F469631

General Info

Members Datasets Scaffolds Average Seq Length
617 241 1234 176

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10238770|Ga0114129_102387703
Length 191
Sequence MSNHKEAQEAPKSFRFCAFLRLMVIAAVVLVPLTAQASQAEVRSTVQGVFDQLKSHNYSALYDLLPASARTRMSRERFVGALQRAQGFYELDRMDIGAIKLSGNLAVVDTVLYGRIVNPVQAEGKIVAQQYLIREDGKWRVATGDQSTVKKFLASNPAFGKGFRIREPRIYVKQGAKWVEFNVPRAPRKQA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
191 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
192 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
193 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
194 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
198 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
199 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
200 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
201 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
202 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
203 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
204 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
218 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
221 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
226 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
227 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
228 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
229 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
230 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
231 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
232 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.3
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 27.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10238770 3300009147 Bacteria 2444
2 SwRhRL3b_contig_4273695 2162886006 Bacteria 2277
3 MRS1b_contig_5818974 2162886011 Unclassified 2139
4 MBSR1b_contig_4847824 2162886012 Bacteria 1671
5 CNAas_1000967 3300000532 Unclassified 2671
6 JGI24751J29686_10000036 3300002459 Bacteria 82067
7 JGI24751J29686_10000038 3300002459 Bacteria 80932
8 JGI25406J46586_10061152 3300003203 Bacteria 1215
9 rootL2_10103635 3300003322 Bacteria 6089
10 Ga0065714_10064462 3300005288 Bacteria 66145
11 Ga0065714_10125642 3300005288 Bacteria 1299
12 Ga0065704_10102168 3300005289 Bacteria 2213
13 Ga0065704_10125823 3300005289 Bacteria 1698
14 Ga0065712_10000135 3300005290 Bacteria 66145
15 Ga0065712_10003714 3300005290 Bacteria 5026
16 Ga0065712_10068954 3300005290 Bacteria 8471
17 Ga0065712_10351881 3300005290 Bacteria 785
18 Ga0065715_10003646 3300005293 Bacteria 3911
19 Ga0065715_10006106 3300005293 Bacteria 4098
20 Ga0065715_10089247 3300005293 Bacteria 11943
21 Ga0065715_10089806 3300005293 Bacteria 8449
22 Ga0065715_10093366 3300005293 Bacteria 4712
23 Ga0065715_10157431 3300005293 Unclassified 1662
24 Ga0065715_10250654 3300005293 Bacteria 1165
25 Ga0065715_10295515 3300005293 Bacteria 1053
26 Ga0065707_10016984 3300005295 Bacteria 2432
27 Ga0065707_10241582 3300005295 Bacteria 1154
28 Ga0065707_10274295 3300005295 Unclassified 1063
29 Ga0070676_10157237 3300005328 Bacteria 1460
30 Ga0070690_100085025 3300005330 Bacteria 2074
31 Ga0070670_100000073 3300005331 Bacteria 98443
32 Ga0070670_100033529 3300005331 Bacteria 4422
33 Ga0070670_100090948 3300005331 Bacteria 2623
34 Ga0070670_100306655 3300005331 Unclassified 1389
35 Ga0070670_100850424 3300005331 Unclassified 825
36 Ga0070677_10018214 3300005333 Bacteria 2527
37 Ga0068869_100120477 3300005334 Bacteria 2006
38 Ga0068869_100584568 3300005334 Bacteria 942
39 Ga0068869_100601788 3300005334 Unclassified 929
40 Ga0070680_100021106 3300005336 Bacteria 5173
41 Ga0070680_100756968 3300005336 Bacteria 836
42 Ga0070682_100002638 3300005337 Bacteria 9908
43 Ga0070682_100423470 3300005337 Bacteria 1012
44 Ga0068868_100038666 3300005338 Unclassified 3704
45 Ga0070660_100216030 3300005339 Bacteria 1557
46 Ga0070689_100003966 3300005340 Bacteria 9938
47 Ga0070689_100110270 3300005340 Bacteria 2188
48 Ga0070687_100399152 3300005343 Bacteria 901
49 Ga0070661_100021202 3300005344 Bacteria 4638
50 Ga0070692_10088880 3300005345 Bacteria 1676
51 Ga0070692_10101337 3300005345 Bacteria 1579
52 Ga0070692_10251124 3300005345 Bacteria 1059
53 Ga0070692_10332993 3300005345 Bacteria 938
54 Ga0070692_10367402 3300005345 Unclassified 899
55 Ga0070692_10494315 3300005345 Unclassified 791
56 Ga0070668_100885437 3300005347 Bacteria 797
57 Ga0070669_100015173 3300005353 Bacteria 5487
58 Ga0070675_100221663 3300005354 Bacteria 1647
59 Ga0070671_101614984 3300005355 Bacteria 575
60 Ga0070673_100236238 3300005364 Bacteria 1587
61 Ga0070673_101946833 3300005364 Unclassified 558
62 Ga0070688_100313705 3300005365 Bacteria 1137
63 Ga0070659_100008589 3300005366 Bacteria 7468
64 Ga0070659_100164001 3300005366 Unclassified 1818
65 Ga0070659_100282057 3300005366 Unclassified 1382
66 Ga0070659_101136312 3300005366 Unclassified 689
67 Ga0070703_10002255 3300005406 Bacteria 5603
68 Ga0070701_10323982 3300005438 Unclassified 954
69 Ga0070701_10336032 3300005438 Bacteria 939
70 Ga0070705_100037256 3300005440 Bacteria 2741
71 Ga0070705_100254775 3300005440 Bacteria 1234
72 Ga0070705_100290329 3300005440 Bacteria 1167
73 Ga0070705_100298308 3300005440 Bacteria 1154
74 Ga0070705_100317660 3300005440 Bacteria 1123
75 Ga0070705_101136942 3300005440 Unclassified 641
76 Ga0070700_100058246 3300005441 Bacteria 2426
77 Ga0070700_100078144 3300005441 Bacteria 2130
78 Ga0070700_100228087 3300005441 Bacteria 1324
79 Ga0070694_100014607 3300005444 Unclassified 4917
80 Ga0070694_100032086 3300005444 Bacteria 3447
81 Ga0070694_100032823 3300005444 Bacteria 3411
82 Ga0070694_100091598 3300005444 Bacteria 2134
83 Ga0070694_100103578 3300005444 Unclassified 2016
84 Ga0070694_100133951 3300005444 Bacteria 1793
85 Ga0070694_100244435 3300005444 Unclassified 1355
86 Ga0070694_100477963 3300005444 Unclassified 988
87 Ga0070694_101118374 3300005444 Bacteria 658
88 Ga0070708_100000328 3300005445 Bacteria 35692
89 Ga0070708_100154869 3300005445 Bacteria 2133
90 Ga0070662_100729027 3300005457 Unclassified 840
91 Ga0070681_10021052 3300005458 Bacteria 6535
92 Ga0070681_10172664 3300005458 Unclassified 2083
93 Ga0070681_10570850 3300005458 Bacteria 1045
94 Ga0068867_100074506 3300005459 Bacteria 2544
95 Ga0068867_100221153 3300005459 Bacteria 1526
96 Ga0068867_100253598 3300005459 Bacteria 1432
97 Ga0070706_100000015 3300005467 Bacteria 188425
98 Ga0070706_100005153 3300005467 Bacteria 12472
99 Ga0070707_100068484 3300005468 Bacteria 3416
100 Ga0070707_100091048 3300005468 Bacteria 2952
101 Ga0070707_100259178 3300005468 Archaea 1692
102 Ga0070698_100020333 3300005471 Bacteria 6957
103 Ga0070698_100024607 3300005471 Bacteria 6281
104 Ga0070698_100066191 3300005471 Bacteria 3638
105 Ga0070699_100003349 3300005518 Bacteria 14182
106 Ga0070699_100004515 3300005518 Bacteria 12313
107 Ga0070699_100821886 3300005518 Unclassified 850
108 Ga0070699_100982541 3300005518 Unclassified 774
109 Ga0070679_100012073 3300005530 Bacteria 8249
110 Ga0070679_100091031 3300005530 Unclassified 3038
111 Ga0070679_100212204 3300005530 Bacteria 1899
112 Ga0070697_100173148 3300005536 Bacteria 1828
113 Ga0068853_100056699 3300005539 Bacteria 3379
114 Ga0068853_100190727 3300005539 Unclassified 1862
115 Ga0070672_100079471 3300005543 Bacteria 2625
116 Ga0070672_100148702 3300005543 Unclassified 1937
117 Ga0070686_100805309 3300005544 Bacteria 758
118 Ga0070695_100052603 3300005545 Bacteria 2617
119 Ga0070695_100300099 3300005545 Unclassified 1187
120 Ga0070695_100460116 3300005545 Unclassified 977
121 Ga0070696_100025405 3300005546 Unclassified 4027
122 Ga0070696_100104596 3300005546 Bacteria 2033
123 Ga0070696_100143259 3300005546 Unclassified 1749
124 Ga0070696_100359925 3300005546 Bacteria 1129
125 Ga0070693_100004504 3300005547 Bacteria 6595
126 Ga0070693_100074495 3300005547 Bacteria 2008
127 Ga0070693_100101016 3300005547 Unclassified 1757
128 Ga0070693_100194411 3300005547 Unclassified 1314
129 Ga0070693_100376018 3300005547 Unclassified 979
130 Ga0070704_100020202 3300005549 Bacteria 4291
131 Ga0070704_100167268 3300005549 Unclassified 1745
132 Ga0070704_100249324 3300005549 Bacteria 1457
133 Ga0070704_100344625 3300005549 Bacteria 1256
134 Ga0070704_100482986 3300005549 Bacteria 1072
135 Ga0070664_100057586 3300005564 Bacteria 3303
136 Ga0070664_100083824 3300005564 Bacteria 2750
137 Ga0070664_100165240 3300005564 Bacteria 1961
138 Ga0070664_100410089 3300005564 Unclassified 1240
139 Ga0068857_100013339 3300005577 Bacteria 7157
140 Ga0068857_100016052 3300005577 Bacteria 6561
141 Ga0068857_100117789 3300005577 Bacteria 2390
142 Ga0068857_100350998 3300005577 Bacteria 1366
143 Ga0068857_101258881 3300005577 Unclassified 717
144 Ga0068854_100135416 3300005578 Bacteria 1885
145 Ga0068854_101117566 3300005578 Unclassified 703
146 Ga0070702_100024642 3300005615 Bacteria 3213
147 Ga0070702_100059146 3300005615 Bacteria 2223
148 Ga0070702_100713927 3300005615 Bacteria 765
149 Ga0070702_100724832 3300005615 Bacteria 761
150 Ga0070702_100750202 3300005615 Unclassified 749
151 Ga0070702_101343899 3300005615 Unclassified 582
152 Ga0068852_100348255 3300005616 Bacteria 1446
153 Ga0068859_100007056 3300005617 Bacteria 11410
154 Ga0068859_100018005 3300005617 Bacteria 7099
155 Ga0068859_100103444 3300005617 Unclassified 2906
156 Ga0068859_100195792 3300005617 Unclassified 2105
157 Ga0068859_100198912 3300005617 Bacteria 2088
158 Ga0068859_100199934 3300005617 Unclassified 2083
159 Ga0068859_100299821 3300005617 Bacteria 1700
160 Ga0068859_100331631 3300005617 Bacteria 1616
161 Ga0068859_100437658 3300005617 Unclassified 1404
162 Ga0068859_100511018 3300005617 Bacteria 1296
163 Ga0068859_100757323 3300005617 Bacteria 1060
164 Ga0068859_100810233 3300005617 Bacteria 1024
165 Ga0068859_101824797 3300005617 Unclassified 671
166 Ga0068864_100011115 3300005618 Bacteria 7440
167 Ga0068864_100037249 3300005618 Bacteria 4150
168 Ga0068864_100041810 3300005618 Bacteria 3920
169 Ga0068864_100049430 3300005618 Bacteria 3618
170 Ga0068864_100091661 3300005618 Unclassified 2682
171 Ga0068864_100210401 3300005618 Unclassified 1790
172 Ga0068864_100540432 3300005618 Bacteria 1125
173 Ga0068864_100588851 3300005618 Bacteria 1078
174 Ga0068864_100611102 3300005618 Bacteria 1059
175 Ga0068864_100801227 3300005618 Unclassified 926
176 Ga0068864_100963510 3300005618 Bacteria 845
177 Ga0068864_101028586 3300005618 Unclassified 818
178 Ga0068864_101205355 3300005618 Unclassified 756
179 Ga0068861_100000514 3300005719 Bacteria 22601
180 Ga0068861_100080703 3300005719 Unclassified 2545
181 Ga0068861_100217371 3300005719 Unclassified 1613
182 Ga0068861_100515231 3300005719 Bacteria 1084
183 Ga0068861_100717036 3300005719 Bacteria 931
184 Ga0068851_10002464 3300005834 Bacteria 8132
185 Ga0068870_10173173 3300005840 Bacteria 1289
186 Ga0068870_10254142 3300005840 Bacteria 1091
187 Ga0068870_10316446 3300005840 Bacteria 990
188 Ga0068870_10330518 3300005840 Bacteria 972
189 Ga0068863_100099882 3300005841 Unclassified 2758
190 Ga0068863_100394503 3300005841 Bacteria 1353
191 Ga0068863_100420940 3300005841 Unclassified 1308
192 Ga0068863_100598710 3300005841 Bacteria 1091
193 Ga0068863_100896957 3300005841 Unclassified 887
194 Ga0068858_100095841 3300005842 Bacteria 2765
195 Ga0068858_100152980 3300005842 Bacteria 2170
196 Ga0068858_100321545 3300005842 Bacteria 1479
197 Ga0068858_100911740 3300005842 Bacteria 859
198 Ga0068860_100044762 3300005843 Unclassified 4217
199 Ga0068860_100098650 3300005843 Bacteria 2786
200 Ga0068860_100275027 3300005843 Bacteria 1644
201 Ga0068860_100337494 3300005843 Bacteria 1481
202 Ga0068860_100353825 3300005843 Bacteria 1446
203 Ga0068860_100372053 3300005843 Unclassified 1409
204 Ga0068860_100531499 3300005843 Unclassified 1177
205 Ga0068860_100829413 3300005843 Unclassified 939
206 Ga0068860_101226314 3300005843 Bacteria 770
207 Ga0068860_101351125 3300005843 Bacteria 734
208 Ga0068862_100092942 3300005844 Unclassified 2630
209 Ga0068862_100357215 3300005844 Unclassified 1357
210 Ga0068862_100523077 3300005844 Bacteria 1129
211 Ga0068862_100755223 3300005844 Bacteria 946
212 Ga0081539_10000487 3300005985 Bacteria 83994
213 Ga0081539_10201133 3300005985 Bacteria 920
214 Ga0070716_100011891 3300006173 Bacteria 4396
215 Ga0097621_100001343 3300006237 Bacteria 16907
216 Ga0097621_100093420 3300006237 Bacteria 2521
217 Ga0097621_100261582 3300006237 Unclassified 1518
218 Ga0068871_100002147 3300006358 Bacteria 13383
219 Ga0075428_100675233 3300006844 Bacteria 1101
220 Ga0075431_100039638 3300006847 Bacteria 4853
221 Ga0075431_101416804 3300006847 Bacteria 654
222 Ga0075433_10026070 3300006852 Unclassified 4944
223 Ga0075433_10127149 3300006852 Bacteria 2263
224 Ga0075434_100073038 3300006871 Bacteria 3423
225 Ga0075434_100390132 3300006871 Bacteria 1413
226 Ga0075429_100028590 3300006880 Bacteria 4839
227 Ga0075429_100161337 3300006880 Bacteria 1963
228 Ga0097620_100007056 3300006931 Bacteria 11410
229 Ga0097620_100018005 3300006931 Bacteria 7099
230 Ga0097620_100103446 3300006931 Unclassified 2906
231 Ga0097620_100195783 3300006931 Unclassified 2105
232 Ga0097620_100198918 3300006931 Bacteria 2088
233 Ga0097620_100199931 3300006931 Unclassified 2083
234 Ga0097620_100299840 3300006931 Bacteria 1700
235 Ga0097620_100331637 3300006931 Bacteria 1616
236 Ga0097620_100437645 3300006931 Unclassified 1404
237 Ga0097620_100511049 3300006931 Bacteria 1296
238 Ga0097620_100757333 3300006931 Bacteria 1060
239 Ga0097620_100810244 3300006931 Bacteria 1024
240 Ga0097620_100914424 3300006931 Bacteria 962
241 Ga0097620_101824804 3300006931 Unclassified 671
242 Ga0075435_100058203 3300007076 Bacteria 3129
243 Ga0105251_10094235 3300009011 Bacteria 1373
244 Ga0105251_10279463 3300009011 Bacteria 755
245 Ga0105240_10202076 3300009093 Bacteria 2328
246 Ga0105240_10555038 3300009093 Unclassified 1270
247 Ga0105240_11357901 3300009093 Bacteria 748
248 Ga0105240_11660280 3300009093 Unclassified 668
249 Ga0111539_10006562 3300009094 Bacteria 14995
250 Ga0111539_10083651 3300009094 Bacteria 3752
251 Ga0111539_10239629 3300009094 Unclassified 2111
252 Ga0111539_10360671 3300009094 Bacteria 1692
253 Ga0111539_10521330 3300009094 Bacteria 1384
254 Ga0105245_10531968 3300009098 Bacteria 1195
255 Ga0105245_11107209 3300009098 Bacteria 838
256 Ga0105247_10001521 3300009101 Bacteria 16577
257 Ga0105247_10039556 3300009101 Bacteria 2881
258 Ga0105247_10069343 3300009101 Bacteria 2200
259 Ga0114129_10021355 3300009147 Bacteria 9191
260 Ga0114129_10054924 3300009147 Bacteria 5583
261 Ga0114129_10393101 3300009147 Bacteria 1828
262 Ga0114129_10485981 3300009147 Bacteria 1615
263 Ga0105243_10002227 3300009148 Bacteria 16311
264 Ga0105243_10548475 3300009148 Bacteria 1104
265 Ga0105241_10046127 3300009174 Bacteria 3308
266 Ga0105241_10050616 3300009174 Unclassified 3166
267 Ga0105241_10178555 3300009174 Bacteria 1759
268 Ga0105241_10314027 3300009174 Bacteria 1349
269 Ga0105241_10371050 3300009174 Bacteria 1248
270 Ga0105241_10496988 3300009174 Unclassified 1087
271 Ga0105241_10733919 3300009174 Bacteria 904
272 Ga0105241_11717411 3300009174 Unclassified 610
273 Ga0105242_10059995 3300009176 Bacteria 3123
274 Ga0105242_10219793 3300009176 Bacteria 1697
275 Ga0105248_10004845 3300009177 Bacteria 14901
276 Ga0105248_10013683 3300009177 Bacteria 8932
277 Ga0105248_10056906 3300009177 Bacteria 4388
278 Ga0105248_10147482 3300009177 Bacteria 2655
279 Ga0105248_10229474 3300009177 Bacteria 2090
280 Ga0105248_10382068 3300009177 Unclassified 1586
281 Ga0105248_10679203 3300009177 Bacteria 1162
282 Ga0105248_10709503 3300009177 Bacteria 1135
283 Ga0105248_11117268 3300009177 Bacteria 891
284 Ga0105248_11250296 3300009177 Unclassified 840
285 Ga0105248_11406747 3300009177 Unclassified 789
286 Ga0105237_10001132 3300009545 Bacteria 35782
287 Ga0105237_10035433 3300009545 Bacteria 5050
288 Ga0105237_10964439 3300009545 Unclassified 860
289 Ga0105238_10003575 3300009551 Bacteria 15496
290 Ga0105238_10045209 3300009551 Bacteria 4449
291 Ga0105249_10117923 3300009553 Bacteria 2518
292 Ga0105249_10666422 3300009553 Bacteria 1099
293 Ga0105249_11282873 3300009553 Bacteria 804
294 Ga0105239_10246069 3300010375 Bacteria 2008
295 Ga0105239_10275963 3300010375 Unclassified 1891
296 Ga0105239_10769031 3300010375 Bacteria 1103
297 Ga0105239_11480641 3300010375 Unclassified 784
298 Ga0105246_10009140 3300011119 Bacteria 6102
299 Ga0105246_10011134 3300011119 Bacteria 5574
300 Ga0105246_10160839 3300011119 Bacteria 1710
301 Ga0105246_10215160 3300011119 Bacteria 1502
302 Ga0105246_11248753 3300011119 Bacteria 686
303 Ga0157373_10001035 3300013100 Bacteria 21421
304 Ga0157373_10027644 3300013100 Bacteria 4093
305 Ga0157373_10045597 3300013100 Bacteria 3129
306 Ga0157373_10251721 3300013100 Bacteria 1249
307 Ga0157374_11058724 3300013296 Bacteria 831
308 Ga0157378_10036749 3300013297 Bacteria 4334
309 Ga0157378_10070833 3300013297 Bacteria 3131
310 Ga0157378_10229572 3300013297 Bacteria 1768
311 Ga0157378_11190501 3300013297 Unclassified 801
312 Ga0163162_10003746 3300013306 Bacteria 14568
313 Ga0163162_10015778 3300013306 Bacteria 7383
314 Ga0163162_10058418 3300013306 Bacteria 3886
315 Ga0163162_10347774 3300013306 Bacteria 1615
316 Ga0163162_10932812 3300013306 Bacteria 980
317 Ga0163162_11183541 3300013306 Bacteria 867
318 Ga0157372_10016829 3300013307 Bacteria 7850
319 Ga0157372_10038216 3300013307 Bacteria 5297
320 Ga0157372_10846433 3300013307 Bacteria 1062
321 Ga0157375_10113010 3300013308 Bacteria 2817
322 Ga0157375_10195325 3300013308 Unclassified 2179
323 Ga0157375_10219331 3300013308 Bacteria 2060
324 Ga0157375_10224696 3300013308 Bacteria 2036
325 Ga0157375_10292320 3300013308 Bacteria 1792
326 Ga0157375_10547589 3300013308 Bacteria 1319
327 Ga0157375_10871978 3300013308 Bacteria 1045
328 Ga0157375_12061153 3300013308 Unclassified 679
329 Ga0163163_10000466 3300014325 Bacteria 36943
330 Ga0163163_10006281 3300014325 Bacteria 10372
331 Ga0163163_10509572 3300014325 Unclassified 1265
332 Ga0157380_10076757 3300014326 Bacteria 2720
333 Ga0157380_10079307 3300014326 Bacteria 2681
334 Ga0157380_10224506 3300014326 Unclassified 1683
335 Ga0157380_11796098 3300014326 Bacteria 672
336 Ga0157380_12092228 3300014326 Bacteria 629
337 Ga0157377_10054588 3300014745 Unclassified 2262
338 Ga0157377_10121214 3300014745 Unclassified 1585
339 Ga0157379_10034888 3300014968 Bacteria 4485
340 Ga0157379_10312755 3300014968 Bacteria 1433
341 Ga0157379_11582257 3300014968 Unclassified 639
342 Ga0163161_10233963 3300017792 Bacteria 1427
343 Ga0207656_10014992 3300025321 Bacteria 2996
344 Ga0207653_10000946 3300025885 Bacteria 9605
345 Ga0207710_10000389 3300025900 Bacteria 29876
346 Ga0207710_10150088 3300025900 Bacteria 1130
347 Ga0207710_10256577 3300025900 Bacteria 875
348 Ga0207688_10286432 3300025901 Bacteria 1005
349 Ga0207647_10001179 3300025904 Bacteria 20116
350 Ga0207647_10301865 3300025904 Bacteria 912
351 Ga0207647_10405169 3300025904 Unclassified 768
352 Ga0207645_10063676 3300025907 Bacteria 2356
353 Ga0207643_10006728 3300025908 Bacteria 6166
354 Ga0207643_10110427 3300025908 Bacteria 1620
355 Ga0207643_10127090 3300025908 Unclassified 1514
356 Ga0207684_10000083 3300025910 Bacteria 176092
357 Ga0207684_10015134 3300025910 Bacteria 6642
358 Ga0207684_10358272 3300025910 Unclassified 1255
359 Ga0207654_10045308 3300025911 Bacteria 2502
360 Ga0207654_10068078 3300025911 Bacteria 2106
361 Ga0207654_10093841 3300025911 Bacteria 1835
362 Ga0207654_10124344 3300025911 Bacteria 1624
363 Ga0207707_10003754 3300025912 Bacteria 13463
364 Ga0207707_10041406 3300025912 Bacteria 4023
365 Ga0207707_10116469 3300025912 Bacteria 2335
366 Ga0207695_10719593 3300025913 Unclassified 879
367 Ga0207695_10990879 3300025913 Bacteria 720
368 Ga0207671_10005003 3300025914 Bacteria 12412
369 Ga0207671_10092536 3300025914 Bacteria 2280
370 Ga0207671_10416144 3300025914 Bacteria 1069
371 Ga0207660_10198564 3300025917 Bacteria 1566
372 Ga0207660_10210859 3300025917 Bacteria 1521
373 Ga0207662_10024900 3300025918 Bacteria 3445
374 Ga0207662_10025951 3300025918 Unclassified 3377
375 Ga0207662_10397001 3300025918 Bacteria 934
376 Ga0207657_10208897 3300025919 Bacteria 1567
377 Ga0207649_10018629 3300025920 Bacteria 3953
378 Ga0207652_10045127 3300025921 Bacteria 3757
379 Ga0207652_10073585 3300025921 Unclassified 2973
380 Ga0207646_10117884 3300025922 Bacteria 2384
381 Ga0207646_10351739 3300025922 Bacteria 1331
382 Ga0207681_10033117 3300025923 Bacteria 3387
383 Ga0207694_10028483 3300025924 Bacteria 4259
384 Ga0207650_10000006 3300025925 Bacteria 544730
385 Ga0207650_10041363 3300025925 Bacteria 3376
386 Ga0207650_10078696 3300025925 Bacteria 2495
387 Ga0207650_10116361 3300025925 Bacteria 2076
388 Ga0207650_10393332 3300025925 Unclassified 1146
389 Ga0207659_10084386 3300025926 Unclassified 2357
390 Ga0207644_10300863 3300025931 Bacteria 1293
391 Ga0207690_10007477 3300025932 Bacteria 6484
392 Ga0207690_10492418 3300025932 Unclassified 991
393 Ga0207706_10094234 3300025933 Bacteria 2634
394 Ga0207686_10235199 3300025934 Bacteria 1331
395 Ga0207709_10008696 3300025935 Bacteria 5603
396 Ga0207670_10005499 3300025936 Bacteria 6963
397 Ga0207665_10016736 3300025939 Bacteria 4816
398 Ga0207691_10089256 3300025940 Bacteria 2765
399 Ga0207691_10148292 3300025940 Unclassified 2064
400 Ga0207691_10428979 3300025940 Bacteria 1126
401 Ga0207711_10014323 3300025941 Bacteria 6586
402 Ga0207711_10057841 3300025941 Bacteria 3334
403 Ga0207711_10062826 3300025941 Bacteria 3204
404 Ga0207689_10155573 3300025942 Bacteria 1885
405 Ga0207689_10173179 3300025942 Bacteria 1779
406 Ga0207689_10295235 3300025942 Bacteria 1343
407 Ga0207689_10298693 3300025942 Bacteria 1335
408 Ga0207679_10038280 3300025945 Bacteria 3415
409 Ga0207679_10289640 3300025945 Unclassified 1407
410 Ga0207679_10561278 3300025945 Bacteria 1025
411 Ga0207651_10935402 3300025960 Bacteria 773
412 Ga0207651_11589041 3300025960 Unclassified 589
413 Ga0207712_10009408 3300025961 Bacteria 6184
414 Ga0207712_10344532 3300025961 Unclassified 1237
415 Ga0207640_10133153 3300025981 Bacteria 1800
416 Ga0207640_10775948 3300025981 Unclassified 828
417 Ga0207677_10071094 3300026023 Bacteria 2455
418 Ga0207677_10518209 3300026023 Bacteria 1034
419 Ga0207703_10086227 3300026035 Unclassified 2630
420 Ga0207703_10094505 3300026035 Bacteria 2520
421 Ga0207703_10261530 3300026035 Bacteria 1564
422 Ga0207703_10414002 3300026035 Bacteria 1253
423 Ga0207639_10440825 3300026041 Unclassified 1181
424 Ga0207708_10000016 3300026075 Bacteria 193989
425 Ga0207708_10015453 3300026075 Bacteria 5725
426 Ga0207708_10046071 3300026075 Unclassified 3322
427 Ga0207708_10051507 3300026075 Bacteria 3134
428 Ga0207708_10077644 3300026075 Bacteria 2549
429 Ga0207708_10362008 3300026075 Bacteria 1192
430 Ga0207641_10045554 3300026088 Unclassified 3694
431 Ga0207641_10053148 3300026088 Unclassified 3432
432 Ga0207641_10152055 3300026088 Unclassified 2097
433 Ga0207641_10226931 3300026088 Bacteria 1734
434 Ga0207641_10284752 3300026088 Bacteria 1556
435 Ga0207641_10340211 3300026088 Bacteria 1428
436 Ga0207641_10748046 3300026088 Bacteria 965
437 Ga0207641_10931689 3300026088 Unclassified 863
438 Ga0207648_10007267 3300026089 Bacteria 10919
439 Ga0207648_10114406 3300026089 Bacteria 2370
440 Ga0207648_10137333 3300026089 Bacteria 2154
441 Ga0207648_10301026 3300026089 Bacteria 1438
442 Ga0207648_10411518 3300026089 Bacteria 1227
443 Ga0207676_10010685 3300026095 Bacteria 6545
444 Ga0207676_10013380 3300026095 Bacteria 5893
445 Ga0207676_10037908 3300026095 Unclassified 3677
446 Ga0207676_10212430 3300026095 Bacteria 1717
447 Ga0207676_10580240 3300026095 Bacteria 1075
448 Ga0207676_10600294 3300026095 Bacteria 1057
449 Ga0207676_10948538 3300026095 Bacteria 846
450 Ga0207676_10968671 3300026095 Unclassified 837
451 Ga0207676_11496999 3300026095 Unclassified 672
452 Ga0207674_10000722 3300026116 Bacteria 43236
453 Ga0207674_10034719 3300026116 Bacteria 5268
454 Ga0207674_10118101 3300026116 Bacteria 2622
455 Ga0207674_10177964 3300026116 Bacteria 2079
456 Ga0207674_10471781 3300026116 Bacteria 1213
457 Ga0207674_10472799 3300026116 Bacteria 1212
458 Ga0207674_11472287 3300026116 Unclassified 650
459 Ga0207675_100003956 3300026118 Bacteria 14376
460 Ga0207675_100047011 3300026118 Bacteria 4031
461 Ga0207675_100060411 3300026118 Bacteria 3539
462 Ga0207675_100065327 3300026118 Bacteria 3400
463 Ga0207675_100103230 3300026118 Bacteria 2686
464 Ga0207675_100432747 3300026118 Bacteria 1301
465 Ga0207675_100633738 3300026118 Bacteria 1074
466 Ga0207698_10085708 3300026142 Bacteria 2559
467 Ga0207698_11387224 3300026142 Bacteria 718
468 Ga0207698_12160898 3300026142 Unclassified 570
469 Ga0207428_10014113 3300027907 Bacteria 6956
470 Ga0207428_10272499 3300027907 Unclassified 1258
471 Ga0268265_10066991 3300028380 Bacteria 2778
472 Ga0268265_10219527 3300028380 Bacteria 1662
473 Ga0268265_10643416 3300028380 Bacteria 1018
474 Ga0268265_10690536 3300028380 Bacteria 985
475 Ga0268265_10804146 3300028380 Unclassified 917
476 Ga0268265_10905062 3300028380 Unclassified 867
477 Ga0268264_10132133 3300028381 Unclassified 2215
478 Ga0268264_10188880 3300028381 Unclassified 1877
479 Ga0268264_10197551 3300028381 Bacteria 1838
480 Ga0268264_10355500 3300028381 Bacteria 1396
481 Ga0307408_100002729 3300031548 Bacteria 12258
482 Ga0307408_100172112 3300031548 Unclassified 1730
483 Ga0307408_101017982 3300031548 Unclassified 764
484 Ga0307405_10275779 3300031731 Bacteria 1263
485 Ga0307405_10362514 3300031731 Unclassified 1122
486 Ga0307405_10430742 3300031731 Unclassified 1040
487 Ga0307413_10116376 3300031824 Bacteria 1801
488 Ga0307413_10539240 3300031824 Unclassified 944
489 Ga0307410_10014517 3300031852 Bacteria 4638
490 Ga0307410_10414147 3300031852 Bacteria 1092
491 Ga0307406_10003176 3300031901 Bacteria 8941
492 Ga0307412_10046009 3300031911 Bacteria 2856
493 Ga0307409_100029998 3300031995 Bacteria 3901
494 Ga0307409_100583767 3300031995 Bacteria 1102
495 Ga0307409_100656435 3300031995 Unclassified 1043
496 Ga0307416_100022476 3300032002 Bacteria 4554
497 Ga0307416_100046562 3300032002 Bacteria 3424
498 Ga0307416_100227214 3300032002 Bacteria 1796
499 Ga0307414_10014701 3300032004 Bacteria 4701
500 Ga0307411_10099900 3300032005 Bacteria 2049
501 Ga0307415_100087283 3300032126 Bacteria 2247
502 Ga0307415_100555986 3300032126 Bacteria 1013
503 Ga0307415_100628917 3300032126 Bacteria 959
504 Ga0373938_0035776 3300034957 Bacteria 1084
505 Ga0373940_0041373 3300035088 Bacteria 1267
506 Ga0373949_0066187 3300035090 Unclassified 939
507 Ga0373951_0000825 3300035091 Bacteria 8418
508 Ga0373941_0011720 3300035115 Bacteria 2273
509 Ga0373961_0119127 3300035241 Bacteria 873
510 Ga0373961_0273521 3300035241 Bacteria 618
511 Ga0373931_0527610 3300035691 Bacteria 765
512 Ga0395899_0233723 3300037312 Bacteria 1268
513 Ga0395898_0086499 3300037466 Bacteria 3021
514 Ga0395901_0346710 3300038443 Bacteria 1533
515 Ga0395901_0410061 3300038443 Bacteria 1391
516 Ga0242420_004787 3300038996 Bacteria 2063
517 Ga0439448_0038924 3300042005 Bacteria 1532
518 Ga0439455_0037836 3300042012 Bacteria 1225
519 Ga0439458_0014295 3300042157 Bacteria 1790
520 Ga0439464_0062159 3300042439 Unclassified 1094
521 Ga0451576_0556041 3300045051 Bacteria 1206
522 Ga0495643_0314769 3300046522 Unclassified 709
523 Ga0495625_0593238 3300046660 Bacteria 666
524 Ga0496106_0330617 3300048909 Bacteria 1223
525 Ga0496107_0453556 3300048910 Unclassified 952
526 Ga0496108_0158165 3300048911 Bacteria 1957
527 Ga0496110_0530257 3300048913 Bacteria 1071
528 Ga0496112_0449259 3300048915 Bacteria 1227
529 Ga0496112_0690751 3300048915 Unclassified 949
530 Ga0496112_1223562 3300048915 Unclassified 668
531 Ga0496113_0929621 3300048916 Bacteria 687
532 Ga0501291_004421 3300049514 Unclassified 1795
533 Ga0501291_020021 3300049514 Unclassified 1055
534 Ga0501291_028477 3300049514 Unclassified 930
535 Ga0501292_002605 3300049515 Bacteria 2341
536 Ga0501295_050681 3300049518 Unclassified 888
537 Ga0501296_002824 3300049519 Bacteria 1838
538 Ga0501296_016180 3300049519 Unclassified 925
539 Ga0501298_003727 3300049521 Archaea 2374
540 Ga0501298_042208 3300049521 Bacteria 927
541 Ga0501038_0008522 3300049574 Bacteria 9423
542 Ga0501048_0477979 3300049582 Unclassified 893
543 Ga0501198_042439 3300049649 Unclassified 791
544 Ga0501199_054622 3300049650 Unclassified 546
545 Ga0501202_030542 3300049652 Unclassified 1121
546 Ga0501206_007597 3300049653 Unclassified 1423
547 Ga0501207_000225 3300049654 Bacteria 5733
548 Ga0501209_008628 3300049656 Bacteria 2019
549 Ga0501214_003866 3300049659 Unclassified 1354
550 Ga0501216_002374 3300049660 Bacteria 2665
551 Ga0501223_011787 3300049663 Bacteria 1754
552 Ga0501223_022354 3300049663 Unclassified 1235
553 Ga0501224_004452 3300049664 Bacteria 1991
554 Ga0501227_000137 3300049665 Bacteria 13407
555 Ga0501227_006476 3300049665 Bacteria 2516
556 Ga0501230_028697 3300049667 Bacteria 1024
557 Ga0501233_018684 3300049668 Unclassified 1460
558 Ga0501233_056084 3300049668 Unclassified 966
559 Ga0501235_004495 3300049669 Bacteria 3014
560 Ga0501235_100198 3300049669 Bacteria 707
561 Ga0501243_012435 3300049675 Archaea 1343
562 Ga0501246_007277 3300049676 Bacteria 963
563 Ga0501249_066249 3300049679 Unclassified 840
564 Ga0501249_070115 3300049679 Bacteria 818
565 Ga0501251_023811 3300049681 Unclassified 832
566 Ga0501257_056376 3300049686 Bacteria 987
567 Ga0501257_057090 3300049686 Bacteria 981
568 Ga0501257_071578 3300049686 Unclassified 886
569 Ga0501259_008757 3300049688 Bacteria 1634
570 Ga0501260_004941 3300049689 Unclassified 1243
571 Ga0501260_027116 3300049689 Unclassified 645
572 Ga0501261_006727 3300049690 Unclassified 1466
573 Ga0501225_0001774 3300049705 Bacteria 6752
574 Ga0501225_0019292 3300049705 Unclassified 1888
575 Ga0501225_0059835 3300049705 Unclassified 1070
576 Ga0501229_006635 3300049706 Bacteria 1434
577 Ga0501234_000728 3300049707 Bacteria 5083
578 Ga0501245_029066 3300049708 Bacteria 905
579 Ga0501264_023577 3300049761 Unclassified 668
580 Ga0501268_009314 3300049765 Unclassified 1507
581 Ga0501268_017749 3300049765 Unclassified 1190
582 Ga0501270_078998 3300049767 Bacteria 651
583 Ga0501273_012221 3300049770 Unclassified 1079
584 Ga0501273_017795 3300049770 Unclassified 941
585 Ga0501278_006488 3300049774 Unclassified 875
586 Ga0501278_012115 3300049774 Unclassified 708
587 Ga0501279_004416 3300049775 Unclassified 1846
588 Ga0501283_012069 3300049779 Unclassified 1294
589 Ga0501283_014201 3300049779 Bacteria 1215
590 Ga0501204_006764 3300049850 Unclassified 1279
591 Ga0501212_013295 3300049851 Unclassified 1207
592 Ga0501226_002647 3300049853 Bacteria 2170
593 Ga0501226_008722 3300049853 Bacteria 1131
594 nmdc:mga05p37_18279_c1 3300050507 Bacteria 8468
595 nmdc:mga05p37_339056_c1 3300050507 Bacteria 1773
596 nmdc:mga05p37_500572_c1 3300050507 Bacteria 1394
597 nmdc:mga05p37_60254_c1 3300050507 Bacteria 4674
598 nmdc:mga05p37_656796_c1 3300050507 Bacteria 1173
599 nmdc:mga09592_466417_c1 3300050508 Bacteria 1089
600 nmdc:mga0qj67_113540_c1 3300050509 Bacteria 2188
601 nmdc:mga0qj67_12928_c1 3300050509 Bacteria 6299
602 nmdc:mga06r32_123259_c1 3300050510 Bacteria 2558
603 nmdc:mga06r32_1486818_c1 3300050510 Unclassified 618
604 nmdc:mga06r32_421036_c1 3300050510 Bacteria 1317
605 nmdc:mga08y16_13322_c1 3300050511 Bacteria 8649
606 nmdc:mga08y16_1489421_c1 3300050511 Unclassified 637
607 nmdc:mga08y16_307232_c1 3300050511 Unclassified 1634
608 nmdc:mga08y16_35018_c1 3300050511 Bacteria 5274
609 nmdc:mga08y16_381108_c1 3300050511 Bacteria 1445
610 nmdc:mga08y16_4683_c1 3300050511 Bacteria 14257
611 nmdc:mga0n895_47412_c1 3300050512 Unclassified 4201
612 nmdc:mga0n895_490327_c1 3300050512 Bacteria 1239
613 nmdc:mga0rr50_34521_c1 3300050513 Bacteria 3623
614 nmdc:mga0a205_33369_c1 3300050515 Unclassified 4936
615 nmdc:mga0a205_54166_c1 3300050515 Bacteria 3873
616 nmdc:mga0a205_96543_c1 3300050515 Bacteria 2854
617 Ga0530510_0028900 3300061734 Unclassified 3977
618 Ga0114129_10238770
619 SwRhRL3b_contig_4273695
620 MRS1b_contig_5818974
621 MBSR1b_contig_4847824
622 CNAas_1000967
623 JGI24751J29686_10000036
624 JGI24751J29686_10000038
625 JGI25406J46586_10061152
626 rootL2_10103635
627 Ga0065714_10064462
628 Ga0065714_10125642
629 Ga0065704_10102168
630 Ga0065704_10125823
631 Ga0065712_10000135
632 Ga0065712_10003714
633 Ga0065712_10068954
634 Ga0065712_10351881
635 Ga0065715_10003646
636 Ga0065715_10006106
637 Ga0065715_10089247
638 Ga0065715_10089806
639 Ga0065715_10093366
640 Ga0065715_10157431
641 Ga0065715_10250654
642 Ga0065715_10295515
643 Ga0065707_10016984
644 Ga0065707_10241582
645 Ga0065707_10274295
646 Ga0070676_10157237
647 Ga0070690_100085025
648 Ga0070670_100000073
649 Ga0070670_100033529
650 Ga0070670_100090948
651 Ga0070670_100306655
652 Ga0070670_100850424
653 Ga0070677_10018214
654 Ga0068869_100120477
655 Ga0068869_100584568
656 Ga0068869_100601788
657 Ga0070680_100021106
658 Ga0070680_100756968
659 Ga0070682_100002638
660 Ga0070682_100423470
661 Ga0068868_100038666
662 Ga0070660_100216030
663 Ga0070689_100003966
664 Ga0070689_100110270
665 Ga0070687_100399152
666 Ga0070661_100021202
667 Ga0070692_10088880
668 Ga0070692_10101337
669 Ga0070692_10251124
670 Ga0070692_10332993
671 Ga0070692_10367402
672 Ga0070692_10494315
673 Ga0070668_100885437
674 Ga0070669_100015173
675 Ga0070675_100221663
676 Ga0070671_101614984
677 Ga0070673_100236238
678 Ga0070673_101946833
679 Ga0070688_100313705
680 Ga0070659_100008589
681 Ga0070659_100164001
682 Ga0070659_100282057
683 Ga0070659_101136312
684 Ga0070703_10002255
685 Ga0070701_10323982
686 Ga0070701_10336032
687 Ga0070705_100037256
688 Ga0070705_100254775
689 Ga0070705_100290329
690 Ga0070705_100298308
691 Ga0070705_100317660
692 Ga0070705_101136942
693 Ga0070700_100058246
694 Ga0070700_100078144
695 Ga0070700_100228087
696 Ga0070694_100014607
697 Ga0070694_100032086
698 Ga0070694_100032823
699 Ga0070694_100091598
700 Ga0070694_100103578
701 Ga0070694_100133951
702 Ga0070694_100244435
703 Ga0070694_100477963
704 Ga0070694_101118374
705 Ga0070708_100000328
706 Ga0070708_100154869
707 Ga0070662_100729027
708 Ga0070681_10021052
709 Ga0070681_10172664
710 Ga0070681_10570850
711 Ga0068867_100074506
712 Ga0068867_100221153
713 Ga0068867_100253598
714 Ga0070706_100000015
715 Ga0070706_100005153
716 Ga0070707_100068484
717 Ga0070707_100091048
718 Ga0070707_100259178
719 Ga0070698_100020333
720 Ga0070698_100024607
721 Ga0070698_100066191
722 Ga0070699_100003349
723 Ga0070699_100004515
724 Ga0070699_100821886
725 Ga0070699_100982541
726 Ga0070679_100012073
727 Ga0070679_100091031
728 Ga0070679_100212204
729 Ga0070697_100173148
730 Ga0068853_100056699
731 Ga0068853_100190727
732 Ga0070672_100079471
733 Ga0070672_100148702
734 Ga0070686_100805309
735 Ga0070695_100052603
736 Ga0070695_100300099
737 Ga0070695_100460116
738 Ga0070696_100025405
739 Ga0070696_100104596
740 Ga0070696_100143259
741 Ga0070696_100359925
742 Ga0070693_100004504
743 Ga0070693_100074495
744 Ga0070693_100101016
745 Ga0070693_100194411
746 Ga0070693_100376018
747 Ga0070704_100020202
748 Ga0070704_100167268
749 Ga0070704_100249324
750 Ga0070704_100344625
751 Ga0070704_100482986
752 Ga0070664_100057586
753 Ga0070664_100083824
754 Ga0070664_100165240
755 Ga0070664_100410089
756 Ga0068857_100013339
757 Ga0068857_100016052
758 Ga0068857_100117789
759 Ga0068857_100350998
760 Ga0068857_101258881
761 Ga0068854_100135416
762 Ga0068854_101117566
763 Ga0070702_100024642
764 Ga0070702_100059146
765 Ga0070702_100713927
766 Ga0070702_100724832
767 Ga0070702_100750202
768 Ga0070702_101343899
769 Ga0068852_100348255
770 Ga0068859_100007056
771 Ga0068859_100018005
772 Ga0068859_100103444
773 Ga0068859_100195792
774 Ga0068859_100198912
775 Ga0068859_100199934
776 Ga0068859_100299821
777 Ga0068859_100331631
778 Ga0068859_100437658
779 Ga0068859_100511018
780 Ga0068859_100757323
781 Ga0068859_100810233
782 Ga0068859_101824797
783 Ga0068864_100011115
784 Ga0068864_100037249
785 Ga0068864_100041810
786 Ga0068864_100049430
787 Ga0068864_100091661
788 Ga0068864_100210401
789 Ga0068864_100540432
790 Ga0068864_100588851
791 Ga0068864_100611102
792 Ga0068864_100801227
793 Ga0068864_100963510
794 Ga0068864_101028586
795 Ga0068864_101205355
796 Ga0068861_100000514
797 Ga0068861_100080703
798 Ga0068861_100217371
799 Ga0068861_100515231
800 Ga0068861_100717036
801 Ga0068851_10002464
802 Ga0068870_10173173
803 Ga0068870_10254142
804 Ga0068870_10316446
805 Ga0068870_10330518
806 Ga0068863_100099882
807 Ga0068863_100394503
808 Ga0068863_100420940
809 Ga0068863_100598710
810 Ga0068863_100896957
811 Ga0068858_100095841
812 Ga0068858_100152980
813 Ga0068858_100321545
814 Ga0068858_100911740
815 Ga0068860_100044762
816 Ga0068860_100098650
817 Ga0068860_100275027
818 Ga0068860_100337494
819 Ga0068860_100353825
820 Ga0068860_100372053
821 Ga0068860_100531499
822 Ga0068860_100829413
823 Ga0068860_101226314
824 Ga0068860_101351125
825 Ga0068862_100092942
826 Ga0068862_100357215
827 Ga0068862_100523077
828 Ga0068862_100755223
829 Ga0081539_10000487
830 Ga0081539_10201133
831 Ga0070716_100011891
832 Ga0097621_100001343
833 Ga0097621_100093420
834 Ga0097621_100261582
835 Ga0068871_100002147
836 Ga0075428_100675233
837 Ga0075431_100039638
838 Ga0075431_101416804
839 Ga0075433_10026070
840 Ga0075433_10127149
841 Ga0075434_100073038
842 Ga0075434_100390132
843 Ga0075429_100028590
844 Ga0075429_100161337
845 Ga0097620_100007056
846 Ga0097620_100018005
847 Ga0097620_100103446
848 Ga0097620_100195783
849 Ga0097620_100198918
850 Ga0097620_100199931
851 Ga0097620_100299840
852 Ga0097620_100331637
853 Ga0097620_100437645
854 Ga0097620_100511049
855 Ga0097620_100757333
856 Ga0097620_100810244
857 Ga0097620_100914424
858 Ga0097620_101824804
859 Ga0075435_100058203
860 Ga0105251_10094235
861 Ga0105251_10279463
862 Ga0105240_10202076
863 Ga0105240_10555038
864 Ga0105240_11357901
865 Ga0105240_11660280
866 Ga0111539_10006562
867 Ga0111539_10083651
868 Ga0111539_10239629
869 Ga0111539_10360671
870 Ga0111539_10521330
871 Ga0105245_10531968
872 Ga0105245_11107209
873 Ga0105247_10001521
874 Ga0105247_10039556
875 Ga0105247_10069343
876 Ga0114129_10021355
877 Ga0114129_10054924
878 Ga0114129_10393101
879 Ga0114129_10485981
880 Ga0105243_10002227
881 Ga0105243_10548475
882 Ga0105241_10046127
883 Ga0105241_10050616
884 Ga0105241_10178555
885 Ga0105241_10314027
886 Ga0105241_10371050
887 Ga0105241_10496988
888 Ga0105241_10733919
889 Ga0105241_11717411
890 Ga0105242_10059995
891 Ga0105242_10219793
892 Ga0105248_10004845
893 Ga0105248_10013683
894 Ga0105248_10056906
895 Ga0105248_10147482
896 Ga0105248_10229474
897 Ga0105248_10382068
898 Ga0105248_10679203
899 Ga0105248_10709503
900 Ga0105248_11117268
901 Ga0105248_11250296
902 Ga0105248_11406747
903 Ga0105237_10001132
904 Ga0105237_10035433
905 Ga0105237_10964439
906 Ga0105238_10003575
907 Ga0105238_10045209
908 Ga0105249_10117923
909 Ga0105249_10666422
910 Ga0105249_11282873
911 Ga0105239_10246069
912 Ga0105239_10275963
913 Ga0105239_10769031
914 Ga0105239_11480641
915 Ga0105246_10009140
916 Ga0105246_10011134
917 Ga0105246_10160839
918 Ga0105246_10215160
919 Ga0105246_11248753
920 Ga0157373_10001035
921 Ga0157373_10027644
922 Ga0157373_10045597
923 Ga0157373_10251721
924 Ga0157374_11058724
925 Ga0157378_10036749
926 Ga0157378_10070833
927 Ga0157378_10229572
928 Ga0157378_11190501
929 Ga0163162_10003746
930 Ga0163162_10015778
931 Ga0163162_10058418
932 Ga0163162_10347774
933 Ga0163162_10932812
934 Ga0163162_11183541
935 Ga0157372_10016829
936 Ga0157372_10038216
937 Ga0157372_10846433
938 Ga0157375_10113010
939 Ga0157375_10195325
940 Ga0157375_10219331
941 Ga0157375_10224696
942 Ga0157375_10292320
943 Ga0157375_10547589
944 Ga0157375_10871978
945 Ga0157375_12061153
946 Ga0163163_10000466
947 Ga0163163_10006281
948 Ga0163163_10509572
949 Ga0157380_10076757
950 Ga0157380_10079307
951 Ga0157380_10224506
952 Ga0157380_11796098
953 Ga0157380_12092228
954 Ga0157377_10054588
955 Ga0157377_10121214
956 Ga0157379_10034888
957 Ga0157379_10312755
958 Ga0157379_11582257
959 Ga0163161_10233963
960 Ga0207656_10014992
961 Ga0207653_10000946
962 Ga0207710_10000389
963 Ga0207710_10150088
964 Ga0207710_10256577
965 Ga0207688_10286432
966 Ga0207647_10001179
967 Ga0207647_10301865
968 Ga0207647_10405169
969 Ga0207645_10063676
970 Ga0207643_10006728
971 Ga0207643_10110427
972 Ga0207643_10127090
973 Ga0207684_10000083
974 Ga0207684_10015134
975 Ga0207684_10358272
976 Ga0207654_10045308
977 Ga0207654_10068078
978 Ga0207654_10093841
979 Ga0207654_10124344
980 Ga0207707_10003754
981 Ga0207707_10041406
982 Ga0207707_10116469
983 Ga0207695_10719593
984 Ga0207695_10990879
985 Ga0207671_10005003
986 Ga0207671_10092536
987 Ga0207671_10416144
988 Ga0207660_10198564
989 Ga0207660_10210859
990 Ga0207662_10024900
991 Ga0207662_10025951
992 Ga0207662_10397001
993 Ga0207657_10208897
994 Ga0207649_10018629
995 Ga0207652_10045127
996 Ga0207652_10073585
997 Ga0207646_10117884
998 Ga0207646_10351739
999 Ga0207681_10033117
1000 Ga0207694_10028483
1001 Ga0207650_10000006
1002 Ga0207650_10041363
1003 Ga0207650_10078696
1004 Ga0207650_10116361
1005 Ga0207650_10393332
1006 Ga0207659_10084386
1007 Ga0207644_10300863
1008 Ga0207690_10007477
1009 Ga0207690_10492418
1010 Ga0207706_10094234
1011 Ga0207686_10235199
1012 Ga0207709_10008696
1013 Ga0207670_10005499
1014 Ga0207665_10016736
1015 Ga0207691_10089256
1016 Ga0207691_10148292
1017 Ga0207691_10428979
1018 Ga0207711_10014323
1019 Ga0207711_10057841
1020 Ga0207711_10062826
1021 Ga0207689_10155573
1022 Ga0207689_10173179
1023 Ga0207689_10295235
1024 Ga0207689_10298693
1025 Ga0207679_10038280
1026 Ga0207679_10289640
1027 Ga0207679_10561278
1028 Ga0207651_10935402
1029 Ga0207651_11589041
1030 Ga0207712_10009408
1031 Ga0207712_10344532
1032 Ga0207640_10133153
1033 Ga0207640_10775948
1034 Ga0207677_10071094
1035 Ga0207677_10518209
1036 Ga0207703_10086227
1037 Ga0207703_10094505
1038 Ga0207703_10261530
1039 Ga0207703_10414002
1040 Ga0207639_10440825
1041 Ga0207708_10000016
1042 Ga0207708_10015453
1043 Ga0207708_10046071
1044 Ga0207708_10051507
1045 Ga0207708_10077644
1046 Ga0207708_10362008
1047 Ga0207641_10045554
1048 Ga0207641_10053148
1049 Ga0207641_10152055
1050 Ga0207641_10226931
1051 Ga0207641_10284752
1052 Ga0207641_10340211
1053 Ga0207641_10748046
1054 Ga0207641_10931689
1055 Ga0207648_10007267
1056 Ga0207648_10114406
1057 Ga0207648_10137333
1058 Ga0207648_10301026
1059 Ga0207648_10411518
1060 Ga0207676_10010685
1061 Ga0207676_10013380
1062 Ga0207676_10037908
1063 Ga0207676_10212430
1064 Ga0207676_10580240
1065 Ga0207676_10600294
1066 Ga0207676_10948538
1067 Ga0207676_10968671
1068 Ga0207676_11496999
1069 Ga0207674_10000722
1070 Ga0207674_10034719
1071 Ga0207674_10118101
1072 Ga0207674_10177964
1073 Ga0207674_10471781
1074 Ga0207674_10472799
1075 Ga0207674_11472287
1076 Ga0207675_100003956
1077 Ga0207675_100047011
1078 Ga0207675_100060411
1079 Ga0207675_100065327
1080 Ga0207675_100103230
1081 Ga0207675_100432747
1082 Ga0207675_100633738
1083 Ga0207698_10085708
1084 Ga0207698_11387224
1085 Ga0207698_12160898
1086 Ga0207428_10014113
1087 Ga0207428_10272499
1088 Ga0268265_10066991
1089 Ga0268265_10219527
1090 Ga0268265_10643416
1091 Ga0268265_10690536
1092 Ga0268265_10804146
1093 Ga0268265_10905062
1094 Ga0268264_10132133
1095 Ga0268264_10188880
1096 Ga0268264_10197551
1097 Ga0268264_10355500
1098 Ga0307408_100002729
1099 Ga0307408_100172112
1100 Ga0307408_101017982
1101 Ga0307405_10275779
1102 Ga0307405_10362514
1103 Ga0307405_10430742
1104 Ga0307413_10116376
1105 Ga0307413_10539240
1106 Ga0307410_10014517
1107 Ga0307410_10414147
1108 Ga0307406_10003176
1109 Ga0307412_10046009
1110 Ga0307409_100029998
1111 Ga0307409_100583767
1112 Ga0307409_100656435
1113 Ga0307416_100022476
1114 Ga0307416_100046562
1115 Ga0307416_100227214
1116 Ga0307414_10014701
1117 Ga0307411_10099900
1118 Ga0307415_100087283
1119 Ga0307415_100555986
1120 Ga0307415_100628917
1121 Ga0373938_0035776
1122 Ga0373940_0041373
1123 Ga0373949_0066187
1124 Ga0373951_0000825
1125 Ga0373941_0011720
1126 Ga0373961_0119127
1127 Ga0373961_0273521
1128 Ga0373931_0527610
1129 Ga0395899_0233723
1130 Ga0395898_0086499
1131 Ga0395901_0346710
1132 Ga0395901_0410061
1133 Ga0242420_004787
1134 Ga0439448_0038924
1135 Ga0439455_0037836
1136 Ga0439458_0014295
1137 Ga0439464_0062159
1138 Ga0451576_0556041
1139 Ga0495643_0314769
1140 Ga0495625_0593238
1141 Ga0496106_0330617
1142 Ga0496107_0453556
1143 Ga0496108_0158165
1144 Ga0496110_0530257
1145 Ga0496112_0449259
1146 Ga0496112_0690751
1147 Ga0496112_1223562
1148 Ga0496113_0929621
1149 Ga0501291_004421
1150 Ga0501291_020021
1151 Ga0501291_028477
1152 Ga0501292_002605
1153 Ga0501295_050681
1154 Ga0501296_002824
1155 Ga0501296_016180
1156 Ga0501298_003727
1157 Ga0501298_042208
1158 Ga0501038_0008522
1159 Ga0501048_0477979
1160 Ga0501198_042439
1161 Ga0501199_054622
1162 Ga0501202_030542
1163 Ga0501206_007597
1164 Ga0501207_000225
1165 Ga0501209_008628
1166 Ga0501214_003866
1167 Ga0501216_002374
1168 Ga0501223_011787
1169 Ga0501223_022354
1170 Ga0501224_004452
1171 Ga0501227_000137
1172 Ga0501227_006476
1173 Ga0501230_028697
1174 Ga0501233_018684
1175 Ga0501233_056084
1176 Ga0501235_004495
1177 Ga0501235_100198
1178 Ga0501243_012435
1179 Ga0501246_007277
1180 Ga0501249_066249
1181 Ga0501249_070115
1182 Ga0501251_023811
1183 Ga0501257_056376
1184 Ga0501257_057090
1185 Ga0501257_071578
1186 Ga0501259_008757
1187 Ga0501260_004941
1188 Ga0501260_027116
1189 Ga0501261_006727
1190 Ga0501225_0001774
1191 Ga0501225_0019292
1192 Ga0501225_0059835
1193 Ga0501229_006635
1194 Ga0501234_000728
1195 Ga0501245_029066
1196 Ga0501264_023577
1197 Ga0501268_009314
1198 Ga0501268_017749
1199 Ga0501270_078998
1200 Ga0501273_012221
1201 Ga0501273_017795
1202 Ga0501278_006488
1203 Ga0501278_012115
1204 Ga0501279_004416
1205 Ga0501283_012069
1206 Ga0501283_014201
1207 Ga0501204_006764
1208 Ga0501212_013295
1209 Ga0501226_002647
1210 Ga0501226_008722
1211 nmdc:mga05p37_18279_c1
1212 nmdc:mga05p37_339056_c1
1213 nmdc:mga05p37_500572_c1
1214 nmdc:mga05p37_60254_c1
1215 nmdc:mga05p37_656796_c1
1216 nmdc:mga09592_466417_c1
1217 nmdc:mga0qj67_113540_c1
1218 nmdc:mga0qj67_12928_c1
1219 nmdc:mga06r32_123259_c1
1220 nmdc:mga06r32_1486818_c1
1221 nmdc:mga06r32_421036_c1
1222 nmdc:mga08y16_13322_c1
1223 nmdc:mga08y16_1489421_c1
1224 nmdc:mga08y16_307232_c1
1225 nmdc:mga08y16_35018_c1
1226 nmdc:mga08y16_381108_c1
1227 nmdc:mga08y16_4683_c1
1228 nmdc:mga0n895_47412_c1
1229 nmdc:mga0n895_490327_c1
1230 nmdc:mga0rr50_34521_c1
1231 nmdc:mga0a205_33369_c1
1232 nmdc:mga0a205_54166_c1
1233 nmdc:mga0a205_96543_c1
1234 Ga0530510_0028900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jq5-assembly1.cif.gz_A solution structure of rpa3114, a sec-c motif containing protein from rhodopseudomonas palustris; northeast structural genomics consortium target rpt5 / ontario center for structural proteomics target rp3097 0.8297 37 128
4orl-assembly1.cif.gz_A crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution 0.7718 60 128
8f3m-assembly1.cif.gz_A crystal structure of penicillin binding protein 5 (pbp5) t485a variant with s466 insertion apo form from enterococcus faecium 0.7642 22 128
8f3f-assembly1.cif.gz_A crystal structure of penicillin binding protein 5 (pbp5) t485m variant apo form from enterococcus faecium 0.763 22 128
8f3q-assembly1.cif.gz_A crystal structure of penicillin binding protein 5 (pbp5) y460a variant apo form from enterococcus faecium 0.7586 24 128
ID Description Score Start End Superfamily
2jq5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8297 37 128 3.10.450.50
af_P37052_1_152_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8165 33 128 3.10.450.50
af_O33346_31_139_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7526 33 128 3.10.450.50
af_Q23164_183_340_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7493 81 128 2.40.128.20
1nu3A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.715 37 127 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V8LFL5-F1-model_v4 DUF4440 domain-containing protein 0.9504 19 173
AF-A0A0S8DR11-F1-model_v4 Uncharacterized protein 0.9405 33 128
AF-A0A7W1LX37-F1-model_v4 DUF4440 domain-containing protein 0.9255 2 167
AF-A0A1Q7Y9N9-F1-model_v4 DUF4440 domain-containing protein 0.9208 1 167
AF-A0A352EUH7-F1-model_v4 DUF4440 domain-containing protein 0.919 1 170

Map