteria | 6981 |
| 531 | Ga0500651_0000029 | 3300053093 | Bacteria | 113528 |
| 532 | Ga0500571_001234 | 3300053110 | Bacteria | 11738 |
| 533 | Ga0500593_000729 | 3300053117 | Bacteria | 12456 |
| 534 | Ga0500594_0006928 | 3300053118 | Bacteria | 2555 |
| 535 | Ga0500607_004123 | 3300053121 | Bacteria | 10147 |
| 536 | Ga0500655_000253 | 3300053133 | Bacteria | 12573 |
| 537 | Ga0500559_0006765 | 3300053136 | Bacteria | 5145 |
| 538 | Ga0500568_0018165 | 3300053139 | Bacteria | 3084 |
| 539 | Ga0500573_0021414 | 3300053140 | Bacteria | 3705 |
| 540 | Ga0500574_001481 | 3300053141 | Bacteria | 3516 |
| 541 | Ga0500627_0001256 | 3300053158 | Bacteria | 7015 |
| 542 | Ga0500634_0018405 | 3300053161 | Bacteria | 3751 |
| 543 | Ga0500645_000413 | 3300053730 | Bacteria | 29917 |
| 544 | Ga0590074_021286 | 3300059423 | Bacteria | 1118 |
| 545 | Ga0590075_009163 | 3300059424 | Bacteria | 2369 |
| 546 | Ga0590075_016770 | 3300059424 | Bacteria | 1803 |
| 547 | Ga0590077_021359 | 3300059426 | Bacteria | 1378 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031901 | Ga0307406_10241256 | Ga0307406_102412562 | 242 |
| 2 | 3300050515 | nmdc:mga0a205_758298_c1 | nmdc:mga0a205_758298_c1_26_784 | 243 |
| 3 | 3300049588 | Ga0501072_0351768 | Ga0501072_0351768_390_1154 | 254 |
| 4 | 3300049587 | Ga0501071_0327833 | Ga0501071_0327833_15_782 | 255 |
| 5 | 3300005406 | Ga0070703_10061474 | Ga0070703_100614741 | 257 |
| 6 | 3300035117 | Ga0373953_0005311 | Ga0373953_0005311_2162_2950 | 262 |
| 7 | 3300059426 | Ga0590077_021359 | Ga0590077_021359_361_1269 | 264 |
| 8 | 3300047318 | Ga0495636_0000875 | Ga0495636_0000875_8719_9627 | 265 |
| 9 | 3300005536 | Ga0070697_100003309 | Ga0070697_1000033099 | 273 |
| 10 | 3300035724 | Ga0373933_0005384 | Ga0373933_0005384_55_963 | 275 |
| 11 | 3300047322 | Ga0495680_0081546 | Ga0495680_0081546_1440_2348 | 275 |
| 12 | 3300035119 | Ga0373956_0005123 | Ga0373956_0005123_1100_2008 | 276 |
| 13 | 3300035120 | Ga0373957_0026221 | Ga0373957_0026221_975_1883 | 276 |
| 14 | 3300036401 | Ga0373937_0003159 | Ga0373937_0003159_1733_2641 | 276 |
| 15 | 3300039438 | Ga0436360_1217697 | Ga0436360_1217697_516_1427 | 276 |
| 16 | 3300047322 | Ga0495680_0024114 | Ga0495680_0024114_1270_2178 | 276 |
| 17 | 3300013102 | Ga0157371_10000123 | Ga0157371_1000012327 | 279 |
| 18 | 3300013307 | Ga0157372_10000067 | Ga0157372_1000006761 | 279 |
| 19 | 3300045976 | Ga0466967_0088801 | Ga0466967_0088801_497_1381 | 279 |
| 20 | 3300006844 | Ga0075428_100072011 | Ga0075428_1000720112 | 280 |
| 21 | 3300006880 | Ga0075429_100066161 | Ga0075429_1000661611 | 280 |
| 22 | 3300027682 | Ga0209971_1008251 | Ga0209971_10082515 | 280 |
| 23 | 3300041408 | Ga0439453_0016796 | Ga0439453_0016796_338_1246 | 280 |
| 24 | 3300042001 | Ga0439441_001340 | Ga0439441_001340_133_1041 | 280 |
| 25 | 3300042003 | Ga0439443_005115 | Ga0439443_005115_181_1089 | 280 |
| 26 | 3300042437 | Ga0439444_0008944 | Ga0439444_0008944_172_1080 | 280 |
| 27 | 3300042461 | Ga0439460_0005393 | Ga0439460_0005393_510_1418 | 280 |
| 28 | 3300050507 | nmdc:mga05p37_61455_c1 | nmdc:mga05p37_61455_c1_1599_2507 | 280 |
| 29 | 3300050509 | nmdc:mga0qj67_99109_c1 | nmdc:mga0qj67_99109_c1_1301_2209 | 280 |
| 30 | 3300009147 | Ga0114129_10167578 | Ga0114129_101675786 | 281 |
| 31 | 3300034957 | Ga0373938_0015789 | Ga0373938_0015789_568_1440 | 281 |
| 32 | 3300049592 | Ga0501076_0257511 | Ga0501076_0257511_31_903 | 281 |
| 33 | 3300003761 | Ga0055535_1002162 | Ga0055535_10021627 | 282 |
| 34 | 3300003762 | Ga0055542_1000087 | Ga0055542_1000087101 | 282 |
| 35 | 3300003773 | Ga0055537_1000490 | Ga0055537_10004906 | 282 |
| 36 | 3300003790 | Ga0055528_1000242 | Ga0055528_100024246 | 282 |
| 37 | 3300048907 | Ga0496104_0007646 | Ga0496104_0007646_21_869 | 282 |
| 38 | 3300048917 | Ga0496114_0146016 | Ga0496114_0146016_32_880 | 282 |
| 39 | 3300049766 | Ga0501269_010129 | Ga0501269_010129_24_872 | 282 |
| 40 | 3300048927 | Ga0496124_0030634 | Ga0496124_0030634_1281_2141 | 286 |
| 41 | 3300005334 | Ga0068869_100020707 | Ga0068869_1000207074 | 287 |
| 42 | iso_pu_bacteria | 2728369097 | 2729146964 | 288 |
| 43 | iso_pu_bacteria | 3007252601 | 3007256376 | 288 |
| 44 | iso_pu_bacteria | 639633007 | 639786227 | 288 |
| 45 | 3300005406 | Ga0070703_10033858 | Ga0070703_100338582 | 290 |
| 46 | iso_pu_bacteria | 2513237150 | 2513952890 | 290 |
| 47 | iso_pu_bacteria | 2513237165 | 2514042405 | 290 |
| 48 | iso_pu_bacteria | 2596583598 | 2597028778 | 290 |
| 49 | iso_pu_bacteria | 2599185178 | 2599445461 | 290 |
| 50 | iso_pu_bacteria | 2834641062 | 2834641836 | 290 |
| 51 | iso_pu_bacteria | 2858688981 | 2858695136 | 290 |
| 52 | iso_pu_bacteria | 2885266251 | 2885266888 | 290 |
| 53 | iso_pu_bacteria | 2928058823 | 2928062793 | 290 |
| 54 | iso_pu_bacteria | 8003400568 | 8003404620 | 290 |
| 55 | 3300006173 | Ga0070716_100044268 | Ga0070716_1000442682 | 291 |
| 56 | 3300006195 | Ga0075366_10000517 | Ga0075366_1000051712 | 291 |
| 57 | 3300021361 | Ga0213872_10157299 | Ga0213872_101572991 | 291 |
| 58 | 3300025939 | Ga0207665_10081418 | Ga0207665_100814182 | 291 |
| 59 | 3300039447 | Ga0436361_0928448 | Ga0436361_0928448_290_1165 | 291 |
| 60 | 3300046537 | Ga0495598_0043619 | Ga0495598_0043619_267_1145 | 291 |
| 61 | 3300050493 | nmdc:mga0k408_517_c2 | nmdc:mga0k408_517_c2_11646_12524 | 291 |
| 62 | iso_pu_bacteria | 2904479285 | 2904482637 | 291 |
| 63 | iso_pu_bacteria | 2939631187 | 2939635651 | 291 |
| 64 | 3300005458 | Ga0070681_10183863 | Ga0070681_101838632 | 292 |
| 65 | 3300025912 | Ga0207707_10326222 | Ga0207707_103262222 | 292 |
| 66 | 3300031250 | Ga0265331_10066245 | Ga0265331_100662452 | 292 |
| 67 | 3300031665 | Ga0316575_10000472 | Ga0316575_1000047211 | 292 |
| 68 | 3300032133 | Ga0316583_10000683 | Ga0316583_100006833 | 292 |
| 69 | 3300035112 | Ga0373932_0071142 | Ga0373932_0071142_144_1022 | 292 |
| 70 | 3300045051 | Ga0451576_0134427 | Ga0451576_0134427_592_1497 | 292 |
| 71 | iso_pu_bacteria | 2513020051 | 2513230264 | 292 |
| 72 | iso_pu_bacteria | 2599185214 | 2599624005 | 292 |
| 73 | iso_pu_bacteria | 2599185226 | 2599672016 | 292 |
| 74 | iso_pu_bacteria | 2599185227 | 2599681902 | 292 |
| 75 | iso_pu_bacteria | 2599185229 | 2599693915 | 292 |
| 76 | iso_pu_bacteria | 2643221628 | 2644162815 | 292 |
| 77 | iso_pu_bacteria | 2643221658 | 2644328766 | 292 |
| 78 | iso_pu_bacteria | 2643221672 | 2644398092 | 292 |
| 79 | iso_pu_bacteria | 2643221683 | 2644469204 | 292 |
| 80 | iso_pu_bacteria | 2738541277 | 2738719987 | 292 |
| 81 | iso_pu_bacteria | 2738541307 | 2738881488 | 292 |
| 82 | iso_pu_bacteria | 2738543019 | 2739279186 | 292 |
| 83 | iso_pu_bacteria | 2818991446 | 2819596457 | 292 |
| 84 | iso_pu_bacteria | 2831265667 | 2831270212 | 292 |
| 85 | iso_pu_bacteria | 2838054893 | 2838059983 | 292 |
| 86 | iso_pu_bacteria | 2842677519 | 2842682385 | 292 |
| 87 | iso_pu_bacteria | 2842733646 | 2842735979 | 292 |
| 88 | iso_pu_bacteria | 2842747753 | 2842748322 | 292 |
| 89 | iso_pu_bacteria | 2885192300 | 2885196188 | 292 |
| 90 | iso_pu_bacteria | 2885198086 | 2885199591 | 292 |
| 91 | iso_pu_bacteria | 2885211737 | 2885213136 | 292 |
| 92 | iso_pu_bacteria | 2899924645 | 2899931170 | 292 |
| 93 | iso_pu_bacteria | 2904449895 | 2904454829 | 292 |
| 94 | iso_pu_bacteria | 2904456579 | 2904462598 | 292 |
| 95 | iso_pu_bacteria | 2904541872 | 2904546811 | 292 |
| 96 | iso_pu_bacteria | 2919462493 | 2919464039 | 292 |
| 97 | iso_pu_bacteria | 2928037797 | 2928038053 | 292 |
| 98 | iso_pu_bacteria | 2928044640 | 2928046341 | 292 |
| 99 | iso_pu_bacteria | 2928051484 | 2928054033 | 292 |
| 100 | iso_pu_bacteria | 2928064002 | 2928065786 | 292 |
| 101 | iso_pu_bacteria | 2928070936 | 2928077891 | 292 |
| 102 | iso_pu_bacteria | 2928084124 | 2928088673 | 292 |
| 103 | iso_pu_bacteria | 2929160207 | 2929164284 | 292 |
| 104 | iso_pu_bacteria | 2929520902 | 2929523864 | 292 |
| 105 | iso_pu_bacteria | 2945909444 | 2945913046 | 292 |
| 106 | iso_pu_bacteria | 2945945610 | 2945946851 | 292 |
| 107 | iso_pu_bacteria | 2945972063 | 2945976568 | 292 |
| 108 | iso_pu_bacteria | 2945984333 | 2945984670 | 292 |
| 109 | iso_pu_bacteria | 2954767861 | 2954771601 | 292 |
| 110 | 3300003203 | JGI25406J46586_10015910 | JGI25406J46586_100159102 | 293 |
| 111 | 3300005293 | Ga0065715_10139916 | Ga0065715_101399162 | 293 |
| 112 | 3300005336 | Ga0070680_100112944 | Ga0070680_1001129442 | 293 |
| 113 | 3300005340 | Ga0070689_100049510 | Ga0070689_1000495103 | 293 |
| 114 | 3300005341 | Ga0070691_10047960 | Ga0070691_100479603 | 293 |
| 115 | 3300005435 | Ga0070714_100077358 | Ga0070714_1000773582 | 293 |
| 116 | 3300005436 | Ga0070713_100473532 | Ga0070713_1004735322 | 293 |
| 117 | 3300005444 | Ga0070694_100133563 | Ga0070694_1001335632 | 293 |
| 118 | 3300005444 | Ga0070694_100151422 | Ga0070694_1001514222 | 293 |
| 119 | 3300005444 | Ga0070694_100159303 | Ga0070694_1001593032 | 293 |
| 120 | 3300005518 | Ga0070699_100003963 | Ga0070699_10000396310 | 293 |
| 121 | 3300005518 | Ga0070699_100023179 | Ga0070699_1000231793 | 293 |
| 122 | 3300005530 | Ga0070679_100298176 | Ga0070679_1002981762 | 293 |
| 123 | 3300005545 | Ga0070695_100002731 | Ga0070695_1000027315 | 293 |
| 124 | 3300005546 | Ga0070696_100000523 | Ga0070696_1000005234 | 293 |
| 125 | 3300005547 | Ga0070693_100364057 | Ga0070693_1003640571 | 293 |
| 126 | 3300005549 | Ga0070704_100009813 | Ga0070704_1000098135 | 293 |
| 127 | 3300005549 | Ga0070704_100265913 | Ga0070704_1002659132 | 293 |
| 128 | 3300005985 | Ga0081539_10000668 | Ga0081539_1000066820 | 293 |
| 129 | 3300006051 | Ga0075364_10052235 | Ga0075364_100522353 | 293 |
| 130 | 3300006847 | Ga0075431_100030053 | Ga0075431_1000300532 | 293 |
| 131 | 3300006871 | Ga0075434_100000083 | Ga0075434_10000008329 | 293 |
| 132 | 3300006871 | Ga0075434_100023583 | Ga0075434_1000235832 | 293 |
| 133 | 3300006871 | Ga0075434_100037499 | Ga0075434_1000374991 | 293 |
| 134 | 3300006880 | Ga0075429_100127368 | Ga0075429_1001273682 | 293 |
| 135 | 3300006914 | Ga0075436_100022009 | Ga0075436_1000220092 | 293 |
| 136 | 3300006914 | Ga0075436_100027856 | Ga0075436_1000278564 | 293 |
| 137 | 3300006914 | Ga0075436_100042280 | Ga0075436_1000422802 | 293 |
| 138 | 3300007076 | Ga0075435_100004854 | Ga0075435_1000048546 | 293 |
| 139 | 3300007076 | Ga0075435_100101313 | Ga0075435_1001013132 | 293 |
| 140 | 3300009094 | Ga0111539_10048579 | Ga0111539_100485794 | 293 |
| 141 | 3300009147 | Ga0114129_10452062 | Ga0114129_104520622 | 293 |
| 142 | 3300025912 | Ga0207707_10016765 | Ga0207707_100167652 | 293 |
| 143 | 3300025917 | Ga0207660_10027059 | Ga0207660_100270595 | 293 |
| 144 | 3300025917 | Ga0207660_10055123 | Ga0207660_100551232 | 293 |
| 145 | 3300025921 | Ga0207652_10280342 | Ga0207652_102803422 | 293 |
| 146 | 3300026075 | Ga0207708_10207519 | Ga0207708_102075192 | 293 |
| 147 | 3300027360 | Ga0209969_1002647 | Ga0209969_10026474 | 293 |
| 148 | 3300027471 | Ga0209995_1017097 | Ga0209995_10170972 | 293 |
| 149 | 3300027526 | Ga0209968_1008420 | Ga0209968_10084202 | 293 |
| 150 | 3300027543 | Ga0209999_1022464 | Ga0209999_10224642 | 293 |
| 151 | 3300027907 | Ga0207428_10277844 | Ga0207428_102778442 | 293 |
| 152 | 3300032002 | Ga0307416_100620116 | Ga0307416_1006201161 | 293 |
| 153 | 3300035117 | Ga0373953_0095300 | Ga0373953_0095300_325_1233 | 293 |
| 154 | 3300035118 | Ga0373954_0000012 | Ga0373954_0000012_50561_51469 | 293 |
| 155 | 3300035172 | Ga0373955_0154793 | Ga0373955_0154793_359_1267 | 293 |
| 156 | 3300035691 | Ga0373931_0083084 | Ga0373931_0083084_277_1185 | 293 |
| 157 | 3300035724 | Ga0373933_0034499 | Ga0373933_0034499_854_1762 | 293 |
| 158 | 3300036401 | Ga0373937_0001168 | Ga0373937_0001168_4720_5628 | 293 |
| 159 | 3300036401 | Ga0373937_0034989 | Ga0373937_0034989_101_1009 | 293 |
| 160 | 3300039110 | Ga0400487_47147 | Ga0400487_47147_278_1159 | 293 |
| 161 | 3300042156 | Ga0439446_0000219 | Ga0439446_0000219_5551_6459 | 293 |
| 162 | 3300042436 | Ga0439435_0001848 | Ga0439435_0001848_722_1630 | 293 |
| 163 | 3300044683 | Ga0466965_0062588 | Ga0466965_0062588_523_1404 | 293 |
| 164 | 3300044901 | Ga0466960_0154459 | Ga0466960_0154459_18_899 | 293 |
| 165 | 3300045051 | Ga0451576_0044853 | Ga0451576_0044853_2216_3124 | 293 |
| 166 | 3300045051 | Ga0451576_0072775 | Ga0451576_0072775_173_1093 | 293 |
| 167 | 3300046454 | Ga0495592_0001196 | Ga0495592_0001196_16058_16966 | 293 |
| 168 | 3300046476 | Ga0495662_0021823 | Ga0495662_0021823_762_1670 | 293 |
| 169 | 3300046506 | Ga0495583_0001878 | Ga0495583_0001878_5658_6542 | 293 |
| 170 | 3300046506 | Ga0495583_0029247 | Ga0495583_0029247_1196_2080 | 293 |
| 171 | 3300046511 | Ga0495608_0003334 | Ga0495608_0003334_10201_11109 | 293 |
| 172 | 3300046516 | Ga0495628_0003978 | Ga0495628_0003978_2037_2945 | 293 |
| 173 | 3300046516 | Ga0495628_0050622 | Ga0495628_0050622_1342_2250 | 293 |
| 174 | 3300046517 | Ga0495630_0236954 | Ga0495630_0236954_423_1331 | 293 |
| 175 | 3300046526 | Ga0495666_0094367 | Ga0495666_0094367_244_1152 | 293 |
| 176 | 3300046529 | Ga0495652_0022688 | Ga0495652_0022688_308_1216 | 293 |
| 177 | 3300046533 | Ga0495640_0017837 | Ga0495640_0017837_2071_2979 | 293 |
| 178 | 3300046533 | Ga0495640_0030674 | Ga0495640_0030674_101_1009 | 293 |
| 179 | 3300046535 | Ga0495586_0006833 | Ga0495586_0006833_3011_3919 | 293 |
| 180 | 3300046536 | Ga0495587_0048534 | Ga0495587_0048534_1159_2067 | 293 |
| 181 | 3300046543 | Ga0495645_0019723 | Ga0495645_0019723_3573_4481 | 293 |
| 182 | 3300046559 | Ga0495667_0052115 | Ga0495667_0052115_1340_2248 | 293 |
| 183 | 3300046642 | Ga0495634_0001365 | Ga0495634_0001365_15204_16112 | 293 |
| 184 | 3300046674 | Ga0495588_0072893 | Ga0495588_0072893_432_1316 | 293 |
| 185 | 3300046675 | Ga0495657_0230675 | Ga0495657_0230675_194_1102 | 293 |
| 186 | 3300046683 | Ga0495658_0147668 | Ga0495658_0147668_99_1007 | 293 |
| 187 | 3300046689 | Ga0495613_0029988 | Ga0495613_0029988_358_1266 | 293 |
| 188 | 3300046690 | Ga0495624_0079348 | Ga0495624_0079348_800_1708 | 293 |
| 189 | 3300046809 | Ga0495600_0012773 | Ga0495600_0012773_225_1133 | 293 |
| 190 | 3300047317 | Ga0495604_0018102 | Ga0495604_0018102_2873_3781 | 293 |
| 191 | 3300047317 | Ga0495604_0236971 | Ga0495604_0236971_36_944 | 293 |
| 192 | 3300047322 | Ga0495680_0000770 | Ga0495680_0000770_14946_15854 | 293 |
| 193 | 3300047471 | Ga0495684_0078975 | Ga0495684_0078975_145_1053 | 293 |
| 194 | 3300048905 | Ga0496102_0233122 | Ga0496102_0233122_41_925 | 293 |
| 195 | 3300048912 | Ga0496109_0195159 | Ga0496109_0195159_502_1383 | 293 |
| 196 | 3300049572 | Ga0501036_0292350 | Ga0501036_0292350_47_955 | 293 |
| 197 | 3300049575 | Ga0501039_0029736 | Ga0501039_0029736_1375_2283 | 293 |
| 198 | 3300049575 | Ga0501039_0064288 | Ga0501039_0064288_1842_2762 | 293 |
| 199 | 3300049576 | Ga0501040_0004819 | Ga0501040_0004819_1531_2451 | 293 |
| 200 | 3300049576 | Ga0501040_0050174 | Ga0501040_0050174_370_1278 | 293 |
| 201 | 3300049577 | Ga0501041_0164151 | Ga0501041_0164151_365_1273 | 293 |
| 202 | 3300049582 | Ga0501048_0063228 | Ga0501048_0063228_181_1101 | 293 |
| 203 | 3300049582 | Ga0501048_0205713 | Ga0501048_0205713_388_1296 | 293 |
| 204 | 3300049588 | Ga0501072_0201153 | Ga0501072_0201153_182_1102 | 293 |
| 205 | 3300049590 | Ga0501074_0071657 | Ga0501074_0071657_352_1260 | 293 |
| 206 | 3300049591 | Ga0501075_0011392 | Ga0501075_0011392_3444_4352 | 293 |
| 207 | 3300049741 | Ga0501079_0284597 | Ga0501079_0284597_233_1141 | 293 |
| 208 | 3300049743 | Ga0501081_0011943 | Ga0501081_0011943_828_1736 | 293 |
| 209 | 3300049824 | Ga0501045_0034151 | Ga0501045_0034151_365_1273 | 293 |
| 210 | 3300050511 | nmdc:mga08y16_116148_c1 | nmdc:mga08y16_116148_c1_1130_2038 | 293 |
| 211 | 3300050512 | nmdc:mga0n895_505227_c1 | nmdc:mga0n895_505227_c1_239_1147 | 293 |
| 212 | 3300050512 | nmdc:mga0n895_518091_c1 | nmdc:mga0n895_518091_c1_66_974 | 293 |
| 213 | 3300050512 | nmdc:mga0n895_90_c1 | nmdc:mga0n895_90_c1_20438_21358 | 293 |
| 214 | 3300050513 | nmdc:mga0rr50_924_c1 | nmdc:mga0rr50_924_c1_4142_5062 | 293 |
| 215 | 3300050514 | nmdc:mga08x19_1368_c1 | nmdc:mga08x19_1368_c1_11067_11975 | 293 |
| 216 | 3300050514 | nmdc:mga08x19_22330_c1 | nmdc:mga08x19_22330_c1_128_1036 | 293 |
| 217 | 3300050514 | nmdc:mga08x19_67157_c1 | nmdc:mga08x19_67157_c1_470_1378 | 293 |
| 218 | 3300050515 | nmdc:mga0a205_117014_c1 | nmdc:mga0a205_117014_c1_536_1444 | 293 |
| 219 | 3300053077 | Ga0495601_0142552 | Ga0495601_0142552_481_1389 | 293 |
| 220 | 3300053077 | Ga0495601_0191360 | Ga0495601_0191360_418_1326 | 293 |
| 221 | iso_pu_bacteria | 2738543013 | 2739249856 | 293 |
| 222 | 3300002704 | JGI25155J39150_1000079 | JGI25155J39150_100007928 | 294 |
| 223 | 3300002705 | JGI25156J39149_1000125 | JGI25156J39149_100012528 | 294 |
| 224 | 3300002738 | JGI25154J39366_1000141 | JGI25154J39366_100014126 | 294 |
| 225 | 3300002741 | JGI25157J39369_1000159 | JGI25157J39369_100015928 | 294 |
| 226 | 3300002774 | JGI25150J39212_1002448 | JGI25150J39212_10024482 | 294 |
| 227 | 3300002987 | JGI25159J45721_1000638 | JGI25159J45721_100063811 | 294 |
| 228 | 3300002987 | JGI25159J45721_1001149 | JGI25159J45721_100114911 | 294 |
| 229 | 3300002987 | JGI25159J45721_1003507 | JGI25159J45721_10035072 | 294 |
| 230 | 3300003187 | JGI25151J46595_10002430 | JGI25151J46595_100024301 | 294 |
| 231 | 3300003187 | JGI25151J46595_10011650 | JGI25151J46595_100116502 | 294 |
| 232 | 3300003187 | JGI25151J46595_10030161 | JGI25151J46595_100301612 | 294 |
| 233 | 3300003187 | JGI25151J46595_10068115 | JGI25151J46595_100681151 | 294 |
| 234 | 3300003215 | JGI25153J46596_10056704 | JGI25153J46596_100567041 | 294 |
| 235 | 3300003354 | JGI25160J50197_1000067 | JGI25160J50197_100006784 | 294 |
| 236 | 3300003374 | JGI25161J50226_1000035 | JGI25161J50226_1000035105 | 294 |
| 237 | 3300003771 | Ga0055526_1001094 | Ga0055526_10010944 | 294 |
| 238 | 3300003773 | Ga0055537_1002621 | Ga0055537_10026212 | 294 |
| 239 | 3300003773 | Ga0055537_1004715 | Ga0055537_10047151 | 294 |
| 240 | 3300003775 | Ga0055524_1000006 | Ga0055524_100000681 | 294 |
| 241 | 3300003775 | Ga0055524_1000360 | Ga0055524_10003601 | 294 |
| 242 | 3300003775 | Ga0055524_1001538 | Ga0055524_10015384 | 294 |
| 243 | 3300003775 | Ga0055524_1032458 | Ga0055524_10324581 | 294 |
| 244 | 3300003781 | Ga0055536_1001210 | Ga0055536_10012104 | 294 |
| 245 | 3300003781 | Ga0055536_1011696 | Ga0055536_10116963 | 294 |
| 246 | 3300003784 | Ga0055534_1001178 | Ga0055534_100117812 | 294 |
| 247 | 3300003784 | Ga0055534_1002450 | Ga0055534_10024507 | 294 |
| 248 | 3300003784 | Ga0055534_1019507 | Ga0055534_10195071 | 294 |
| 249 | 3300003790 | Ga0055528_1000374 | Ga0055528_100037412 | 294 |
| 250 | 3300003791 | Ga0055530_10000346 | Ga0055530_1000034629 | 294 |
| 251 | 3300003791 | Ga0055530_10031413 | Ga0055530_100314132 | 294 |
| 252 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005233 | 294 |
| 253 | 3300003792 | Ga0055540_1021135 | Ga0055540_10211352 | 294 |
| 254 | 3300003794 | Ga0055531_10000604 | Ga0055531_1000060419 | 294 |
| 255 | 3300003794 | Ga0055531_10000705 | Ga0055531_100007055 | 294 |
| 256 | 3300004625 | Ga0055543_1001289 | Ga0055543_100128911 | 294 |
| 257 | 3300005262 | Ga0065165_1013863 | Ga0065165_10138635 | 294 |
| 258 | 3300005262 | Ga0065165_1013875 | Ga0065165_10138755 | 294 |
| 259 | 3300006058 | Ga0075432_10014721 | Ga0075432_100147212 | 294 |
| 260 | 3300006177 | Ga0075362_10039428 | Ga0075362_100394282 | 294 |
| 261 | 3300006353 | Ga0075370_10163309 | Ga0075370_101633092 | 294 |
| 262 | 3300006946 | Ga0079104_1000002 | Ga0079104_1000002148 | 294 |
| 263 | 3300006948 | Ga0099826_10000004 | Ga0099826_10000004441 | 294 |
| 264 | 3300006948 | Ga0099826_10189649 | Ga0099826_101896492 | 294 |
| 265 | 3300009011 | Ga0105251_10049307 | Ga0105251_100493072 | 294 |
| 266 | 3300009092 | Ga0105250_10004264 | Ga0105250_100042645 | 294 |
| 267 | 3300009148 | Ga0105243_10002300 | Ga0105243_100023007 | 294 |
| 268 | 3300009176 | Ga0105242_10017149 | Ga0105242_100171495 | 294 |
| 269 | 3300021361 | Ga0213872_10001797 | Ga0213872_100017972 | 294 |
| 270 | 3300025206 | Ga0209435_100001 | Ga0209435_10000125 | 294 |
| 271 | 3300025245 | Ga0207425_1000863 | Ga0207425_10008636 | 294 |
| 272 | 3300025245 | Ga0207425_1002398 | Ga0207425_10023987 | 294 |
| 273 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001394 | 294 |
| 274 | 3300025250 | Ga0209026_1000003 | Ga0209026_100000325 | 294 |
| 275 | 3300025256 | Ga0209759_1000001 | Ga0209759_100000125 | 294 |
| 276 | 3300025263 | Ga0209565_1000124 | Ga0209565_100012412 | 294 |
| 277 | 3300025263 | Ga0209565_1000235 | Ga0209565_100023549 | 294 |
| 278 | 3300025263 | Ga0209565_1000498 | Ga0209565_100049816 | 294 |
| 279 | 3300025263 | Ga0209565_1008861 | Ga0209565_10088612 | 294 |
| 280 | 3300025273 | Ga0209673_1000043 | Ga0209673_1000043171 | 294 |
| 281 | 3300025284 | Ga0209130_1000442 | Ga0209130_100044227 | 294 |
| 282 | 3300025284 | Ga0209130_1000620 | Ga0209130_100062019 | 294 |
| 283 | 3300025291 | Ga0209675_1000125 | Ga0209675_10001251 | 294 |
| 284 | 3300025291 | Ga0209675_1000309 | Ga0209675_10003098 | 294 |
| 285 | 3300025291 | Ga0209675_1000312 | Ga0209675_10003121 | 294 |
| 286 | 3300025291 | Ga0209675_1007688 | Ga0209675_10076885 | 294 |
| 287 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007466 | 294 |
| 288 | 3300025292 | Ga0209676_1000014 | Ga0209676_100001493 | 294 |
| 289 | 3300025292 | Ga0209676_1009837 | Ga0209676_10098372 | 294 |
| 290 | 3300025294 | Ga0209025_1000232 | Ga0209025_1000232115 | 294 |
| 291 | 3300025294 | Ga0209025_1000246 | Ga0209025_1000246150 | 294 |
| 292 | 3300025294 | Ga0209025_1001132 | Ga0209025_100113224 | 294 |
| 293 | 3300025294 | Ga0209025_1001880 | Ga0209025_100188010 | 294 |
| 294 | 3300025294 | Ga0209025_1002427 | Ga0209025_100242711 | 294 |
| 295 | 3300025294 | Ga0209025_1004916 | Ga0209025_10049165 | 294 |
| 296 | 3300025295 | Ga0209564_1000268 | Ga0209564_100026812 | 294 |
| 297 | 3300025295 | Ga0209564_1000476 | Ga0209564_100047611 | 294 |
| 298 | 3300025295 | Ga0209564_1001012 | Ga0209564_100101224 | 294 |
| 299 | 3300025295 | Ga0209564_1003314 | Ga0209564_100331411 | 294 |
| 300 | 3300025295 | Ga0209564_1052362 | Ga0209564_10523621 | 294 |
| 301 | 3300025297 | Ga0209758_1004677 | Ga0209758_10046777 | 294 |
| 302 | 3300025297 | Ga0209758_1054966 | Ga0209758_10549661 | 294 |
| 303 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031042 | 294 |
| 304 | 3300025298 | Ga0209050_1004391 | Ga0209050_100439111 | 294 |
| 305 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011048 | 294 |
| 306 | 3300025299 | Ga0209256_1000291 | Ga0209256_100029138 | 294 |
| 307 | 3300025299 | Ga0209256_1000700 | Ga0209256_100070037 | 294 |
| 308 | 3300025302 | Ga0207426_1000247 | Ga0207426_100024734 | 294 |
| 309 | 3300025302 | Ga0207426_1002558 | Ga0207426_10025588 | 294 |
| 310 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031042 | 294 |
| 311 | 3300025303 | Ga0209051_1000320 | Ga0209051_100032055 | 294 |
| 312 | 3300025303 | Ga0209051_1043024 | Ga0209051_10430241 | 294 |
| 313 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020466 | 294 |
| 314 | 3300025304 | Ga0209257_1000161 | Ga0209257_100016180 | 294 |
| 315 | 3300025304 | Ga0209257_1017645 | Ga0209257_10176453 | 294 |
| 316 | 3300025711 | Ga0207696_1003880 | Ga0207696_10038805 | 294 |
| 317 | 3300025909 | Ga0207705_10233764 | Ga0207705_102337642 | 294 |
| 318 | 3300025934 | Ga0207686_10035403 | Ga0207686_100354034 | 294 |
| 319 | 3300025935 | Ga0207709_10000015 | Ga0207709_10000015143 | 294 |
| 320 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007366 | 294 |
| 321 | 3300027666 | Ga0209282_1000027 | Ga0209282_100002748 | 294 |
| 322 | 3300027907 | Ga0207428_10277477 | Ga0207428_102774772 | 294 |
| 323 | 3300028786 | Ga0307517_10243831 | Ga0307517_102438311 | 294 |
| 324 | 3300031456 | Ga0307513_10000054 | Ga0307513_10000054112 | 294 |
| 325 | 3300031548 | Ga0307408_100000617 | Ga0307408_10000061711 | 294 |
| 326 | 3300031548 | Ga0307408_100008657 | Ga0307408_1000086573 | 294 |
| 327 | 3300031731 | Ga0307405_10089794 | Ga0307405_100897942 | 294 |
| 328 | 3300031901 | Ga0307406_10001016 | Ga0307406_100010167 | 294 |
| 329 | 3300036647 | Ga0316582_0084073 | Ga0316582_0084073_424_1317 | 294 |
| 330 | 3300039447 | Ga0436361_1152527 | Ga0436361_1152527_18379_19275 | 294 |
| 331 | 3300041459 | Ga0451800_0811317 | Ga0451800_0811317_26_910 | 294 |
| 332 | 3300046474 | Ga0495605_0002853 | Ga0495605_0002853_453_1337 | 294 |
| 333 | 3300046500 | Ga0495596_0000335 | Ga0495596_0000335_18764_19648 | 294 |
| 334 | 3300046500 | Ga0495596_0032243 | Ga0495596_0032243_292_1197 | 294 |
| 335 | 3300046507 | Ga0495606_0012887 | Ga0495606_0012887_1766_2671 | 294 |
| 336 | 3300046513 | Ga0495616_0007066 | Ga0495616_0007066_4352_5236 | 294 |
| 337 | 3300046542 | Ga0495597_0001930 | Ga0495597_0001930_3721_4617 | 294 |
| 338 | 3300046692 | Ga0495671_0005939 | Ga0495671_0005939_615_1499 | 294 |
| 339 | 3300047318 | Ga0495636_0008006 | Ga0495636_0008006_1075_1959 | 294 |
| 340 | 3300047447 | Ga0495685_001591 | Ga0495685_001591_2354_3238 | 294 |
| 341 | 3300048919 | Ga0496116_0003784 | Ga0496116_0003784_1395_2279 | 294 |
| 342 | 3300048919 | Ga0496116_0013289 | Ga0496116_0013289_957_1841 | 294 |
| 343 | 3300048925 | Ga0496122_0001935 | Ga0496122_0001935_18763_19647 | 294 |
| 344 | 3300048926 | Ga0496123_0002072 | Ga0496123_0002072_17952_18836 | 294 |
| 345 | 3300048926 | Ga0496123_0033921 | Ga0496123_0033921_1773_2669 | 294 |
| 346 | 3300048929 | Ga0496126_0000031 | Ga0496126_0000031_192638_193543 | 294 |
| 347 | 3300049571 | Ga0501034_0000379 | Ga0501034_0000379_63972_64856 | 294 |
| 348 | 3300050491 | nmdc:mga00v17_9577_c1 | nmdc:mga00v17_9577_c1_2259_3143 | 294 |
| 349 | 3300053088 | Ga0500644_0001247 | Ga0500644_0001247_4003_4887 | 294 |
| 350 | 3300053117 | Ga0500593_000729 | Ga0500593_000729_4386_5270 | 294 |
| 351 | 3300053730 | Ga0500645_000413 | Ga0500645_000413_24801_25685 | 294 |
| 352 | iso_pu_bacteria | 2547132374 | 2548500123 | 294 |
| 353 | iso_pu_bacteria | 2643221570 | 2643864837 | 294 |
| 354 | iso_pu_bacteria | 2643221596 | 2643991200 | 294 |
| 355 | iso_pu_bacteria | 2643221609 | 2644059903 | 294 |
| 356 | iso_pu_bacteria | 2643221611 | 2644074476 | 294 |
| 357 | iso_pu_bacteria | 2643221652 | 2644293927 | 294 |
| 358 | iso_pu_bacteria | 2643221717 | 2644644557 | 294 |
| 359 | iso_pu_bacteria | 2721755523 | 2722882399 | 294 |
| 360 | iso_pu_bacteria | 2738543012 | 2739241428 | 294 |
| 361 | iso_pu_bacteria | 2816332133 | 2816473592 | 294 |
| 362 | iso_pu_bacteria | 2839138175 | 2839142130 | 294 |
| 363 | iso_pu_bacteria | 2842718218 | 2842719036 | 294 |
| 364 | iso_pu_bacteria | 2900577576 | 2900581153 | 294 |
| 365 | iso_pu_bacteria | 2990710928 | 2990711719 | 294 |
| 366 | iso_pu_bacteria | 644736347 | 644747495 | 294 |
| 367 | 3300005577 | Ga0068857_100559028 | Ga0068857_1005590281 | 295 |
| 368 | 3300009174 | Ga0105241_10156974 | Ga0105241_101569743 | 295 |
| 369 | 3300010375 | Ga0105239_10572032 | Ga0105239_105720322 | 295 |
| 370 | 3300013297 | Ga0157378_10516983 | Ga0157378_105169831 | 295 |
| 371 | 3300013308 | Ga0157375_10514764 | Ga0157375_105147642 | 295 |
| 372 | 3300025942 | Ga0207689_10246913 | Ga0207689_102469132 | 295 |
| 373 | 3300027614 | Ga0209970_1002734 | Ga0209970_10027343 | 295 |
| 374 | 3300037312 | Ga0395899_0005385 | Ga0395899_0005385_709_1596 | 295 |
| 375 | 3300037418 | Ga0395900_0001269 | Ga0395900_0001269_24718_25605 | 295 |
| 376 | 3300037418 | Ga0395900_0094874 | Ga0395900_0094874_716_1603 | 295 |
| 377 | 3300037418 | Ga0395900_0409209 | Ga0395900_0409209_99_986 | 295 |
| 378 | 3300037466 | Ga0395898_0048848 | Ga0395898_0048848_2402_3289 | 295 |
| 379 | 3300037466 | Ga0395898_0084784 | Ga0395898_0084784_122_1009 | 295 |
| 380 | 3300037471 | Ga0395905_0035418 | Ga0395905_0035418_2790_3677 | 295 |
| 381 | 3300037471 | Ga0395905_0170776 | Ga0395905_0170776_816_1703 | 295 |
| 382 | 3300038443 | Ga0395901_0290923 | Ga0395901_0290923_476_1363 | 295 |
| 383 | 3300038443 | Ga0395901_0334647 | Ga0395901_0334647_525_1412 | 295 |
| 384 | 3300038443 | Ga0395901_0353963 | Ga0395901_0353963_430_1317 | 295 |
| 385 | 3300041411 | Ga0439466_0041716 | Ga0439466_0041716_314_1201 | 295 |
| 386 | 3300042007 | Ga0439449_0000469 | Ga0439449_0000469_10164_11051 | 295 |
| 387 | 3300042156 | Ga0439446_0013925 | Ga0439446_0013925_737_1624 | 295 |
| 388 | 3300042185 | Ga0450909_006951 | Ga0450909_006951_640_1527 | 295 |
| 389 | 3300042439 | Ga0439464_0022711 | Ga0439464_0022711_335_1222 | 295 |
| 390 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_39804_40691 | 295 |
| 391 | 3300044673 | Ga0453683_0001682 | Ga0453683_0001682_16250_17137 | 295 |
| 392 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_215601_216488 | 295 |
| 393 | 3300046528 | Ga0495642_0006127 | Ga0495642_0006127_1970_2857 | 295 |
| 394 | 3300047445 | Ga0495677_0015280 | Ga0495677_0015280_1734_2621 | 295 |
| 395 | 3300049568 | Ga0501031_0001649 | Ga0501031_0001649_5791_6690 | 295 |
| 396 | 3300050494 | nmdc:mga06z11_111659_c1 | nmdc:mga06z11_111659_c1_160_1047 | 295 |
| 397 | 3300059423 | Ga0590074_021286 | Ga0590074_021286_46_933 | 295 |
| 398 | 3300059424 | Ga0590075_009163 | Ga0590075_009163_1220_2107 | 295 |
| 399 | 3300059424 | Ga0590075_016770 | Ga0590075_016770_736_1623 | 295 |
| 400 | iso_pu_bacteria | 2894023352 | 2894024546 | 295 |
| 401 | 3300001989 | JGI24739J22299_10037077 | JGI24739J22299_100370772 | 296 |
| 402 | 3300002739 | JGI25158J39367_1002898 | JGI25158J39367_10028984 | 296 |
| 403 | 3300002773 | JGI25152J39213_1023049 | JGI25152J39213_10230491 | 296 |
| 404 | 3300002774 | JGI25150J39212_1005975 | JGI25150J39212_10059754 | 296 |
| 405 | 3300002987 | JGI25159J45721_1010700 | JGI25159J45721_10107001 | 296 |
| 406 | 3300003187 | JGI25151J46595_10007994 | JGI25151J46595_100079945 | 296 |
| 407 | 3300003578 | Ga0006562J51391_1036758 | Ga0006562J51391_10367582 | 296 |
| 408 | 3300003578 | Ga0006562J51391_1036760 | Ga0006562J51391_10367602 | 296 |
| 409 | 3300003578 | Ga0006562J51391_1114748 | Ga0006562J51391_11147481 | 296 |
| 410 | 3300003578 | Ga0006562J51391_1114752 | Ga0006562J51391_11147522 | 296 |
| 411 | 3300003781 | Ga0055536_1003127 | Ga0055536_10031271 | 296 |
| 412 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004291 | 296 |
| 413 | 3300003784 | Ga0055534_1000722 | Ga0055534_10007222 | 296 |
| 414 | 3300003784 | Ga0055534_1005829 | Ga0055534_10058292 | 296 |
| 415 | 3300003784 | Ga0055534_1008709 | Ga0055534_10087092 | 296 |
| 416 | 3300003792 | Ga0055540_1013970 | Ga0055540_10139704 | 296 |
| 417 | 3300003792 | Ga0055540_1017045 | Ga0055540_10170452 | 296 |
| 418 | 3300005327 | Ga0070658_10096585 | Ga0070658_100965852 | 296 |
| 419 | 3300005356 | Ga0070674_100131131 | Ga0070674_1001311313 | 296 |
| 420 | 3300005367 | Ga0070667_100085849 | Ga0070667_1000858494 | 296 |
| 421 | 3300005539 | Ga0068853_100005208 | Ga0068853_1000052086 | 296 |
| 422 | 3300005564 | Ga0070664_100149065 | Ga0070664_1001490651 | 296 |
| 423 | 3300005577 | Ga0068857_100169700 | Ga0068857_1001697004 | 296 |
| 424 | 3300005844 | Ga0068862_100070359 | Ga0068862_1000703592 | 296 |
| 425 | 3300006038 | Ga0075365_10100765 | Ga0075365_101007652 | 296 |
| 426 | 3300006048 | Ga0075363_100034165 | Ga0075363_1000341654 | 296 |
| 427 | 3300006048 | Ga0075363_100066165 | Ga0075363_1000661652 | 296 |
| 428 | 3300006051 | Ga0075364_10034160 | Ga0075364_100341603 | 296 |
| 429 | 3300006177 | Ga0075362_10001536 | Ga0075362_100015362 | 296 |
| 430 | 3300006177 | Ga0075362_10025368 | Ga0075362_100253683 | 296 |
| 431 | 3300006177 | Ga0075362_10048826 | Ga0075362_100488264 | 296 |
| 432 | 3300006178 | Ga0075367_10105055 | Ga0075367_101050552 | 296 |
| 433 | 3300006195 | Ga0075366_10010971 | Ga0075366_100109712 | 296 |
| 434 | 3300006195 | Ga0075366_10047092 | Ga0075366_100470924 | 296 |
| 435 | 3300006353 | Ga0075370_10002974 | Ga0075370_100029746 | 296 |
| 436 | 3300006353 | Ga0075370_10008542 | Ga0075370_100085423 | 296 |
| 437 | 3300006353 | Ga0075370_10011368 | Ga0075370_100113683 | 296 |
| 438 | 3300006353 | Ga0075370_10063049 | Ga0075370_100630492 | 296 |
| 439 | 3300006358 | Ga0068871_100053786 | Ga0068871_1000537863 | 296 |
| 440 | 3300009036 | Ga0105244_10004693 | Ga0105244_100046938 | 296 |
| 441 | 3300009148 | Ga0105243_10009710 | Ga0105243_100097108 | 296 |
| 442 | 3300013100 | Ga0157373_10027789 | Ga0157373_100277891 | 296 |
| 443 | 3300013104 | Ga0157370_10037489 | Ga0157370_100374895 | 296 |
| 444 | 3300013105 | Ga0157369_10013458 | Ga0157369_100134584 | 296 |
| 445 | 3300013306 | Ga0163162_10024877 | Ga0163162_100248775 | 296 |
| 446 | 3300014497 | Ga0182008_10000838 | Ga0182008_100008387 | 296 |
| 447 | 3300014497 | Ga0182008_10003873 | Ga0182008_100038732 | 296 |
| 448 | 3300014497 | Ga0182008_10011535 | Ga0182008_100115354 | 296 |
| 449 | 3300014497 | Ga0182008_10055610 | Ga0182008_100556102 | 296 |
| 450 | 3300015261 | Ga0182006_1002216 | Ga0182006_10022164 | 296 |
| 451 | 3300015261 | Ga0182006_1056801 | Ga0182006_10568011 | 296 |
| 452 | 3300015262 | Ga0182007_10000601 | Ga0182007_1000060111 | 296 |
| 453 | 3300015262 | Ga0182007_10000825 | Ga0182007_1000082517 | 296 |
| 454 | 3300015683 | Ga0183362_10003 | Ga0183362_1000366 | 296 |
| 455 | 3300017792 | Ga0163161_10011479 | Ga0163161_100114793 | 296 |
| 456 | 3300017792 | Ga0163161_10092071 | Ga0163161_100920713 | 296 |
| 457 | 3300017792 | Ga0163161_10161761 | Ga0163161_101617612 | 296 |
| 458 | 3300025208 | Ga0209436_107649 | Ga0209436_1076491 | 296 |
| 459 | 3300025228 | Ga0209672_101515 | Ga0209672_1015157 | 296 |
| 460 | 3300025229 | Ga0209147_103861 | Ga0209147_1038612 | 296 |
| 461 | 3300025242 | Ga0209258_100199 | Ga0209258_1001997 | 296 |
| 462 | 3300025245 | Ga0207425_1004716 | Ga0207425_10047166 | 296 |
| 463 | 3300025254 | Ga0209148_1000179 | Ga0209148_10001797 | 296 |
| 464 | 3300025258 | Ga0209129_1000071 | Ga0209129_1000071126 | 296 |
| 465 | 3300025258 | Ga0209129_1001902 | Ga0209129_10019025 | 296 |
| 466 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008392 | 296 |
| 467 | 3300025263 | Ga0209565_1002195 | Ga0209565_10021954 | 296 |
| 468 | 3300025273 | Ga0209673_1000534 | Ga0209673_100053455 | 296 |
| 469 | 3300025273 | Ga0209673_1001906 | Ga0209673_10019065 | 296 |
| 470 | 3300025273 | Ga0209673_1020278 | Ga0209673_10202781 | 296 |
| 471 | 3300025273 | Ga0209673_1033411 | Ga0209673_10334112 | 296 |
| 472 | 3300025284 | Ga0209130_1000773 | Ga0209130_100077326 | 296 |
| 473 | 3300025284 | Ga0209130_1002969 | Ga0209130_10029697 | 296 |
| 474 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008192 | 296 |
| 475 | 3300025291 | Ga0209675_1002859 | Ga0209675_10028596 | 296 |
| 476 | 3300025291 | Ga0209675_1006924 | Ga0209675_10069246 | 296 |
| 477 | 3300025292 | Ga0209676_1000005 | Ga0209676_100000557 | 296 |
| 478 | 3300025292 | Ga0209676_1001007 | Ga0209676_10010072 | 296 |
| 479 | 3300025292 | Ga0209676_1003004 | Ga0209676_10030042 | 296 |
| 480 | 3300025292 | Ga0209676_1030273 | Ga0209676_10302732 | 296 |
| 481 | 3300025294 | Ga0209025_1000544 | Ga0209025_100054411 | 296 |
| 482 | 3300025294 | Ga0209025_1000854 | Ga0209025_100085453 | 296 |
| 483 | 3300025294 | Ga0209025_1004201 | Ga0209025_10042015 | 296 |
| 484 | 3300025294 | Ga0209025_1007365 | Ga0209025_10073656 | 296 |
| 485 | 3300025294 | Ga0209025_1010312 | Ga0209025_10103122 | 296 |
| 486 | 3300025295 | Ga0209564_1000239 | Ga0209564_100023949 | 296 |
| 487 | 3300025295 | Ga0209564_1031042 | Ga0209564_10310421 | 296 |
| 488 | 3300025295 | Ga0209564_1033743 | Ga0209564_10337431 | 296 |
| 489 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027383 | 296 |
| 490 | 3300025297 | Ga0209758_1003037 | Ga0209758_10030376 | 296 |
| 491 | 3300025298 | Ga0209050_1000007 | Ga0209050_10000071041 | 296 |
| 492 | 3300025298 | Ga0209050_1001089 | Ga0209050_10010892 | 296 |
| 493 | 3300025299 | Ga0209256_1000081 | Ga0209256_1000081126 | 296 |
| 494 | 3300025299 | Ga0209256_1027019 | Ga0209256_10270191 | 296 |
| 495 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027348 | 296 |
| 496 | 3300025302 | Ga0207426_1000614 | Ga0207426_100061450 | 296 |
| 497 | 3300025303 | Ga0209051_1000009 | Ga0209051_100000957 | 296 |
| 498 | 3300025303 | Ga0209051_1000347 | Ga0209051_100034760 | 296 |
| 499 | 3300025303 | Ga0209051_1000373 | Ga0209051_100037337 | 296 |
| 500 | 3300025303 | Ga0209051_1000553 | Ga0209051_100055338 | 296 |
| 501 | 3300025303 | Ga0209051_1002578 | Ga0209051_10025782 | 296 |
| 502 | 3300025303 | Ga0209051_1036022 | Ga0209051_10360222 | 296 |
| 503 | 3300025304 | Ga0209257_1000011 | Ga0209257_100001131 | 296 |
| 504 | 3300025304 | Ga0209257_1000449 | Ga0209257_100044957 | 296 |
| 505 | 3300025321 | Ga0207656_10026603 | Ga0207656_100266032 | 296 |
| 506 | 3300025728 | Ga0207655_1001731 | Ga0207655_100173114 | 296 |
| 507 | 3300025913 | Ga0207695_10223244 | Ga0207695_102232442 | 296 |
| 508 | 3300025923 | Ga0207681_10082163 | Ga0207681_100821634 | 296 |
| 509 | 3300025933 | Ga0207706_10006469 | Ga0207706_1000646912 | 296 |
| 510 | 3300025935 | Ga0207709_10001584 | Ga0207709_1000158412 | 296 |
| 511 | 3300025935 | Ga0207709_10010549 | Ga0207709_100105492 | 296 |
| 512 | 3300025937 | Ga0207669_10016406 | Ga0207669_100164063 | 296 |
| 513 | 3300025960 | Ga0207651_10094176 | Ga0207651_100941762 | 296 |
| 514 | 3300026041 | Ga0207639_10125879 | Ga0207639_101258792 | 296 |
| 515 | 3300026089 | Ga0207648_10075188 | Ga0207648_100751884 | 296 |
| 516 | 3300026121 | Ga0207683_10035294 | Ga0207683_100352945 | 296 |
| 517 | 3300026121 | Ga0207683_10176934 | Ga0207683_101769341 | 296 |
| 518 | 3300026142 | Ga0207698_10095965 | Ga0207698_100959652 | 296 |
| 519 | 3300027666 | Ga0209282_1023309 | Ga0209282_10233092 | 296 |
| 520 | 3300028379 | Ga0268266_10013638 | Ga0268266_100136384 | 296 |
| 521 | 3300030732 | Ga0316176_1066153 | Ga0316176_10661538 | 296 |
| 522 | 3300030733 | Ga0314311_1174773 | Ga0314311_11747738 | 296 |
| 523 | 3300030744 | Ga0316181_1035278 | Ga0316181_10352786 | 296 |
| 524 | 3300031251 | Ga0265327_10089230 | Ga0265327_100892302 | 296 |
| 525 | 3300031649 | Ga0307514_10088797 | Ga0307514_100887972 | 296 |
| 526 | 3300031731 | Ga0307405_10001308 | Ga0307405_1000130810 | 296 |
| 527 | 3300031731 | Ga0307405_10045486 | Ga0307405_100454864 | 296 |
| 528 | 3300031901 | Ga0307406_10000749 | Ga0307406_100007496 | 296 |
| 529 | 3300031911 | Ga0307412_10035707 | Ga0307412_100357072 | 296 |
| 530 | 3300031911 | Ga0307412_10081245 | Ga0307412_100812452 | 296 |
| 531 | 3300031911 | Ga0307412_10159158 | Ga0307412_101591582 | 296 |
| 532 | 3300032002 | Ga0307416_100081998 | Ga0307416_1000819984 | 296 |
| 533 | 3300032004 | Ga0307414_10358703 | Ga0307414_103587031 | 296 |
| 534 | 3300032005 | Ga0307411_10104682 | Ga0307411_101046821 | 296 |
| 535 | 3300041407 | Ga0439447_005612 | Ga0439447_005612_107_997 | 296 |
| 536 | 3300041410 | Ga0439461_0005991 | Ga0439461_0005991_217_1107 | 296 |
| 537 | 3300041410 | Ga0439461_0016872 | Ga0439461_0016872_193_1083 | 296 |
| 538 | 3300041411 | Ga0439466_0010309 | Ga0439466_0010309_2413_3303 | 296 |
| 539 | 3300041411 | Ga0439466_0012586 | Ga0439466_0012586_1604_2494 | 296 |
| 540 | 3300041486 | Ga0451807_2067542 | Ga0451807_2067542_101_991 | 296 |
| 541 | 3300041997 | Ga0439431_0001255 | Ga0439431_0001255_2469_3359 | 296 |
| 542 | 3300041999 | Ga0439433_0000519 | Ga0439433_0000519_5468_6358 | 296 |
| 543 | 3300042002 | Ga0439442_000506 | Ga0439442_000506_2438_3328 | 296 |
| 544 | 3300042004 | Ga0439445_0001045 | Ga0439445_0001045_955_1845 | 296 |
| 545 | 3300042006 | Ga0439432_006319 | Ga0439432_006319_3224_4114 | 296 |
| 546 | 3300042007 | Ga0439449_0000720 | Ga0439449_0000720_8462_9352 | 296 |
| 547 | 3300042010 | Ga0439452_002385 | Ga0439452_002385_224_1114 | 296 |
| 548 | 3300042125 | Ga0450923_015944 | Ga0450923_015944_32_922 | 296 |
| 549 | 3300042131 | Ga0450894_005188 | Ga0450894_005188_662_1552 | 296 |
| 550 | 3300042134 | Ga0450898_006727 | Ga0450898_006727_599_1489 | 296 |
| 551 | 3300042145 | Ga0450906_001292 | Ga0450906_001292_1214_2104 | 296 |
| 552 | 3300042145 | Ga0450906_003902 | Ga0450906_003902_1466_2356 | 296 |
| 553 | 3300042185 | Ga0450909_005997 | Ga0450909_005997_80_970 | 296 |
| 554 | 3300042435 | Ga0439434_0001219 | Ga0439434_0001219_2970_3860 | 296 |
| 555 | 3300042435 | Ga0439434_0008117 | Ga0439434_0008117_83_973 | 296 |
| 556 | 3300042531 | Ga0450918_000592 | Ga0450918_000592_4982_5872 | 296 |
| 557 | 3300046513 | Ga0495616_0002637 | Ga0495616_0002637_3501_4391 | 296 |
| 558 | 3300046515 | Ga0495620_0024367 | Ga0495620_0024367_936_1826 | 296 |
| 559 | 3300046518 | Ga0495631_0002010 | Ga0495631_0002010_8130_9020 | 296 |
| 560 | 3300046520 | Ga0495637_0004867 | Ga0495637_0004867_493_1383 | 296 |
| 561 | 3300046539 | Ga0495621_0002691 | Ga0495621_0002691_405_1295 | 296 |
| 562 | 3300046615 | Ga0495656_0000202 | Ga0495656_0000202_3361_4251 | 296 |
| 563 | 3300046660 | Ga0495625_0000637 | Ga0495625_0000637_44738_45628 | 296 |
| 564 | 3300046660 | Ga0495625_0119424 | Ga0495625_0119424_20_910 | 296 |
| 565 | 3300046674 | Ga0495588_0005864 | Ga0495588_0005864_2134_3024 | 296 |
| 566 | 3300046674 | Ga0495588_0029895 | Ga0495588_0029895_16_906 | 296 |
| 567 | 3300046675 | Ga0495657_0057838 | Ga0495657_0057838_1076_2002 | 296 |
| 568 | 3300046683 | Ga0495658_0011936 | Ga0495658_0011936_1385_2275 | 296 |
| 569 | 3300046690 | Ga0495624_0105543 | Ga0495624_0105543_79_1005 | 296 |
| 570 | 3300046691 | Ga0495670_0085716 | Ga0495670_0085716_246_1136 | 296 |
| 571 | 3300046692 | Ga0495671_0008248 | Ga0495671_0008248_1487_2377 | 296 |
| 572 | 3300047321 | Ga0495676_0041433 | Ga0495676_0041433_704_1594 | 296 |
| 573 | 3300047673 | Ga0495593_0034289 | Ga0495593_0034289_705_1595 | 296 |
| 574 | 3300048089 | Ga0495614_0019254 | Ga0495614_0019254_687_1577 | 296 |
| 575 | 3300048903 | Ga0496100_0143066 | Ga0496100_0143066_540_1466 | 296 |
| 576 | 3300048904 | Ga0496101_0001014 | Ga0496101_0001014_12265_13191 | 296 |
| 577 | 3300048905 | Ga0496102_0350559 | Ga0496102_0350559_50_940 | 296 |
| 578 | 3300048906 | Ga0496103_0114364 | Ga0496103_0114364_413_1339 | 296 |
| 579 | 3300048908 | Ga0496105_0020999 | Ga0496105_0020999_1845_2771 | 296 |
| 580 | 3300048910 | Ga0496107_0132292 | Ga0496107_0132292_649_1575 | 296 |
| 581 | 3300048913 | Ga0496110_0101400 | Ga0496110_0101400_1055_1981 | 296 |
| 582 | 3300048919 | Ga0496116_0030075 | Ga0496116_0030075_2416_3306 | 296 |
| 583 | 3300048920 | Ga0496117_0040746 | Ga0496117_0040746_2377_3267 | 296 |
| 584 | 3300048920 | Ga0496117_0043935 | Ga0496117_0043935_320_1210 | 296 |
| 585 | 3300048920 | Ga0496117_0072694 | Ga0496117_0072694_693_1583 | 296 |
| 586 | 3300048920 | Ga0496117_0110202 | Ga0496117_0110202_217_1143 | 296 |
| 587 | 3300048921 | Ga0496118_0026715 | Ga0496118_0026715_3272_4162 | 296 |
| 588 | 3300048924 | Ga0496121_0039089 | Ga0496121_0039089_2935_3825 | 296 |
| 589 | 3300048925 | Ga0496122_0000103 | Ga0496122_0000103_165305_166231 | 296 |
| 590 | 3300048926 | Ga0496123_0000261 | Ga0496123_0000261_30021_30947 | 296 |
| 591 | 3300048926 | Ga0496123_0108450 | Ga0496123_0108450_165_1055 | 296 |
| 592 | 3300048927 | Ga0496124_0084452 | Ga0496124_0084452_872_1798 | 296 |
| 593 | 3300048927 | Ga0496124_0150339 | Ga0496124_0150339_102_992 | 296 |
| 594 | 3300048928 | Ga0496125_0085355 | Ga0496125_0085355_675_1565 | 296 |
| 595 | 3300049705 | Ga0501225_0009408 | Ga0501225_0009408_1381_2271 | 296 |
| 596 | 3300049759 | Ga0501262_000697 | Ga0501262_000697_2252_3142 | 296 |
| 597 | 3300050489 | nmdc:mga03683_8387_c1 | nmdc:mga03683_8387_c1_2411_3301 | 296 |
| 598 | 3300050490 | nmdc:mga03n38_8334_c1 | nmdc:mga03n38_8334_c1_1123_2013 | 296 |
| 599 | 3300050493 | nmdc:mga0k408_46207_c1 | nmdc:mga0k408_46207_c1_630_1520 | 296 |
| 600 | 3300050494 | nmdc:mga06z11_51836_c1 | nmdc:mga06z11_51836_c1_506_1396 | 296 |
| 601 | 3300050496 | nmdc:mga07m45_1912_c1 | nmdc:mga07m45_1912_c1_1579_2469 | 296 |
| 602 | 3300050496 | nmdc:mga07m45_28493_c1 | nmdc:mga07m45_28493_c1_793_1683 | 296 |
| 603 | 3300050496 | nmdc:mga07m45_34770_c1 | nmdc:mga07m45_34770_c1_1572_2462 | 296 |
| 604 | 3300050496 | nmdc:mga07m45_7137_c1 | nmdc:mga07m45_7137_c1_830_1720 | 296 |
| 605 | 3300053079 | Ga0500610_0160959 | Ga0500610_0160959_52_942 | 296 |
| 606 | 3300053087 | Ga0500643_011857 | Ga0500643_011857_2249_3139 | 296 |
| 607 | 3300053093 | Ga0500651_0000029 | Ga0500651_0000029_72793_73683 | 296 |
| 608 | 3300053110 | Ga0500571_001234 | Ga0500571_001234_2867_3757 | 296 |
| 609 | 3300053118 | Ga0500594_0006928 | Ga0500594_0006928_1570_2460 | 296 |
| 610 | 3300053121 | Ga0500607_004123 | Ga0500607_004123_3631_4521 | 296 |
| 611 | 3300053133 | Ga0500655_000253 | Ga0500655_000253_3686_4576 | 296 |
| 612 | 3300053136 | Ga0500559_0006765 | Ga0500559_0006765_97_1023 | 296 |
| 613 | 3300053139 | Ga0500568_0018165 | Ga0500568_0018165_2139_3029 | 296 |
| 614 | 3300053140 | Ga0500573_0021414 | Ga0500573_0021414_456_1382 | 296 |
| 615 | 3300053141 | Ga0500574_001481 | Ga0500574_001481_258_1148 | 296 |
| 616 | 3300053158 | Ga0500627_0001256 | Ga0500627_0001256_809_1699 | 296 |
| 617 | 3300053161 | Ga0500634_0018405 | Ga0500634_0018405_707_1597 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qze-assembly2.cif.gz_D | crystal structure of dapa (pa1010) at 1.6 a resolution | 0.9802 | 5 | 294 |
| 6mqh-assembly1.cif.gz_A | crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei | 0.9799 | 3 | 294 |
| 6p90-assembly1.cif.gz_B | crystal structure of padhdps2-h56q mutant | 0.9795 | 3 | 294 |
| 3pud-assembly1.cif.gz_A | crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution | 0.9783 | 3 | 294 |
| 3noe-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa | 0.9775 | 3 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a5fA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9706 | 5 | 294 | 3.20.20.70 |
| 6nvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9672 | 5 | 294 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9663 | 5 | 294 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9654 | 3 | 289 | 3.20.20.70 |
| 5f1uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9607 | 2 | 289 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A540WHZ1-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9848 | 135 | 294 |
GO:0005829
GO:0008840 GO:0044281 |
| AF-A0A521ZAB2-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9835 | 3 | 295 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A0A2V9Y7R4-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9834 | 149 | 296 |
GO:0005829
GO:0008840 |
| AF-A0A520RXY2-F1-model_v4 | Dihydrodipicolinate synthase | 0.9834 | 201 | 292 |
GO:0005829
GO:0008840 |
| AF-A0A2P5KB96-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9816 | 3 | 295 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar