F469305

General Info

Members Datasets Scaffolds Average Seq Length
613 251 1226 149

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0228916|Ga0501040_0228916_267_743
Length 158
Sequence VLLEEDDMSAKVHLHLHVSDLGKSREFYERFLGTPPVKVKPGYVKFLPGWAPVNLALSGGGAAGAGTIDHVGVQVATVDAVTTELARVKAAGLPVREEMGVDCCHANQDKFWVQDPDGVEWEVYHLNYDLEDEAAAPRGRGLPLSTSASCCGSGGGTR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
194 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0228916 3300049576 Bacteria 1323
2 JGI25406J46586_10047407 3300003203 Unclassified 1465
3 JGI26129J50193_1000514 3300003349 Bacteria 2432
4 JGI25405J52794_10013414 3300003911 Bacteria 1589
5 Ga0058861_11289412 3300004800 Bacteria 767
6 Ga0065712_10226382 3300005290 Bacteria 1025
7 Ga0065715_10127416 3300005293 Bacteria 2087
8 Ga0065707_10106719 3300005295 Bacteria 2584
9 Ga0065707_10332736 3300005295 Bacteria 947
10 Ga0065707_10797384 3300005295 Bacteria 600
11 Ga0070676_10000338 3300005328 Bacteria 21345
12 Ga0070690_100542073 3300005330 Bacteria 876
13 Ga0070690_100929639 3300005330 Bacteria 682
14 Ga0070690_101463740 3300005330 Bacteria 551
15 Ga0070670_100022224 3300005331 Bacteria 5459
16 Ga0068869_100000894 3300005334 Bacteria 17186
17 Ga0068869_100013262 3300005334 Bacteria 5477
18 Ga0070666_10314586 3300005335 Bacteria 1116
19 Ga0070680_100001984 3300005336 Bacteria 15059
20 Ga0070680_100155613 3300005336 Bacteria 1920
21 Ga0070680_100451404 3300005336 Bacteria 1098
22 Ga0070682_100000313 3300005337 Bacteria 33584
23 Ga0068868_100007350 3300005338 Bacteria 7844
24 Ga0070689_100486437 3300005340 Bacteria 1055
25 Ga0070691_10006203 3300005341 Bacteria 5455
26 Ga0070691_10045788 3300005341 Bacteria 2076
27 Ga0070687_100016678 3300005343 Bacteria 3358
28 Ga0070661_100001707 3300005344 Bacteria 15232
29 Ga0070692_10000264 3300005345 Bacteria 14603
30 Ga0070668_100011286 3300005347 Bacteria 6655
31 Ga0070668_100708916 3300005347 Bacteria 888
32 Ga0070668_100727346 3300005347 Bacteria 877
33 Ga0070668_101496626 3300005347 Bacteria 617
34 Ga0070669_100021917 3300005353 Bacteria 4569
35 Ga0070669_100048344 3300005353 Bacteria 3105
36 Ga0070669_100387928 3300005353 Bacteria 1140
37 Ga0070675_100080504 3300005354 Bacteria 2715
38 Ga0070675_101156685 3300005354 Bacteria 712
39 Ga0070671_100899737 3300005355 Bacteria 773
40 Ga0070673_100014247 3300005364 Bacteria 5530
41 Ga0070688_100618272 3300005365 Bacteria 831
42 Ga0070659_100011555 3300005366 Bacteria 6533
43 Ga0070659_100510820 3300005366 Unclassified 1025
44 Ga0070703_10004004 3300005406 Bacteria 4165
45 Ga0070703_10024156 3300005406 Bacteria 1794
46 Ga0070709_10280767 3300005434 Bacteria 1210
47 Ga0070701_10066442 3300005438 Bacteria 1916
48 Ga0070701_10336777 3300005438 Unclassified 938
49 Ga0070711_100098573 3300005439 Bacteria 2122
50 Ga0070705_100000185 3300005440 Bacteria 36441
51 Ga0070705_100011755 3300005440 Bacteria 4429
52 Ga0070705_100072177 3300005440 Bacteria 2090
53 Ga0070700_100385878 3300005441 Bacteria 1049
54 Ga0070694_100010008 3300005444 Bacteria 5831
55 Ga0070694_100010114 3300005444 Bacteria 5803
56 Ga0070694_100016427 3300005444 Bacteria 4659
57 Ga0070694_100020050 3300005444 Bacteria 4258
58 Ga0070694_100032030 3300005444 Bacteria 3450
59 Ga0070708_100006916 3300005445 Bacteria 9051
60 Ga0070708_100026132 3300005445 Bacteria 4995
61 Ga0070708_100034963 3300005445 Bacteria 4375
62 Ga0070708_100051329 3300005445 Bacteria 3654
63 Ga0070708_100183974 3300005445 Bacteria 1954
64 Ga0070708_100630080 3300005445 Bacteria 1011
65 Ga0070708_100719038 3300005445 Bacteria 939
66 Ga0070663_100006142 3300005455 Bacteria 7193
67 Ga0070662_100010683 3300005457 Bacteria 6042
68 Ga0070662_100012913 3300005457 Bacteria 5549
69 Ga0070662_100226746 3300005457 Bacteria 1493
70 Ga0070662_100744708 3300005457 Bacteria 831
71 Ga0070681_10452550 3300005458 Bacteria 1196
72 Ga0068867_100003399 3300005459 Bacteria 11203
73 Ga0068867_100522435 3300005459 Bacteria 1024
74 Ga0070706_100013284 3300005467 Bacteria 7616
75 Ga0070706_100299455 3300005467 Bacteria 1501
76 Ga0070706_100748617 3300005467 Unclassified 905
77 Ga0070706_101364136 3300005467 Bacteria 649
78 Ga0070706_101561398 3300005467 Unclassified 602
79 Ga0070707_100031685 3300005468 Bacteria 5037
80 Ga0070707_100151886 3300005468 Bacteria 2255
81 Ga0070707_100284609 3300005468 Bacteria 1606
82 Ga0070707_100290246 3300005468 Bacteria 1589
83 Ga0070698_100038341 3300005471 Bacteria 4937
84 Ga0070698_100236164 3300005471 Bacteria 1761
85 Ga0070698_100822197 3300005471 Unclassified 873
86 Ga0070699_100000451 3300005518 Bacteria 39379
87 Ga0070699_100281903 3300005518 Bacteria 1488
88 Ga0070699_100398719 3300005518 Unclassified 1244
89 Ga0070699_100466833 3300005518 Unclassified 1145
90 Ga0070699_100489526 3300005518 Bacteria 1117
91 Ga0070679_101075516 3300005530 Unclassified 749
92 Ga0070684_100047226 3300005535 Bacteria 3731
93 Ga0070697_100032636 3300005536 Bacteria 4191
94 Ga0070697_100033252 3300005536 Bacteria 4152
95 Ga0070697_100034205 3300005536 Bacteria 4097
96 Ga0070697_100050734 3300005536 Bacteria 3368
97 Ga0070697_100341577 3300005536 Bacteria 1292
98 Ga0070697_100455521 3300005536 Unclassified 1115
99 Ga0070697_100458853 3300005536 Unclassified 1110
100 Ga0070697_100699131 3300005536 Unclassified 894
101 Ga0070697_100822239 3300005536 Bacteria 822
102 Ga0068853_100001090 3300005539 Bacteria 19218
103 Ga0070672_100035825 3300005543 Bacteria 3774
104 Ga0070686_100699915 3300005544 Bacteria 808
105 Ga0070695_100000668 3300005545 Bacteria 18292
106 Ga0070695_100009241 3300005545 Bacteria 5861
107 Ga0070695_100017865 3300005545 Bacteria 4304
108 Ga0070695_100033882 3300005545 Bacteria 3197
109 Ga0070695_100184667 3300005545 Bacteria 1480
110 Ga0070696_100424162 3300005546 Bacteria 1045
111 Ga0070693_100000495 3300005547 Bacteria 17589
112 Ga0070693_100595680 3300005547 Bacteria 797
113 Ga0070704_100000754 3300005549 Bacteria 15924
114 Ga0070704_100077973 3300005549 Bacteria 2429
115 Ga0070704_100102582 3300005549 Bacteria 2159
116 Ga0070704_101429983 3300005549 Bacteria 635
117 Ga0068855_100128600 3300005563 Bacteria 2894
118 Ga0070664_100026729 3300005564 Bacteria 4791
119 Ga0068857_100131190 3300005577 Bacteria 2260
120 Ga0068854_100005308 3300005578 Bacteria 8133
121 Ga0068856_100002170 3300005614 Bacteria 20328
122 Ga0070702_100121503 3300005615 Bacteria 1636
123 Ga0070702_101360028 3300005615 Bacteria 579
124 Ga0068859_100042388 3300005617 Bacteria 4571
125 Ga0068859_100114518 3300005617 Bacteria 2761
126 Ga0068859_100238878 3300005617 Bacteria 1906
127 Ga0068859_100617083 3300005617 Bacteria 1177
128 Ga0068864_100024070 3300005618 Bacteria 5119
129 Ga0068866_10084886 3300005718 Bacteria 1710
130 Ga0068866_10332024 3300005718 Bacteria 960
131 Ga0068861_100002757 3300005719 Bacteria 11523
132 Ga0068861_100715654 3300005719 Bacteria 932
133 Ga0068861_100790394 3300005719 Bacteria 890
134 Ga0068861_101895525 3300005719 Bacteria 593
135 Ga0068861_102489107 3300005719 Bacteria 521
136 Ga0068851_10136320 3300005834 Bacteria 1331
137 Ga0068870_10001862 3300005840 Bacteria 8681
138 Ga0068863_100034167 3300005841 Bacteria 4844
139 Ga0068863_100082157 3300005841 Bacteria 3053
140 Ga0068863_100087409 3300005841 Bacteria 2953
141 Ga0068860_100012655 3300005843 Bacteria 8299
142 Ga0068860_100042448 3300005843 Bacteria 4343
143 Ga0068860_100308625 3300005843 Bacteria 1551
144 Ga0068862_100009546 3300005844 Bacteria 8025
145 Ga0068862_100013252 3300005844 Bacteria 6820
146 Ga0068862_100016322 3300005844 Bacteria 6180
147 Ga0068862_100237368 3300005844 Bacteria 1656
148 Ga0068862_100767219 3300005844 Unclassified 939
149 Ga0081455_10000074 3300005937 Bacteria 107319
150 Ga0081540_1031679 3300005983 Bacteria 2902
151 Ga0081539_10000021 3300005985 Bacteria 360643
152 Ga0081539_10406729 3300005985 Unclassified 565
153 Ga0070712_100000880 3300006175 Bacteria 17949
154 Ga0097621_100435955 3300006237 Bacteria 1178
155 Ga0068871_100065764 3300006358 Bacteria 2970
156 Ga0075428_100046889 3300006844 Bacteria 4747
157 Ga0075428_100087115 3300006844 Bacteria 3406
158 Ga0075428_100115949 3300006844 Bacteria 2918
159 Ga0075428_100294244 3300006844 Bacteria 1746
160 Ga0075428_100976865 3300006844 Bacteria 897
161 Ga0075430_100001100 3300006846 Bacteria 21487
162 Ga0075430_100004228 3300006846 Bacteria 12120
163 Ga0075430_100049666 3300006846 Bacteria 3540
164 Ga0075430_100378458 3300006846 Bacteria 1168
165 Ga0075430_100941268 3300006846 Unclassified 712
166 Ga0075431_100001407 3300006847 Bacteria 22068
167 Ga0075431_100019473 3300006847 Bacteria 6919
168 Ga0075431_100021770 3300006847 Bacteria 6554
169 Ga0075431_100051455 3300006847 Bacteria 4247
170 Ga0075431_100074288 3300006847 Bacteria 3508
171 Ga0075431_100187909 3300006847 Bacteria 2118
172 Ga0075431_100584648 3300006847 Bacteria 1102
173 Ga0075431_100599398 3300006847 Bacteria 1086
174 Ga0075431_100802503 3300006847 Bacteria 914
175 Ga0075433_10001043 3300006852 Bacteria 19807
176 Ga0075433_10004038 3300006852 Bacteria 11354
177 Ga0075433_10025550 3300006852 Bacteria 4994
178 Ga0075433_10029400 3300006852 Bacteria 4681
179 Ga0075433_10071746 3300006852 Unclassified 3044
180 Ga0075433_10095853 3300006852 Bacteria 2626
181 Ga0075433_10096260 3300006852 Bacteria 2620
182 Ga0075433_10146720 3300006852 Bacteria 2098
183 Ga0075433_10149453 3300006852 Bacteria 2078
184 Ga0075433_10162104 3300006852 Bacteria 1990
185 Ga0075433_10221161 3300006852 Bacteria 1682
186 Ga0075433_10719926 3300006852 Bacteria 874
187 Ga0075434_100001043 3300006871 Bacteria 22614
188 Ga0075434_100015833 3300006871 Bacteria 7241
189 Ga0075434_100051434 3300006871 Bacteria 4095
190 Ga0075434_100063979 3300006871 Bacteria 3662
191 Ga0075434_100139651 3300006871 Bacteria 2442
192 Ga0075434_100144913 3300006871 Bacteria 2395
193 Ga0075434_100290670 3300006871 Bacteria 1654
194 Ga0075434_100530884 3300006871 Bacteria 1197
195 Ga0075434_100549467 3300006871 Bacteria 1175
196 Ga0075429_100000030 3300006880 Bacteria 65324
197 Ga0075429_100004421 3300006880 Bacteria 12078
198 Ga0075429_100017568 3300006880 Bacteria 6185
199 Ga0075429_100019943 3300006880 Bacteria 5814
200 Ga0075429_100212409 3300006880 Bacteria 1695
201 Ga0075429_100541940 3300006880 Bacteria 1020
202 Ga0075429_100652370 3300006880 Bacteria 922
203 Ga0068865_100059511 3300006881 Bacteria 2672
204 Ga0068865_100209404 3300006881 Unclassified 1518
205 Ga0068865_100259565 3300006881 Bacteria 1375
206 Ga0068865_100384089 3300006881 Bacteria 1146
207 Ga0075436_100003423 3300006914 Bacteria 10875
208 Ga0075436_100025768 3300006914 Bacteria 4047
209 Ga0075436_100052909 3300006914 Bacteria 2803
210 Ga0075436_100089542 3300006914 Bacteria 2138
211 Ga0075436_100250190 3300006914 Bacteria 1262
212 Ga0097620_100042387 3300006931 Bacteria 4571
213 Ga0097620_100114525 3300006931 Bacteria 2761
214 Ga0097620_100238868 3300006931 Bacteria 1906
215 Ga0097620_100617074 3300006931 Bacteria 1177
216 Ga0075435_100007199 3300007076 Bacteria 7914
217 Ga0075435_100012317 3300007076 Bacteria 6327
218 Ga0075435_100021679 3300007076 Bacteria 4946
219 Ga0075435_100044597 3300007076 Bacteria 3551
220 Ga0075435_100101431 3300007076 Bacteria 2385
221 Ga0075435_100218577 3300007076 Bacteria 1618
222 Ga0075435_100236599 3300007076 Bacteria 1552
223 Ga0075435_100242749 3300007076 Bacteria 1532
224 Ga0075435_100266951 3300007076 Unclassified 1459
225 Ga0075435_100397865 3300007076 Bacteria 1184
226 Ga0075435_100762591 3300007076 Bacteria 842
227 Ga0099794_10000248 3300007265 Bacteria 18859
228 Ga0099794_10558621 3300007265 Unclassified 604
229 Ga0111539_10000608 3300009094 Bacteria 46341
230 Ga0111539_10013937 3300009094 Bacteria 10049
231 Ga0111539_10100593 3300009094 Bacteria 3394
232 Ga0111539_10149902 3300009094 Bacteria 2730
233 Ga0111539_10214324 3300009094 Bacteria 2243
234 Ga0111539_11354782 3300009094 Bacteria 826
235 Ga0114129_10000814 3300009147 Bacteria 40163
236 Ga0114129_10005964 3300009147 Bacteria 17250
237 Ga0114129_10027505 3300009147 Bacteria 8051
238 Ga0114129_10040809 3300009147 Bacteria 6542
239 Ga0114129_10045276 3300009147 Bacteria 6186
240 Ga0114129_10057044 3300009147 Bacteria 5468
241 Ga0114129_10063562 3300009147 Bacteria 5154
242 Ga0114129_10206218 3300009147 Bacteria 2660
243 Ga0114129_10298872 3300009147 Bacteria 2146
244 Ga0114129_10325546 3300009147 Bacteria 2042
245 Ga0114129_10371912 3300009147 Bacteria 1889
246 Ga0114129_10571602 3300009147 Bacteria 1468
247 Ga0114129_10615007 3300009147 Bacteria 1406
248 Ga0114129_10763610 3300009147 Bacteria 1237
249 Ga0114129_11043330 3300009147 Unclassified 1027
250 Ga0114129_11689668 3300009147 Bacteria 773
251 Ga0105243_10032153 3300009148 Bacteria 4052
252 Ga0105243_11709579 3300009148 Bacteria 658
253 Ga0105241_10000158 3300009174 Bacteria 49323
254 Ga0105242_10052316 3300009176 Bacteria 3332
255 Ga0105242_10229463 3300009176 Bacteria 1663
256 Ga0105242_10598449 3300009176 Bacteria 1065
257 Ga0105242_11284624 3300009176 Bacteria 755
258 Ga0105248_10228464 3300009177 Bacteria 2094
259 Ga0105248_10251879 3300009177 Bacteria 1988
260 Ga0105238_10728438 3300009551 Bacteria 1005
261 Ga0105249_10012722 3300009553 Bacteria 7417
262 Ga0105249_10080961 3300009553 Bacteria 3017
263 Ga0105249_10695609 3300009553 Bacteria 1076
264 Ga0105239_10084782 3300010375 Bacteria 3491
265 Ga0105246_10005743 3300011119 Bacteria 7573
266 Ga0157373_10001129 3300013100 Bacteria 20517
267 Ga0157373_10536521 3300013100 Bacteria 847
268 Ga0157373_10743972 3300013100 Bacteria 720
269 Ga0157371_10144792 3300013102 Bacteria 1693
270 Ga0157370_10150742 3300013104 Bacteria 2164
271 Ga0157369_10010973 3300013105 Bacteria 10314
272 Ga0157378_10120481 3300013297 Bacteria 2418
273 Ga0157378_10204954 3300013297 Bacteria 1867
274 Ga0157378_10589693 3300013297 Bacteria 1121
275 Ga0163162_10006405 3300013306 Bacteria 11398
276 Ga0163162_10054636 3300013306 Bacteria 4018
277 Ga0163162_10499769 3300013306 Bacteria 1346
278 Ga0163162_10577449 3300013306 Bacteria 1251
279 Ga0157372_10001789 3300013307 Bacteria 23349
280 Ga0157372_10031342 3300013307 Bacteria 5822
281 Ga0157372_10258473 3300013307 Bacteria 2022
282 Ga0157375_10159035 3300013308 Bacteria 2400
283 Ga0157375_10299192 3300013308 Bacteria 1772
284 Ga0157380_10618356 3300014326 Bacteria 1075
285 Ga0182008_10116958 3300014497 Bacteria 1323
286 Ga0182007_10057463 3300015262 Bacteria 1277
287 Ga0163161_10265670 3300017792 Bacteria 1341
288 Ga0206353_11409522 3300020082 Bacteria 564
289 Ga0207653_10000321 3300025885 Bacteria 26160
290 Ga0207653_10033533 3300025885 Unclassified 1666
291 Ga0207653_10277105 3300025885 Bacteria 647
292 Ga0207642_10294257 3300025899 Bacteria 939
293 Ga0207688_10025397 3300025901 Bacteria 3253
294 Ga0207680_10179993 3300025903 Bacteria 1429
295 Ga0207647_10098294 3300025904 Bacteria 1739
296 Ga0207647_10285743 3300025904 Bacteria 941
297 Ga0207699_10523851 3300025906 Bacteria 857
298 Ga0207645_10001546 3300025907 Bacteria 18820
299 Ga0207643_10004500 3300025908 Bacteria 7493
300 Ga0207684_10008211 3300025910 Bacteria 9296
301 Ga0207684_10011397 3300025910 Bacteria 7779
302 Ga0207684_10021824 3300025910 Bacteria 5465
303 Ga0207684_10037797 3300025910 Bacteria 4096
304 Ga0207684_10181807 3300025910 Bacteria 1813
305 Ga0207684_10195205 3300025910 Bacteria 1746
306 Ga0207684_10395448 3300025910 Unclassified 1188
307 Ga0207684_10497842 3300025910 Unclassified 1045
308 Ga0207684_10648685 3300025910 Unclassified 900
309 Ga0207684_11191632 3300025910 Unclassified 631
310 Ga0207654_10000677 3300025911 Bacteria 19095
311 Ga0207654_10034506 3300025911 Bacteria 2811
312 Ga0207654_10408695 3300025911 Unclassified 945
313 Ga0207654_11106525 3300025911 Bacteria 577
314 Ga0207707_10000223 3300025912 Bacteria 61090
315 Ga0207693_10002236 3300025915 Bacteria 16861
316 Ga0207663_10658740 3300025916 Bacteria 827
317 Ga0207660_10009724 3300025917 Bacteria 6224
318 Ga0207660_10107495 3300025917 Bacteria 2094
319 Ga0207660_10127782 3300025917 Bacteria 1932
320 Ga0207660_10349535 3300025917 Bacteria 1185
321 Ga0207662_10028597 3300025918 Bacteria 3225
322 Ga0207662_10118589 3300025918 Bacteria 1657
323 Ga0207657_10000041 3300025919 Bacteria 118810
324 Ga0207649_10001180 3300025920 Bacteria 15724
325 Ga0207652_10000760 3300025921 Bacteria 30993
326 Ga0207652_10951867 3300025921 Unclassified 757
327 Ga0207646_10017008 3300025922 Bacteria 6816
328 Ga0207646_10025928 3300025922 Bacteria 5359
329 Ga0207646_10039697 3300025922 Bacteria 4235
330 Ga0207646_10045683 3300025922 Bacteria 3931
331 Ga0207646_10062141 3300025922 Bacteria 3334
332 Ga0207646_10181612 3300025922 Bacteria 1900
333 Ga0207646_10279972 3300025922 Bacteria 1507
334 Ga0207646_10906763 3300025922 Unclassified 782
335 Ga0207646_11275438 3300025922 Unclassified 642
336 Ga0207681_10033097 3300025923 Bacteria 3388
337 Ga0207681_10040551 3300025923 Bacteria 3099
338 Ga0207650_10016826 3300025925 Bacteria 5115
339 Ga0207690_10007169 3300025932 Bacteria 6622
340 Ga0207706_10004994 3300025933 Bacteria 12391
341 Ga0207706_10046717 3300025933 Bacteria 3833
342 Ga0207706_10079063 3300025933 Bacteria 2892
343 Ga0207706_10231366 3300025933 Bacteria 1617
344 Ga0207706_11256769 3300025933 Bacteria 613
345 Ga0207670_10079023 3300025936 Bacteria 2296
346 Ga0207670_10487721 3300025936 Bacteria 999
347 Ga0207704_10075019 3300025938 Bacteria 2161
348 Ga0207704_10143763 3300025938 Bacteria 1673
349 Ga0207704_11128462 3300025938 Bacteria 667
350 Ga0207665_10034972 3300025939 Bacteria 3334
351 Ga0207691_10065047 3300025940 Bacteria 3302
352 Ga0207691_10122186 3300025940 Unclassified 2306
353 Ga0207711_10333287 3300025941 Bacteria 1403
354 Ga0207711_10410079 3300025941 Bacteria 1259
355 Ga0207711_11659024 3300025941 Bacteria 583
356 Ga0207689_10000112 3300025942 Bacteria 67234
357 Ga0207689_10006596 3300025942 Bacteria 10236
358 Ga0207679_10002536 3300025945 Bacteria 11253
359 Ga0207667_10002476 3300025949 Bacteria 23016
360 Ga0207651_10667742 3300025960 Bacteria 913
361 Ga0207712_10321508 3300025961 Bacteria 1277
362 Ga0207712_10606012 3300025961 Bacteria 948
363 Ga0207668_10851983 3300025972 Bacteria 809
364 Ga0207640_10010106 3300025981 Bacteria 5305
365 Ga0207658_10914881 3300025986 Bacteria 799
366 Ga0207677_10077375 3300026023 Bacteria 2372
367 Ga0207703_10660075 3300026035 Bacteria 992
368 Ga0207639_10030884 3300026041 Bacteria 3933
369 Ga0207678_10003471 3300026067 Bacteria 14191
370 Ga0207708_10031701 3300026075 Bacteria 4013
371 Ga0207708_10320012 3300026075 Bacteria 1266
372 Ga0207708_10398857 3300026075 Bacteria 1137
373 Ga0207702_10003094 3300026078 Bacteria 15426
374 Ga0207641_10071781 3300026088 Bacteria 2979
375 Ga0207641_10186294 3300026088 Bacteria 1904
376 Ga0207641_10202094 3300026088 Bacteria 1833
377 Ga0207641_10954395 3300026088 Unclassified 853
378 Ga0207648_10012182 3300026089 Bacteria 8055
379 Ga0207648_10074343 3300026089 Bacteria 2962
380 Ga0207676_10095892 3300026095 Bacteria 2447
381 Ga0207674_10004232 3300026116 Bacteria 17314
382 Ga0207675_100005454 3300026118 Bacteria 12188
383 Ga0207675_100140593 3300026118 Bacteria 2293
384 Ga0207675_100904355 3300026118 Bacteria 899
385 Ga0207675_100965493 3300026118 Unclassified 870
386 Ga0207675_101027630 3300026118 Bacteria 843
387 Ga0209969_1001517 3300027360 Bacteria 3203
388 Ga0209996_1016268 3300027395 Bacteria 1020
389 Ga0209996_1046677 3300027395 Bacteria 651
390 Ga0210000_1001780 3300027462 Bacteria 3045
391 Ga0209968_1002327 3300027526 Bacteria 2874
392 Ga0209999_1000563 3300027543 Bacteria 5823
393 Ga0209970_1001704 3300027614 Bacteria 3814
394 Ga0209970_1059292 3300027614 Bacteria 701
395 Ga0210002_1000500 3300027617 Bacteria 5297
396 Ga0209983_1005215 3300027665 Bacteria 2700
397 Ga0209588_1001874 3300027671 Bacteria 5621
398 Ga0209971_1000008 3300027682 Bacteria 102612
399 Ga0209966_1000187 3300027695 Bacteria 25599
400 Ga0209998_10000016 3300027717 Bacteria 85166
401 Ga0209998_10086104 3300027717 Bacteria 766
402 Ga0209974_10001338 3300027876 Bacteria 8856
403 Ga0209974_10055005 3300027876 Bacteria 1342
404 Ga0207428_10000118 3300027907 Bacteria 107695
405 Ga0207428_10000725 3300027907 Bacteria 38077
406 Ga0207428_10172958 3300027907 Bacteria 1635
407 Ga0207428_10192024 3300027907 Bacteria 1539
408 Ga0207428_10215735 3300027907 Bacteria 1440
409 Ga0268265_10004670 3300028380 Bacteria 9464
410 Ga0268265_10150705 3300028380 Bacteria 1961
411 Ga0268265_10386691 3300028380 Bacteria 1289
412 Ga0268265_10757539 3300028380 Unclassified 943
413 Ga0268264_10064551 3300028381 Bacteria 3082
414 Ga0268264_10078735 3300028381 Bacteria 2811
415 Ga0268264_10124347 3300028381 Bacteria 2277
416 Ga0268264_10125176 3300028381 Bacteria 2270
417 Ga0373948_0008948 3300034817 Bacteria 1717
418 Ga0373950_0010557 3300034818 Bacteria 1494
419 Ga0373958_0140808 3300034819 Bacteria 597
420 Ga0373959_0017604 3300034820 Bacteria 1336
421 Ga0373938_0056158 3300034957 Bacteria 911
422 Ga0373940_0020698 3300035088 Bacteria 1674
423 Ga0373940_0037581 3300035088 Bacteria 1318
424 Ga0373951_0023049 3300035091 Bacteria 1436
425 Ga0373952_0068901 3300035092 Bacteria 881
426 Ga0373932_0116231 3300035112 Bacteria 887
427 Ga0373939_0023765 3300035114 Bacteria 1701
428 Ga0373939_0112440 3300035114 Unclassified 950
429 Ga0373941_0223401 3300035115 Bacteria 725
430 Ga0373942_0188936 3300035207 Bacteria 678
431 Ga0373961_0114616 3300035241 Bacteria 887
432 Ga0373962_0005496 3300035242 Bacteria 3065
433 Ga0373931_0092165 3300035691 Bacteria 1690
434 Ga0373931_0141082 3300035691 Bacteria 1396
435 Ga0373931_0388324 3300035691 Bacteria 881
436 Ga0395899_0007410 3300037312 Bacteria 8479
437 Ga0395900_0001221 3300037418 Bacteria 31668
438 Ga0395898_0003272 3300037466 Bacteria 18211
439 Ga0395905_0518870 3300037471 Unclassified 1092
440 Ga0395901_0001825 3300038443 Bacteria 21987
441 Ga0242420_017009 3300038996 Bacteria 1270
442 Ga0439437_052893 3300042000 Unclassified 542
443 Ga0439441_146306 3300042001 Unclassified 555
444 Ga0439448_0123757 3300042005 Bacteria 888
445 Ga0439455_0002041 3300042012 Bacteria 3579
446 Ga0439458_0002237 3300042157 Bacteria 4774
447 Ga0439458_0080183 3300042157 Bacteria 832
448 Ga0439459_0000266 3300042438 Bacteria 6156
449 Ga0439459_0014668 3300042438 Bacteria 1427
450 Ga0439464_0010534 3300042439 Bacteria 2441
451 Ga0439460_0006954 3300042461 Bacteria 2819
452 Ga0439460_0088819 3300042461 Bacteria 980
453 Ga0450893_0039276 3300042532 Bacteria 864
454 Ga0451577_0000807 3300042876 Bacteria 47174
455 Ga0451577_0020218 3300042876 Bacteria 6114
456 Ga0451577_0032116 3300042876 Bacteria 4731
457 Ga0453683_0033010 3300044673 Bacteria 3264
458 Ga0453683_0464186 3300044673 Bacteria 820
459 Ga0453684_0144071 3300044712 Bacteria 2841
460 Ga0453684_0182256 3300044712 Bacteria 2464
461 Ga0453684_0589771 3300044712 Bacteria 1219
462 Ga0453684_1039371 3300044712 Bacteria 869
463 Ga0451576_0005053 3300045051 Bacteria 16728
464 Ga0451576_0018864 3300045051 Bacteria 7540
465 Ga0451576_0030468 3300045051 Bacteria 5766
466 Ga0451576_0034420 3300045051 Bacteria 5380
467 Ga0451576_0045461 3300045051 Bacteria 4624
468 Ga0451576_0382888 3300045051 Bacteria 1474
469 Ga0451576_0430640 3300045051 Unclassified 1384
470 Ga0451576_0757834 3300045051 Bacteria 1020
471 Ga0495594_0124976 3300046499 Bacteria 1455
472 Ga0495642_0042190 3300046528 Unclassified 1858
473 Ga0495633_0139791 3300046558 Bacteria 1120
474 Ga0495656_0143515 3300046615 Unclassified 1147
475 Ga0495656_0163232 3300046615 Archaea 1084
476 Ga0495659_0059243 3300046664 Bacteria 1411
477 Ga0495669_0510847 3300046684 Bacteria 584
478 Ga0495636_0006516 3300047318 Bacteria 4590
479 Ga0496102_0039748 3300048905 Bacteria 4252
480 Ga0496106_0183855 3300048909 Bacteria 1660
481 Ga0496106_0234090 3300048909 Bacteria 1467
482 Ga0496112_0051850 3300048915 Bacteria 4025
483 Ga0496113_0799993 3300048916 Bacteria 749
484 Ga0501033_0433513 3300049570 Bacteria 914
485 Ga0501036_0301872 3300049572 Bacteria 1339
486 Ga0501037_0036759 3300049573 Bacteria 3609
487 Ga0501038_0185394 3300049574 Bacteria 1677
488 Ga0501039_0042611 3300049575 Bacteria 3506
489 Ga0501039_0509892 3300049575 Unclassified 944
490 Ga0501040_0001982 3300049576 Bacteria 13201
491 Ga0501040_0255495 3300049576 Bacteria 1250
492 Ga0501041_0008326 3300049577 Bacteria 6102
493 Ga0501042_0007810 3300049578 Bacteria 7030
494 Ga0501042_0087844 3300049578 Bacteria 2231
495 Ga0501042_0100174 3300049578 Bacteria 2083
496 Ga0501042_0366005 3300049578 Bacteria 1043
497 Ga0501043_0302194 3300049579 Bacteria 1222
498 Ga0501046_0000779 3300049580 Bacteria 30812
499 Ga0501046_0087597 3300049580 Bacteria 2399
500 Ga0501047_0320114 3300049581 Bacteria 1391
501 Ga0501048_0000908 3300049582 Bacteria 21845
502 Ga0501048_0145527 3300049582 Bacteria 1676
503 Ga0501071_0617435 3300049587 Bacteria 834
504 Ga0501072_0049576 3300049588 Bacteria 3306
505 Ga0501072_0146466 3300049588 Bacteria 1883
506 Ga0501074_0002117 3300049590 Bacteria 13714
507 Ga0501074_0268460 3300049590 Bacteria 1213
508 Ga0501075_0037594 3300049591 Bacteria 3617
509 Ga0501075_0104734 3300049591 Bacteria 2150
510 Ga0501075_0497032 3300049591 Bacteria 930
511 Ga0501075_1180238 3300049591 Bacteria 581
512 Ga0501076_0075871 3300049592 Bacteria 2695
513 Ga0501076_0278096 3300049592 Bacteria 1371
514 Ga0501077_0010315 3300049593 Bacteria 5813
515 Ga0501077_0108473 3300049593 Bacteria 1759
516 Ga0501079_0001192 3300049741 Bacteria 18205
517 Ga0501079_0041626 3300049741 Bacteria 3547
518 Ga0501079_0053762 3300049741 Bacteria 3106
519 Ga0501080_0030744 3300049742 Bacteria 5003
520 Ga0501080_0571872 3300049742 Bacteria 1005
521 Ga0501080_0824532 3300049742 Bacteria 812
522 Ga0501081_0003534 3300049743 Bacteria 9984
523 Ga0501081_0012591 3300049743 Bacteria 5562
524 Ga0501081_0178596 3300049743 Bacteria 1535
525 Ga0501081_0444816 3300049743 Bacteria 962
526 Ga0501083_0005068 3300049744 Bacteria 9329
527 Ga0501045_0000998 3300049824 Bacteria 18589
528 Ga0501045_0061555 3300049824 Bacteria 2754
529 Ga0501045_0445148 3300049824 Bacteria 963
530 nmdc:mga05p37_1113_c1 3300050507 Bacteria 28074
531 nmdc:mga05p37_114204_c1 3300050507 Bacteria 3320
532 nmdc:mga05p37_15878_c1 3300050507 Bacteria 9058
533 nmdc:mga05p37_317903_c1 3300050507 Bacteria 1844
534 nmdc:mga05p37_373542_c1 3300050507 Bacteria 1673
535 nmdc:mga05p37_382468_c1 3300050507 Bacteria 1649
536 nmdc:mga05p37_4153_c1 3300050507 Bacteria 16905
537 nmdc:mga05p37_435263_c1 3300050507 Bacteria 1523
538 nmdc:mga05p37_446808_c1 3300050507 Bacteria 1498
539 nmdc:mga05p37_524684_c1 3300050507 Bacteria 1354
540 nmdc:mga05p37_7423_c1 3300050507 Bacteria 12934
541 nmdc:mga05p37_779016_c1 3300050507 Unclassified 1050
542 nmdc:mga05p37_7985_c1 3300050507 Bacteria 12492
543 nmdc:mga05p37_818722_c1 3300050507 Bacteria 1016
544 nmdc:mga05p37_88180_c1 3300050507 Bacteria 3824
545 nmdc:mga09592_135273_c1 3300050508 Bacteria 2123
546 nmdc:mga09592_14363_c1 3300050508 Bacteria 6466
547 nmdc:mga09592_170774_c1 3300050508 Bacteria 1880
548 nmdc:mga09592_27718_c1 3300050508 Bacteria 4702
549 nmdc:mga09592_568910_c1 3300050508 Bacteria 973
550 nmdc:mga0qj67_118775_c1 3300050509 Bacteria 2138
551 nmdc:mga0qj67_3808_c1 3300050509 Bacteria 10897
552 nmdc:mga0qj67_405935_c1 3300050509 Archaea 1099
553 nmdc:mga0qj67_478611_c1 3300050509 Unclassified 1002
554 nmdc:mga0qj67_645599_c1 3300050509 Bacteria 845
555 nmdc:mga0qj67_936924_c1 3300050509 Unclassified 681
556 nmdc:mga06r32_238712_c1 3300050510 Bacteria 1805
557 nmdc:mga06r32_242551_c1 3300050510 Bacteria 1789
558 nmdc:mga06r32_498534_c1 3300050510 Bacteria 1195
559 nmdc:mga06r32_69002_c1 3300050510 Bacteria 3416
560 nmdc:mga06r32_74765_c1 3300050510 Bacteria 3286
561 nmdc:mga06r32_805942_c1 3300050510 Bacteria 899
562 nmdc:mga06r32_898417_c1 3300050510 Bacteria 842
563 nmdc:mga08y16_154115_c1 3300050511 Bacteria 2388
564 nmdc:mga08y16_161221_c1 3300050511 Bacteria 2330
565 nmdc:mga08y16_17007_c1 3300050511 Bacteria 7659
566 nmdc:mga08y16_2054399_c1 3300050511 Bacteria 520
567 nmdc:mga08y16_274983_c1 3300050511 Bacteria 1738
568 nmdc:mga08y16_5938_c1 3300050511 Bacteria 12800
569 nmdc:mga08y16_970823_c1 3300050511 Bacteria 831
570 nmdc:mga08y16_997635_c1 3300050511 Bacteria 817
571 nmdc:mga0n895_105779_c1 3300050512 Bacteria 2827
572 nmdc:mga0n895_111787_c1 3300050512 Bacteria 2749
573 nmdc:mga0n895_14820_c1 3300050512 Bacteria 7093
574 nmdc:mga0n895_155305_c1 3300050512 Bacteria 2319
575 nmdc:mga0n895_304783_c1 3300050512 Bacteria 1615
576 nmdc:mga0n895_358544_c1 3300050512 Bacteria 1477
577 nmdc:mga0n895_38658_c1 3300050512 Bacteria 4625
578 nmdc:mga0n895_48001_c1 3300050512 Bacteria 4177
579 nmdc:mga0n895_820150_c1 3300050512 Bacteria 920
580 nmdc:mga0n895_9893_c1 3300050512 Bacteria 8385
581 nmdc:mga0rr50_100888_c1 3300050513 Bacteria 2268
582 nmdc:mga0rr50_106545_c1 3300050513 Bacteria 2212
583 nmdc:mga0rr50_110335_c1 3300050513 Bacteria 2176
584 nmdc:mga0rr50_138495_c1 3300050513 Bacteria 1956
585 nmdc:mga0rr50_1632873_c1 3300050513 Bacteria 544
586 nmdc:mga0rr50_18853_c1 3300050513 Bacteria 4644
587 nmdc:mga0rr50_270523_c1 3300050513 Bacteria 1416
588 nmdc:mga0rr50_296114_c1 3300050513 Bacteria 1353
589 nmdc:mga0rr50_51772_c1 3300050513 Bacteria 3048
590 nmdc:mga08x19_52693_c1 3300050514 Bacteria 2617
591 nmdc:mga08x19_56305_c1 3300050514 Bacteria 2537
592 nmdc:mga08x19_7578_c1 3300050514 Bacteria 6450
593 nmdc:mga0a205_10528_c1 3300050515 Bacteria 8498
594 nmdc:mga0a205_181065_c1 3300050515 Bacteria 2002
595 nmdc:mga0a205_255_c1 3300050515 Bacteria 38182
596 nmdc:mga0a205_260038_c1 3300050515 Bacteria 1614
597 nmdc:mga0a205_263786_c1 3300050515 Bacteria 1600
598 nmdc:mga0a205_35996_c1 3300050515 Bacteria 4755
599 nmdc:mga0a205_37539_c1 3300050515 Bacteria 4659
600 nmdc:mga0a205_455105_c1 3300050515 Bacteria 1140
601 nmdc:mga0a205_631_c1 3300050515 Bacteria 20134
602 nmdc:mga0a205_77997_c1 3300050515 Bacteria 3200
603 nmdc:mga0a205_879865_c1 3300050515 Bacteria 743
604 Ga0501084_0000880 3300054114 Bacteria 23208
605 Ga0501084_0068618 3300054114 Bacteria 2968
606 Ga0501084_0115596 3300054114 Bacteria 2255
607 Ga0501082_0001040 3300060353 Bacteria 24529
608 Ga0501082_0030889 3300060353 Bacteria 4618
609 Ga0530510_0005130 3300061734 Bacteria 9036
610 Ga0530510_0073178 3300061734 Bacteria 2487
611 Ga0530510_0264938 3300061734 Bacteria 1282
612 Ga0530510_0640110 3300061734 Bacteria 809
613 Ga0530510_0765533 3300061734 Bacteria 736
614 Ga0501040_0228916
615 JGI25406J46586_10047407
616 JGI26129J50193_1000514
617 JGI25405J52794_10013414
618 Ga0058861_11289412
619 Ga0065712_10226382
620 Ga0065715_10127416
621 Ga0065707_10106719
622 Ga0065707_10332736
623 Ga0065707_10797384
624 Ga0070676_10000338
625 Ga0070690_100542073
626 Ga0070690_100929639
627 Ga0070690_101463740
628 Ga0070670_100022224
629 Ga0068869_100000894
630 Ga0068869_100013262
631 Ga0070666_10314586
632 Ga0070680_100001984
633 Ga0070680_100155613
634 Ga0070680_100451404
635 Ga0070682_100000313
636 Ga0068868_100007350
637 Ga0070689_100486437
638 Ga0070691_10006203
639 Ga0070691_10045788
640 Ga0070687_100016678
641 Ga0070661_100001707
642 Ga0070692_10000264
643 Ga0070668_100011286
644 Ga0070668_100708916
645 Ga0070668_100727346
646 Ga0070668_101496626
647 Ga0070669_100021917
648 Ga0070669_100048344
649 Ga0070669_100387928
650 Ga0070675_100080504
651 Ga0070675_101156685
652 Ga0070671_100899737
653 Ga0070673_100014247
654 Ga0070688_100618272
655 Ga0070659_100011555
656 Ga0070659_100510820
657 Ga0070703_10004004
658 Ga0070703_10024156
659 Ga0070709_10280767
660 Ga0070701_10066442
661 Ga0070701_10336777
662 Ga0070711_100098573
663 Ga0070705_100000185
664 Ga0070705_100011755
665 Ga0070705_100072177
666 Ga0070700_100385878
667 Ga0070694_100010008
668 Ga0070694_100010114
669 Ga0070694_100016427
670 Ga0070694_100020050
671 Ga0070694_100032030
672 Ga0070708_100006916
673 Ga0070708_100026132
674 Ga0070708_100034963
675 Ga0070708_100051329
676 Ga0070708_100183974
677 Ga0070708_100630080
678 Ga0070708_100719038
679 Ga0070663_100006142
680 Ga0070662_100010683
681 Ga0070662_100012913
682 Ga0070662_100226746
683 Ga0070662_100744708
684 Ga0070681_10452550
685 Ga0068867_100003399
686 Ga0068867_100522435
687 Ga0070706_100013284
688 Ga0070706_100299455
689 Ga0070706_100748617
690 Ga0070706_101364136
691 Ga0070706_101561398
692 Ga0070707_100031685
693 Ga0070707_100151886
694 Ga0070707_100284609
695 Ga0070707_100290246
696 Ga0070698_100038341
697 Ga0070698_100236164
698 Ga0070698_100822197
699 Ga0070699_100000451
700 Ga0070699_100281903
701 Ga0070699_100398719
702 Ga0070699_100466833
703 Ga0070699_100489526
704 Ga0070679_101075516
705 Ga0070684_100047226
706 Ga0070697_100032636
707 Ga0070697_100033252
708 Ga0070697_100034205
709 Ga0070697_100050734
710 Ga0070697_100341577
711 Ga0070697_100455521
712 Ga0070697_100458853
713 Ga0070697_100699131
714 Ga0070697_100822239
715 Ga0068853_100001090
716 Ga0070672_100035825
717 Ga0070686_100699915
718 Ga0070695_100000668
719 Ga0070695_100009241
720 Ga0070695_100017865
721 Ga0070695_100033882
722 Ga0070695_100184667
723 Ga0070696_100424162
724 Ga0070693_100000495
725 Ga0070693_100595680
726 Ga0070704_100000754
727 Ga0070704_100077973
728 Ga0070704_100102582
729 Ga0070704_101429983
730 Ga0068855_100128600
731 Ga0070664_100026729
732 Ga0068857_100131190
733 Ga0068854_100005308
734 Ga0068856_100002170
735 Ga0070702_100121503
736 Ga0070702_101360028
737 Ga0068859_100042388
738 Ga0068859_100114518
739 Ga0068859_100238878
740 Ga0068859_100617083
741 Ga0068864_100024070
742 Ga0068866_10084886
743 Ga0068866_10332024
744 Ga0068861_100002757
745 Ga0068861_100715654
746 Ga0068861_100790394
747 Ga0068861_101895525
748 Ga0068861_102489107
749 Ga0068851_10136320
750 Ga0068870_10001862
751 Ga0068863_100034167
752 Ga0068863_100082157
753 Ga0068863_100087409
754 Ga0068860_100012655
755 Ga0068860_100042448
756 Ga0068860_100308625
757 Ga0068862_100009546
758 Ga0068862_100013252
759 Ga0068862_100016322
760 Ga0068862_100237368
761 Ga0068862_100767219
762 Ga0081455_10000074
763 Ga0081540_1031679
764 Ga0081539_10000021
765 Ga0081539_10406729
766 Ga0070712_100000880
767 Ga0097621_100435955
768 Ga0068871_100065764
769 Ga0075428_100046889
770 Ga0075428_100087115
771 Ga0075428_100115949
772 Ga0075428_100294244
773 Ga0075428_100976865
774 Ga0075430_100001100
775 Ga0075430_100004228
776 Ga0075430_100049666
777 Ga0075430_100378458
778 Ga0075430_100941268
779 Ga0075431_100001407
780 Ga0075431_100019473
781 Ga0075431_100021770
782 Ga0075431_100051455
783 Ga0075431_100074288
784 Ga0075431_100187909
785 Ga0075431_100584648
786 Ga0075431_100599398
787 Ga0075431_100802503
788 Ga0075433_10001043
789 Ga0075433_10004038
790 Ga0075433_10025550
791 Ga0075433_10029400
792 Ga0075433_10071746
793 Ga0075433_10095853
794 Ga0075433_10096260
795 Ga0075433_10146720
796 Ga0075433_10149453
797 Ga0075433_10162104
798 Ga0075433_10221161
799 Ga0075433_10719926
800 Ga0075434_100001043
801 Ga0075434_100015833
802 Ga0075434_100051434
803 Ga0075434_100063979
804 Ga0075434_100139651
805 Ga0075434_100144913
806 Ga0075434_100290670
807 Ga0075434_100530884
808 Ga0075434_100549467
809 Ga0075429_100000030
810 Ga0075429_100004421
811 Ga0075429_100017568
812 Ga0075429_100019943
813 Ga0075429_100212409
814 Ga0075429_100541940
815 Ga0075429_100652370
816 Ga0068865_100059511
817 Ga0068865_100209404
818 Ga0068865_100259565
819 Ga0068865_100384089
820 Ga0075436_100003423
821 Ga0075436_100025768
822 Ga0075436_100052909
823 Ga0075436_100089542
824 Ga0075436_100250190
825 Ga0097620_100042387
826 Ga0097620_100114525
827 Ga0097620_100238868
828 Ga0097620_100617074
829 Ga0075435_100007199
830 Ga0075435_100012317
831 Ga0075435_100021679
832 Ga0075435_100044597
833 Ga0075435_100101431
834 Ga0075435_100218577
835 Ga0075435_100236599
836 Ga0075435_100242749
837 Ga0075435_100266951
838 Ga0075435_100397865
839 Ga0075435_100762591
840 Ga0099794_10000248
841 Ga0099794_10558621
842 Ga0111539_10000608
843 Ga0111539_10013937
844 Ga0111539_10100593
845 Ga0111539_10149902
846 Ga0111539_10214324
847 Ga0111539_11354782
848 Ga0114129_10000814
849 Ga0114129_10005964
850 Ga0114129_10027505
851 Ga0114129_10040809
852 Ga0114129_10045276
853 Ga0114129_10057044
854 Ga0114129_10063562
855 Ga0114129_10206218
856 Ga0114129_10298872
857 Ga0114129_10325546
858 Ga0114129_10371912
859 Ga0114129_10571602
860 Ga0114129_10615007
861 Ga0114129_10763610
862 Ga0114129_11043330
863 Ga0114129_11689668
864 Ga0105243_10032153
865 Ga0105243_11709579
866 Ga0105241_10000158
867 Ga0105242_10052316
868 Ga0105242_10229463
869 Ga0105242_10598449
870 Ga0105242_11284624
871 Ga0105248_10228464
872 Ga0105248_10251879
873 Ga0105238_10728438
874 Ga0105249_10012722
875 Ga0105249_10080961
876 Ga0105249_10695609
877 Ga0105239_10084782
878 Ga0105246_10005743
879 Ga0157373_10001129
880 Ga0157373_10536521
881 Ga0157373_10743972
882 Ga0157371_10144792
883 Ga0157370_10150742
884 Ga0157369_10010973
885 Ga0157378_10120481
886 Ga0157378_10204954
887 Ga0157378_10589693
888 Ga0163162_10006405
889 Ga0163162_10054636
890 Ga0163162_10499769
891 Ga0163162_10577449
892 Ga0157372_10001789
893 Ga0157372_10031342
894 Ga0157372_10258473
895 Ga0157375_10159035
896 Ga0157375_10299192
897 Ga0157380_10618356
898 Ga0182008_10116958
899 Ga0182007_10057463
900 Ga0163161_10265670
901 Ga0206353_11409522
902 Ga0207653_10000321
903 Ga0207653_10033533
904 Ga0207653_10277105
905 Ga0207642_10294257
906 Ga0207688_10025397
907 Ga0207680_10179993
908 Ga0207647_10098294
909 Ga0207647_10285743
910 Ga0207699_10523851
911 Ga0207645_10001546
912 Ga0207643_10004500
913 Ga0207684_10008211
914 Ga0207684_10011397
915 Ga0207684_10021824
916 Ga0207684_10037797
917 Ga0207684_10181807
918 Ga0207684_10195205
919 Ga0207684_10395448
920 Ga0207684_10497842
921 Ga0207684_10648685
922 Ga0207684_11191632
923 Ga0207654_10000677
924 Ga0207654_10034506
925 Ga0207654_10408695
926 Ga0207654_11106525
927 Ga0207707_10000223
928 Ga0207693_10002236
929 Ga0207663_10658740
930 Ga0207660_10009724
931 Ga0207660_10107495
932 Ga0207660_10127782
933 Ga0207660_10349535
934 Ga0207662_10028597
935 Ga0207662_10118589
936 Ga0207657_10000041
937 Ga0207649_10001180
938 Ga0207652_10000760
939 Ga0207652_10951867
940 Ga0207646_10017008
941 Ga0207646_10025928
942 Ga0207646_10039697
943 Ga0207646_10045683
944 Ga0207646_10062141
945 Ga0207646_10181612
946 Ga0207646_10279972
947 Ga0207646_10906763
948 Ga0207646_11275438
949 Ga0207681_10033097
950 Ga0207681_10040551
951 Ga0207650_10016826
952 Ga0207690_10007169
953 Ga0207706_10004994
954 Ga0207706_10046717
955 Ga0207706_10079063
956 Ga0207706_10231366
957 Ga0207706_11256769
958 Ga0207670_10079023
959 Ga0207670_10487721
960 Ga0207704_10075019
961 Ga0207704_10143763
962 Ga0207704_11128462
963 Ga0207665_10034972
964 Ga0207691_10065047
965 Ga0207691_10122186
966 Ga0207711_10333287
967 Ga0207711_10410079
968 Ga0207711_11659024
969 Ga0207689_10000112
970 Ga0207689_10006596
971 Ga0207679_10002536
972 Ga0207667_10002476
973 Ga0207651_10667742
974 Ga0207712_10321508
975 Ga0207712_10606012
976 Ga0207668_10851983
977 Ga0207640_10010106
978 Ga0207658_10914881
979 Ga0207677_10077375
980 Ga0207703_10660075
981 Ga0207639_10030884
982 Ga0207678_10003471
983 Ga0207708_10031701
984 Ga0207708_10320012
985 Ga0207708_10398857
986 Ga0207702_10003094
987 Ga0207641_10071781
988 Ga0207641_10186294
989 Ga0207641_10202094
990 Ga0207641_10954395
991 Ga0207648_10012182
992 Ga0207648_10074343
993 Ga0207676_10095892
994 Ga0207674_10004232
995 Ga0207675_100005454
996 Ga0207675_100140593
997 Ga0207675_100904355
998 Ga0207675_100965493
999 Ga0207675_101027630
1000 Ga0209969_1001517
1001 Ga0209996_1016268
1002 Ga0209996_1046677
1003 Ga0210000_1001780
1004 Ga0209968_1002327
1005 Ga0209999_1000563
1006 Ga0209970_1001704
1007 Ga0209970_1059292
1008 Ga0210002_1000500
1009 Ga0209983_1005215
1010 Ga0209588_1001874
1011 Ga0209971_1000008
1012 Ga0209966_1000187
1013 Ga0209998_10000016
1014 Ga0209998_10086104
1015 Ga0209974_10001338
1016 Ga0209974_10055005
1017 Ga0207428_10000118
1018 Ga0207428_10000725
1019 Ga0207428_10172958
1020 Ga0207428_10192024
1021 Ga0207428_10215735
1022 Ga0268265_10004670
1023 Ga0268265_10150705
1024 Ga0268265_10386691
1025 Ga0268265_10757539
1026 Ga0268264_10064551
1027 Ga0268264_10078735
1028 Ga0268264_10124347
1029 Ga0268264_10125176
1030 Ga0373948_0008948
1031 Ga0373950_0010557
1032 Ga0373958_0140808
1033 Ga0373959_0017604
1034 Ga0373938_0056158
1035 Ga0373940_0020698
1036 Ga0373940_0037581
1037 Ga0373951_0023049
1038 Ga0373952_0068901
1039 Ga0373932_0116231
1040 Ga0373939_0023765
1041 Ga0373939_0112440
1042 Ga0373941_0223401
1043 Ga0373942_0188936
1044 Ga0373961_0114616
1045 Ga0373962_0005496
1046 Ga0373931_0092165
1047 Ga0373931_0141082
1048 Ga0373931_0388324
1049 Ga0395899_0007410
1050 Ga0395900_0001221
1051 Ga0395898_0003272
1052 Ga0395905_0518870
1053 Ga0395901_0001825
1054 Ga0242420_017009
1055 Ga0439437_052893
1056 Ga0439441_146306
1057 Ga0439448_0123757
1058 Ga0439455_0002041
1059 Ga0439458_0002237
1060 Ga0439458_0080183
1061 Ga0439459_0000266
1062 Ga0439459_0014668
1063 Ga0439464_0010534
1064 Ga0439460_0006954
1065 Ga0439460_0088819
1066 Ga0450893_0039276
1067 Ga0451577_0000807
1068 Ga0451577_0020218
1069 Ga0451577_0032116
1070 Ga0453683_0033010
1071 Ga0453683_0464186
1072 Ga0453684_0144071
1073 Ga0453684_0182256
1074 Ga0453684_0589771
1075 Ga0453684_1039371
1076 Ga0451576_0005053
1077 Ga0451576_0018864
1078 Ga0451576_0030468
1079 Ga0451576_0034420
1080 Ga0451576_0045461
1081 Ga0451576_0382888
1082 Ga0451576_0430640
1083 Ga0451576_0757834
1084 Ga0495594_0124976
1085 Ga0495642_0042190
1086 Ga0495633_0139791
1087 Ga0495656_0143515
1088 Ga0495656_0163232
1089 Ga0495659_0059243
1090 Ga0495669_0510847
1091 Ga0495636_0006516
1092 Ga0496102_0039748
1093 Ga0496106_0183855
1094 Ga0496106_0234090
1095 Ga0496112_0051850
1096 Ga0496113_0799993
1097 Ga0501033_0433513
1098 Ga0501036_0301872
1099 Ga0501037_0036759
1100 Ga0501038_0185394
1101 Ga0501039_0042611
1102 Ga0501039_0509892
1103 Ga0501040_0001982
1104 Ga0501040_0255495
1105 Ga0501041_0008326
1106 Ga0501042_0007810
1107 Ga0501042_0087844
1108 Ga0501042_0100174
1109 Ga0501042_0366005
1110 Ga0501043_0302194
1111 Ga0501046_0000779
1112 Ga0501046_0087597
1113 Ga0501047_0320114
1114 Ga0501048_0000908
1115 Ga0501048_0145527
1116 Ga0501071_0617435
1117 Ga0501072_0049576
1118 Ga0501072_0146466
1119 Ga0501074_0002117
1120 Ga0501074_0268460
1121 Ga0501075_0037594
1122 Ga0501075_0104734
1123 Ga0501075_0497032
1124 Ga0501075_1180238
1125 Ga0501076_0075871
1126 Ga0501076_0278096
1127 Ga0501077_0010315
1128 Ga0501077_0108473
1129 Ga0501079_0001192
1130 Ga0501079_0041626
1131 Ga0501079_0053762
1132 Ga0501080_0030744
1133 Ga0501080_0571872
1134 Ga0501080_0824532
1135 Ga0501081_0003534
1136 Ga0501081_0012591
1137 Ga0501081_0178596
1138 Ga0501081_0444816
1139 Ga0501083_0005068
1140 Ga0501045_0000998
1141 Ga0501045_0061555
1142 Ga0501045_0445148
1143 nmdc:mga05p37_1113_c1
1144 nmdc:mga05p37_114204_c1
1145 nmdc:mga05p37_15878_c1
1146 nmdc:mga05p37_317903_c1
1147 nmdc:mga05p37_373542_c1
1148 nmdc:mga05p37_382468_c1
1149 nmdc:mga05p37_4153_c1
1150 nmdc:mga05p37_435263_c1
1151 nmdc:mga05p37_446808_c1
1152 nmdc:mga05p37_524684_c1
1153 nmdc:mga05p37_7423_c1
1154 nmdc:mga05p37_779016_c1
1155 nmdc:mga05p37_7985_c1
1156 nmdc:mga05p37_818722_c1
1157 nmdc:mga05p37_88180_c1
1158 nmdc:mga09592_135273_c1
1159 nmdc:mga09592_14363_c1
1160 nmdc:mga09592_170774_c1
1161 nmdc:mga09592_27718_c1
1162 nmdc:mga09592_568910_c1
1163 nmdc:mga0qj67_118775_c1
1164 nmdc:mga0qj67_3808_c1
1165 nmdc:mga0qj67_405935_c1
1166 nmdc:mga0qj67_478611_c1
1167 nmdc:mga0qj67_645599_c1
1168 nmdc:mga0qj67_936924_c1
1169 nmdc:mga06r32_238712_c1
1170 nmdc:mga06r32_242551_c1
1171 nmdc:mga06r32_498534_c1
1172 nmdc:mga06r32_69002_c1
1173 nmdc:mga06r32_74765_c1
1174 nmdc:mga06r32_805942_c1
1175 nmdc:mga06r32_898417_c1
1176 nmdc:mga08y16_154115_c1
1177 nmdc:mga08y16_161221_c1
1178 nmdc:mga08y16_17007_c1
1179 nmdc:mga08y16_2054399_c1
1180 nmdc:mga08y16_274983_c1
1181 nmdc:mga08y16_5938_c1
1182 nmdc:mga08y16_970823_c1
1183 nmdc:mga08y16_997635_c1
1184 nmdc:mga0n895_105779_c1
1185 nmdc:mga0n895_111787_c1
1186 nmdc:mga0n895_14820_c1
1187 nmdc:mga0n895_155305_c1
1188 nmdc:mga0n895_304783_c1
1189 nmdc:mga0n895_358544_c1
1190 nmdc:mga0n895_38658_c1
1191 nmdc:mga0n895_48001_c1
1192 nmdc:mga0n895_820150_c1
1193 nmdc:mga0n895_9893_c1
1194 nmdc:mga0rr50_100888_c1
1195 nmdc:mga0rr50_106545_c1
1196 nmdc:mga0rr50_110335_c1
1197 nmdc:mga0rr50_138495_c1
1198 nmdc:mga0rr50_1632873_c1
1199 nmdc:mga0rr50_18853_c1
1200 nmdc:mga0rr50_270523_c1
1201 nmdc:mga0rr50_296114_c1
1202 nmdc:mga0rr50_51772_c1
1203 nmdc:mga08x19_52693_c1
1204 nmdc:mga08x19_56305_c1
1205 nmdc:mga08x19_7578_c1
1206 nmdc:mga0a205_10528_c1
1207 nmdc:mga0a205_181065_c1
1208 nmdc:mga0a205_255_c1
1209 nmdc:mga0a205_260038_c1
1210 nmdc:mga0a205_263786_c1
1211 nmdc:mga0a205_35996_c1
1212 nmdc:mga0a205_37539_c1
1213 nmdc:mga0a205_455105_c1
1214 nmdc:mga0a205_631_c1
1215 nmdc:mga0a205_77997_c1
1216 nmdc:mga0a205_879865_c1
1217 Ga0501084_0000880
1218 Ga0501084_0068618
1219 Ga0501084_0115596
1220 Ga0501082_0001040
1221 Ga0501082_0030889
1222 Ga0530510_0005130
1223 Ga0530510_0073178
1224 Ga0530510_0264938
1225 Ga0530510_0640110
1226 Ga0530510_0765533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

123

0.98

Map