F469286

General Info

Members Datasets Scaffolds Average Seq Length
613 249 1226 235

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0000199|Ga0495580_0000199_2643_3470
Length 275
Sequence MSKAIEQACRKRLSGHAEPASTYFRPPSVQAGLEAPATKKGSKVAEKIQRVLVVTAHPDDSEFGAGGTVAKLVRDGCEVTYVIVTNGNKGSGDRTMTSERLARIREEEQRNAARTLGVVRVEFLGYPDCEVEDTRDLRRDVTREIRRWRPDLVITMNPHRTYNLGGSHRDHRTVAGVTLDCVYPLARDHLSFPELMPDFEPHKALEIHLMQWENPQLVVDISDVMDLKIKALACHASQFADFAGVEKRIRERAAELGKPTGYAYAETFDRVVLAR

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.14
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0000199 3300046472 Bacteria 46030
2 JGI26141J51220_1000481 3300003503 Bacteria 2231
3 Ga0065715_10110360 3300005293 Bacteria 2623
4 Ga0065707_10122511 3300005295 Unclassified 2086
5 Ga0065707_10137545 3300005295 Bacteria 1819
6 Ga0065707_10164721 3300005295 Bacteria 1532
7 Ga0065707_10216997 3300005295 Unclassified 1240
8 Ga0070676_10000399 3300005328 Bacteria 20207
9 Ga0070690_100060776 3300005330 Bacteria 2432
10 Ga0070690_100338953 3300005330 Unclassified 1088
11 Ga0070670_100004255 3300005331 Bacteria 11974
12 Ga0068869_100000613 3300005334 Bacteria 20146
13 Ga0068869_100011722 3300005334 Bacteria 5762
14 Ga0070680_100001091 3300005336 Bacteria 19470
15 Ga0070680_100007333 3300005336 Bacteria 8411
16 Ga0070680_100037119 3300005336 Bacteria 3937
17 Ga0070680_100694874 3300005336 Bacteria 875
18 Ga0070682_100002284 3300005337 Bacteria 10603
19 Ga0068868_100116059 3300005338 Unclassified 2180
20 Ga0068868_100220331 3300005338 Bacteria 1588
21 Ga0070660_100000294 3300005339 Bacteria 33307
22 Ga0070689_100082443 3300005340 Bacteria 2526
23 Ga0070689_100177398 3300005340 Bacteria 1729
24 Ga0070691_10000687 3300005341 Bacteria 13191
25 Ga0070691_10076673 3300005341 Bacteria 1630
26 Ga0070691_10239455 3300005341 Bacteria 969
27 Ga0070687_100054868 3300005343 Bacteria 2078
28 Ga0070661_100000260 3300005344 Bacteria 43164
29 Ga0070692_10004434 3300005345 Bacteria 5868
30 Ga0070669_100015449 3300005353 Bacteria 5440
31 Ga0070669_100066249 3300005353 Bacteria 2662
32 Ga0070669_100452336 3300005353 Bacteria 1059
33 Ga0070671_100234227 3300005355 Unclassified 1558
34 Ga0070674_100566957 3300005356 Unclassified 955
35 Ga0070673_100017884 3300005364 Bacteria 5052
36 Ga0070659_100000151 3300005366 Bacteria 53009
37 Ga0070703_10000647 3300005406 Bacteria 12125
38 Ga0070703_10006469 3300005406 Bacteria 3284
39 Ga0070701_10013851 3300005438 Bacteria 3680
40 Ga0070701_10058796 3300005438 Bacteria 2019
41 Ga0070705_100002359 3300005440 Bacteria 9526
42 Ga0070705_100009096 3300005440 Bacteria 4930
43 Ga0070705_100016225 3300005440 Bacteria 3868
44 Ga0070705_100118775 3300005440 Bacteria 1703
45 Ga0070705_100344237 3300005440 Bacteria 1085
46 Ga0070700_100173615 3300005441 Bacteria 1494
47 Ga0070700_100231280 3300005441 Bacteria 1316
48 Ga0070694_100000695 3300005444 Bacteria 18727
49 Ga0070694_100005251 3300005444 Bacteria 7828
50 Ga0070694_100005948 3300005444 Bacteria 7395
51 Ga0070694_100018670 3300005444 Bacteria 4404
52 Ga0070694_100024622 3300005444 Bacteria 3886
53 Ga0070694_100031878 3300005444 Bacteria 3458
54 Ga0070694_100039602 3300005444 Bacteria 3138
55 Ga0070694_100264797 3300005444 Unclassified 1305
56 Ga0070708_100025947 3300005445 Bacteria 5011
57 Ga0070708_100040335 3300005445 Bacteria 4088
58 Ga0070708_100089044 3300005445 Bacteria 2808
59 Ga0070708_100109732 3300005445 Bacteria 2535
60 Ga0070708_100241564 3300005445 Bacteria 1695
61 Ga0070663_100002162 3300005455 Bacteria 10992
62 Ga0070662_100034375 3300005457 Bacteria 3574
63 Ga0070681_10023687 3300005458 Bacteria 6179
64 Ga0068867_100001400 3300005459 Bacteria 16669
65 Ga0068867_100287845 3300005459 Bacteria 1350
66 Ga0070706_100004088 3300005467 Bacteria 14189
67 Ga0070706_100004202 3300005467 Bacteria 13991
68 Ga0070706_100017424 3300005467 Bacteria 6628
69 Ga0070706_100022670 3300005467 Bacteria 5782
70 Ga0070706_100052226 3300005467 Bacteria 3773
71 Ga0070706_100102914 3300005467 Bacteria 2655
72 Ga0070706_100142610 3300005467 Unclassified 2236
73 Ga0070707_100007093 3300005468 Bacteria 10389
74 Ga0070707_100007695 3300005468 Bacteria 10004
75 Ga0070707_100008529 3300005468 Bacteria 9523
76 Ga0070707_100011962 3300005468 Bacteria 8097
77 Ga0070707_100090105 3300005468 Bacteria 2968
78 Ga0070707_100209030 3300005468 Bacteria 1902
79 Ga0070707_100526955 3300005468 Unclassified 1143
80 Ga0070698_100009798 3300005471 Bacteria 10243
81 Ga0070698_100015241 3300005471 Bacteria 8128
82 Ga0070698_100015906 3300005471 Bacteria 7943
83 Ga0070698_100019196 3300005471 Bacteria 7184
84 Ga0070698_100062231 3300005471 Bacteria 3765
85 Ga0070698_100087259 3300005471 Bacteria 3106
86 Ga0070698_100136882 3300005471 Bacteria 2403
87 Ga0070698_100160709 3300005471 Bacteria 2190
88 Ga0070698_100241526 3300005471 Bacteria 1739
89 Ga0070698_100582581 3300005471 Bacteria 1059
90 Ga0070699_100000451 3300005518 Bacteria 39379
91 Ga0070699_100044991 3300005518 Bacteria 3820
92 Ga0070699_100046101 3300005518 Bacteria 3773
93 Ga0070699_100047434 3300005518 Bacteria 3717
94 Ga0070699_100075221 3300005518 Bacteria 2939
95 Ga0070699_100123171 3300005518 Unclassified 2281
96 Ga0070699_100135490 3300005518 Bacteria 2172
97 Ga0070699_100141883 3300005518 Bacteria 2122
98 Ga0070699_100164447 3300005518 Bacteria 1965
99 Ga0070699_100279031 3300005518 Unclassified 1496
100 Ga0070699_100529227 3300005518 Bacteria 1072
101 Ga0070679_100001088 3300005530 Bacteria 23758
102 Ga0070679_100112296 3300005530 Bacteria 2711
103 Ga0070684_100060742 3300005535 Bacteria 3307
104 Ga0070697_100005220 3300005536 Bacteria 9978
105 Ga0070697_100005819 3300005536 Bacteria 9514
106 Ga0070697_100009120 3300005536 Bacteria 7750
107 Ga0070697_100025914 3300005536 Bacteria 4677
108 Ga0070697_100027748 3300005536 Bacteria 4531
109 Ga0070697_100062426 3300005536 Bacteria 3041
110 Ga0070697_100099151 3300005536 Bacteria 2418
111 Ga0070697_100135723 3300005536 Bacteria 2066
112 Ga0068853_100001773 3300005539 Bacteria 15862
113 Ga0068853_100432155 3300005539 Bacteria 1236
114 Ga0070672_100016904 3300005543 Bacteria 5235
115 Ga0070672_100334733 3300005543 Unclassified 1288
116 Ga0070686_100285528 3300005544 Bacteria 1219
117 Ga0070695_100000773 3300005545 Bacteria 17225
118 Ga0070695_100003003 3300005545 Bacteria 9829
119 Ga0070695_100022956 3300005545 Bacteria 3829
120 Ga0070695_100029006 3300005545 Bacteria 3436
121 Ga0070695_100051249 3300005545 Bacteria 2648
122 Ga0070695_100057746 3300005545 Bacteria 2508
123 Ga0070695_100134894 3300005545 Bacteria 1705
124 Ga0070696_100003398 3300005546 Bacteria 10622
125 Ga0070696_100028096 3300005546 Bacteria 3836
126 Ga0070696_100092413 3300005546 Unclassified 2156
127 Ga0070696_100164230 3300005546 Bacteria 1638
128 Ga0070693_100000077 3300005547 Bacteria 40469
129 Ga0070693_100054458 3300005547 Bacteria 2301
130 Ga0070693_100230071 3300005547 Unclassified 1219
131 Ga0070704_100002730 3300005549 Bacteria 9980
132 Ga0070704_100011808 3300005549 Bacteria 5373
133 Ga0070704_100034747 3300005549 Bacteria 3421
134 Ga0068855_100012494 3300005563 Bacteria 10250
135 Ga0070664_100359308 3300005564 Bacteria 1326
136 Ga0068857_100077629 3300005577 Unclassified 2964
137 Ga0068857_100088735 3300005577 Bacteria 2766
138 Ga0068854_100126519 3300005578 Bacteria 1947
139 Ga0068856_100001162 3300005614 Bacteria 27668
140 Ga0070702_100013424 3300005615 Bacteria 4135
141 Ga0068859_100029275 3300005617 Bacteria 5525
142 Ga0068859_100046542 3300005617 Bacteria 4356
143 Ga0068859_100158150 3300005617 Bacteria 2344
144 Ga0068859_100561146 3300005617 Bacteria 1236
145 Ga0068864_100027654 3300005618 Bacteria 4792
146 Ga0068864_100171602 3300005618 Bacteria 1978
147 Ga0068866_10091065 3300005718 Bacteria 1661
148 Ga0068866_10092664 3300005718 Bacteria 1649
149 Ga0068861_100029167 3300005719 Bacteria 4034
150 Ga0068861_100760148 3300005719 Bacteria 906
151 Ga0068851_10022727 3300005834 Bacteria 3059
152 Ga0068870_10000176 3300005840 Bacteria 23093
153 Ga0068863_100081333 3300005841 Bacteria 3068
154 Ga0068863_100139115 3300005841 Unclassified 2320
155 Ga0068863_100470142 3300005841 Bacteria 1235
156 Ga0068858_100033873 3300005842 Bacteria 4738
157 Ga0068858_100141156 3300005842 Bacteria 2261
158 Ga0068860_100024543 3300005843 Bacteria 5824
159 Ga0068860_100027528 3300005843 Bacteria 5474
160 Ga0068860_100153013 3300005843 Bacteria 2222
161 Ga0068860_100189029 3300005843 Bacteria 1993
162 Ga0068860_100353496 3300005843 Bacteria 1446
163 Ga0068860_100438307 3300005843 Bacteria 1297
164 Ga0068862_100007133 3300005844 Bacteria 9280
165 Ga0068862_100018101 3300005844 Bacteria 5866
166 Ga0068862_100031828 3300005844 Bacteria 4455
167 Ga0068862_100900369 3300005844 Bacteria 870
168 Ga0081455_10001046 3300005937 Bacteria 34887
169 Ga0081538_10045113 3300005981 Bacteria 2737
170 Ga0081540_1052640 3300005983 Unclassified 2002
171 Ga0075432_10040547 3300006058 Bacteria 1625
172 Ga0070715_10101547 3300006163 Bacteria 1342
173 Ga0070716_100007237 3300006173 Bacteria 5458
174 Ga0070712_100002336 3300006175 Bacteria 11684
175 Ga0075428_100000367 3300006844 Bacteria 44787
176 Ga0075428_100170785 3300006844 Bacteria 2357
177 Ga0075428_100483630 3300006844 Bacteria 1325
178 Ga0075428_100543628 3300006844 Bacteria 1242
179 Ga0075428_101086963 3300006844 Bacteria 845
180 Ga0075430_100000036 3300006846 Bacteria 68655
181 Ga0075430_100002234 3300006846 Bacteria 16046
182 Ga0075430_100100063 3300006846 Bacteria 2421
183 Ga0075430_100146711 3300006846 Bacteria 1965
184 Ga0075431_100000370 3300006847 Bacteria 35785
185 Ga0075431_100008603 3300006847 Bacteria 10219
186 Ga0075431_100009289 3300006847 Bacteria 9864
187 Ga0075431_100068951 3300006847 Bacteria 3649
188 Ga0075431_100134840 3300006847 Bacteria 2545
189 Ga0075431_100171244 3300006847 Bacteria 2231
190 Ga0075431_100562303 3300006847 Bacteria 1127
191 Ga0075433_10000826 3300006852 Bacteria 21650
192 Ga0075433_10002293 3300006852 Bacteria 14570
193 Ga0075433_10003279 3300006852 Bacteria 12495
194 Ga0075433_10028162 3300006852 Bacteria 4775
195 Ga0075433_10036013 3300006852 Bacteria 4260
196 Ga0075433_10071839 3300006852 Bacteria 3042
197 Ga0075433_10080618 3300006852 Bacteria 2869
198 Ga0075433_10184209 3300006852 Bacteria 1858
199 Ga0075434_100000463 3300006871 Bacteria 30376
200 Ga0075434_100008131 3300006871 Bacteria 9727
201 Ga0075434_100028275 3300006871 Bacteria 5506
202 Ga0075434_100043720 3300006871 Bacteria 4443
203 Ga0075434_100060425 3300006871 Bacteria 3769
204 Ga0075434_100076456 3300006871 Bacteria 3343
205 Ga0075434_100118923 3300006871 Bacteria 2656
206 Ga0075434_100120171 3300006871 Bacteria 2642
207 Ga0075434_100147900 3300006871 Bacteria 2369
208 Ga0075434_100326726 3300006871 Bacteria 1554
209 Ga0075434_100397839 3300006871 Bacteria 1398
210 Ga0075434_100469865 3300006871 Bacteria 1279
211 Ga0075429_100000001 3300006880 Bacteria 139031
212 Ga0075429_100005966 3300006880 Bacteria 10523
213 Ga0075429_100015623 3300006880 Bacteria 6578
214 Ga0075429_100017792 3300006880 Bacteria 6147
215 Ga0075429_100041160 3300006880 Bacteria 4024
216 Ga0075429_100096419 3300006880 Bacteria 2580
217 Ga0068865_100660689 3300006881 Bacteria 889
218 Ga0075436_100046811 3300006914 Bacteria 2983
219 Ga0075436_100139570 3300006914 Bacteria 1703
220 Ga0075436_100318854 3300006914 Unclassified 1116
221 Ga0075436_100411065 3300006914 Bacteria 981
222 Ga0097620_100029278 3300006931 Bacteria 5525
223 Ga0097620_100046541 3300006931 Bacteria 4356
224 Ga0097620_100158154 3300006931 Bacteria 2344
225 Ga0097620_100561156 3300006931 Bacteria 1236
226 Ga0075435_100004683 3300007076 Bacteria 9432
227 Ga0075435_100012041 3300007076 Bacteria 6391
228 Ga0075435_100018067 3300007076 Bacteria 5352
229 Ga0075435_100043070 3300007076 Bacteria 3613
230 Ga0075435_100062750 3300007076 Bacteria 3016
231 Ga0075435_100094075 3300007076 Bacteria 2477
232 Ga0099794_10011527 3300007265 Bacteria 3786
233 Ga0099794_10020881 3300007265 Bacteria 2969
234 Ga0099794_10165767 3300007265 Unclassified 1125
235 Ga0099794_10221634 3300007265 Bacteria 972
236 Ga0111539_10002135 3300009094 Bacteria 26456
237 Ga0111539_10004822 3300009094 Bacteria 17581
238 Ga0111539_10041373 3300009094 Bacteria 5541
239 Ga0111539_10048850 3300009094 Bacteria 5050
240 Ga0111539_10140287 3300009094 Bacteria 2830
241 Ga0105245_10044329 3300009098 Bacteria 3970
242 Ga0105245_10598425 3300009098 Bacteria 1129
243 Ga0105247_10035909 3300009101 Bacteria 3022
244 Ga0114129_10007686 3300009147 Bacteria 15340
245 Ga0114129_10008853 3300009147 Bacteria 14361
246 Ga0114129_10018531 3300009147 Bacteria 9911
247 Ga0114129_10019523 3300009147 Bacteria 9650
248 Ga0114129_10025650 3300009147 Bacteria 8351
249 Ga0114129_10066229 3300009147 Bacteria 5039
250 Ga0114129_10074019 3300009147 Bacteria 4745
251 Ga0114129_10130966 3300009147 Bacteria 3445
252 Ga0114129_10178540 3300009147 Bacteria 2891
253 Ga0114129_10409230 3300009147 Unclassified 1786
254 Ga0114129_10414380 3300009147 Bacteria 1773
255 Ga0114129_10454778 3300009147 Bacteria 1679
256 Ga0105243_10006276 3300009148 Bacteria 9184
257 Ga0105241_10000054 3300009174 Bacteria 93205
258 Ga0105241_10246079 3300009174 Bacteria 1514
259 Ga0105241_10448001 3300009174 Bacteria 1141
260 Ga0105241_10786676 3300009174 Unclassified 875
261 Ga0105242_10044087 3300009176 Bacteria 3611
262 Ga0105242_10165298 3300009176 Unclassified 1941
263 Ga0105242_10447853 3300009176 Unclassified 1216
264 Ga0105248_10171347 3300009177 Bacteria 2446
265 Ga0105249_10058052 3300009553 Bacteria 3547
266 Ga0105249_10064956 3300009553 Bacteria 3356
267 Ga0105249_10321343 3300009553 Bacteria 1559
268 Ga0157373_10000475 3300013100 Bacteria 31828
269 Ga0157371_10208471 3300013102 Bacteria 1402
270 Ga0157370_10122188 3300013104 Bacteria 2431
271 Ga0157378_10671690 3300013297 Bacteria 1053
272 Ga0157378_10820135 3300013297 Unclassified 957
273 Ga0163162_10032345 3300013306 Bacteria 5195
274 Ga0163162_10654494 3300013306 Unclassified 1174
275 Ga0157372_10000420 3300013307 Bacteria 46608
276 Ga0157372_10560618 3300013307 Bacteria 1332
277 Ga0157375_10029085 3300013308 Bacteria 5192
278 Ga0157375_10224121 3300013308 Bacteria 2039
279 Ga0157375_10449168 3300013308 Bacteria 1455
280 Ga0163163_10016568 3300014325 Bacteria 6854
281 Ga0157380_10461750 3300014326 Bacteria 1222
282 Ga0157380_10814742 3300014326 Bacteria 952
283 Ga0157379_10171887 3300014968 Bacteria 1956
284 Ga0157379_10302096 3300014968 Bacteria 1459
285 Ga0163161_10185894 3300017792 Bacteria 1595
286 Ga0206350_11330308 3300020080 Bacteria 1813
287 Ga0224712_10009291 3300022467 Bacteria 2956
288 Ga0224712_10234120 3300022467 Unclassified 844
289 Ga0207653_10001345 3300025885 Bacteria 7992
290 Ga0207653_10003775 3300025885 Bacteria 4767
291 Ga0207642_10065024 3300025899 Bacteria 1712
292 Ga0207688_10040882 3300025901 Bacteria 2577
293 Ga0207680_10059445 3300025903 Bacteria 2322
294 Ga0207699_10022687 3300025906 Bacteria 3406
295 Ga0207645_10000589 3300025907 Bacteria 30180
296 Ga0207643_10000014 3300025908 Bacteria 128891
297 Ga0207684_10002192 3300025910 Bacteria 19973
298 Ga0207684_10008566 3300025910 Bacteria 9095
299 Ga0207684_10035152 3300025910 Bacteria 4256
300 Ga0207684_10130350 3300025910 Unclassified 2158
301 Ga0207684_10267175 3300025910 Unclassified 1476
302 Ga0207654_10001801 3300025911 Bacteria 11133
303 Ga0207707_10000138 3300025912 Bacteria 74881
304 Ga0207693_10018409 3300025915 Bacteria 5563
305 Ga0207660_10004489 3300025917 Bacteria 9101
306 Ga0207660_10066412 3300025917 Bacteria 2609
307 Ga0207662_10033894 3300025918 Bacteria 2979
308 Ga0207657_10000135 3300025919 Bacteria 75248
309 Ga0207649_10015242 3300025920 Bacteria 4318
310 Ga0207652_10001153 3300025921 Bacteria 23785
311 Ga0207652_10269647 3300025921 Bacteria 1535
312 Ga0207646_10003384 3300025922 Bacteria 18044
313 Ga0207646_10014999 3300025922 Bacteria 7335
314 Ga0207646_10016023 3300025922 Bacteria 7047
315 Ga0207646_10016096 3300025922 Bacteria 7028
316 Ga0207646_10020112 3300025922 Bacteria 6191
317 Ga0207646_10032684 3300025922 Bacteria 4707
318 Ga0207646_10045475 3300025922 Bacteria 3941
319 Ga0207646_10065967 3300025922 Bacteria 3231
320 Ga0207646_10206364 3300025922 Bacteria 1775
321 Ga0207646_10584595 3300025922 Unclassified 1003
322 Ga0207681_10038355 3300025923 Bacteria 3174
323 Ga0207681_10281326 3300025923 Unclassified 1310
324 Ga0207681_10352399 3300025923 Bacteria 1179
325 Ga0207681_10365331 3300025923 Bacteria 1158
326 Ga0207650_10018963 3300025925 Bacteria 4834
327 Ga0207687_10024290 3300025927 Bacteria 4047
328 Ga0207644_10199984 3300025931 Unclassified 1576
329 Ga0207690_10000884 3300025932 Bacteria 19156
330 Ga0207706_10029339 3300025933 Bacteria 4911
331 Ga0207706_10050454 3300025933 Bacteria 3677
332 Ga0207686_10149295 3300025934 Bacteria 1625
333 Ga0207686_10220950 3300025934 Bacteria 1368
334 Ga0207709_10018469 3300025935 Bacteria 3907
335 Ga0207709_10071812 3300025935 Bacteria 2199
336 Ga0207670_10069625 3300025936 Bacteria 2428
337 Ga0207670_10115221 3300025936 Bacteria 1944
338 Ga0207665_10002823 3300025939 Bacteria 11647
339 Ga0207691_10028455 3300025940 Bacteria 5233
340 Ga0207691_10192363 3300025940 Bacteria 1779
341 Ga0207711_10116608 3300025941 Bacteria 2381
342 Ga0207711_10177007 3300025941 Bacteria 1938
343 Ga0207689_10000340 3300025942 Bacteria 43593
344 Ga0207689_10042129 3300025942 Bacteria 3779
345 Ga0207679_10000492 3300025945 Bacteria 27253
346 Ga0207667_10002330 3300025949 Bacteria 23785
347 Ga0207651_10017408 3300025960 Bacteria 4247
348 Ga0207712_10007920 3300025961 Bacteria 6711
349 Ga0207712_10030502 3300025961 Bacteria 3625
350 Ga0207712_10154624 3300025961 Bacteria 1775
351 Ga0207640_10144963 3300025981 Bacteria 1736
352 Ga0207640_10375655 3300025981 Bacteria 1150
353 Ga0207658_10089871 3300025986 Bacteria 2379
354 Ga0207677_10085409 3300026023 Bacteria 2278
355 Ga0207703_10082351 3300026035 Bacteria 2685
356 Ga0207639_10001574 3300026041 Bacteria 15302
357 Ga0207678_10005156 3300026067 Bacteria 11712
358 Ga0207702_10048175 3300026078 Bacteria 3593
359 Ga0207641_10212641 3300026088 Unclassified 1789
360 Ga0207641_10480606 3300026088 Bacteria 1204
361 Ga0207648_10000374 3300026089 Bacteria 49152
362 Ga0207648_10164424 3300026089 Bacteria 1960
363 Ga0207648_10224532 3300026089 Bacteria 1670
364 Ga0207648_10866642 3300026089 Archaea 843
365 Ga0207676_10007758 3300026095 Bacteria 7633
366 Ga0207674_10000684 3300026116 Bacteria 44066
367 Ga0207674_10053858 3300026116 Bacteria 4099
368 Ga0207675_100006969 3300026118 Bacteria 10691
369 Ga0207675_100066607 3300026118 Bacteria 3367
370 Ga0207675_100087322 3300026118 Bacteria 2929
371 Ga0209969_1003922 3300027360 Bacteria 2073
372 Ga0209981_1004560 3300027378 Bacteria 1821
373 Ga0209996_1000947 3300027395 Bacteria 3433
374 Ga0210000_1006493 3300027462 Bacteria 1702
375 Ga0209995_1001163 3300027471 Bacteria 4045
376 Ga0209968_1000646 3300027526 Bacteria 5374
377 Ga0209999_1002573 3300027543 Bacteria 3208
378 Ga0209982_1006522 3300027552 Bacteria 1698
379 Ga0209588_1074045 3300027671 Bacteria 1100
380 Ga0209971_1000010 3300027682 Bacteria 84272
381 Ga0209966_1000110 3300027695 Bacteria 36054
382 Ga0209998_10000565 3300027717 Bacteria 10008
383 Ga0209974_10011504 3300027876 Bacteria 2970
384 Ga0207428_10000018 3300027907 Bacteria 293117
385 Ga0207428_10000119 3300027907 Bacteria 106261
386 Ga0207428_10017026 3300027907 Bacteria 6244
387 Ga0268265_10014060 3300028380 Bacteria 5454
388 Ga0268265_10015715 3300028380 Bacteria 5185
389 Ga0268265_10220367 3300028380 Bacteria 1659
390 Ga0268264_10032696 3300028381 Bacteria 4269
391 Ga0268264_10128987 3300028381 Bacteria 2239
392 Ga0307408_100119335 3300031548 Bacteria 2040
393 Ga0316578_10152539 3300031728 Bacteria 1392
394 Ga0307405_10042795 3300031731 Bacteria 2759
395 Ga0307410_10054214 3300031852 Bacteria 2717
396 Ga0307412_10160296 3300031911 Bacteria 1670
397 Ga0307409_100131633 3300031995 Bacteria 2139
398 Ga0307416_100053356 3300032002 Bacteria 3243
399 Ga0307411_10343336 3300032005 Bacteria 1214
400 Ga0316596_1057154 3300033541 Bacteria 1038
401 Ga0373948_0010050 3300034817 Unclassified 1644
402 Ga0373948_0059409 3300034817 Unclassified 837
403 Ga0373948_0072655 3300034817 Bacteria 774
404 Ga0373950_0032521 3300034818 Unclassified 971
405 Ga0373959_0009890 3300034820 Bacteria 1656
406 Ga0373940_0111357 3300035088 Bacteria 841
407 Ga0373949_0048099 3300035090 Unclassified 1067
408 Ga0373951_0007951 3300035091 Bacteria 2403
409 Ga0373932_0161569 3300035112 Bacteria 775
410 Ga0373939_0052625 3300035114 Bacteria 1269
411 Ga0373962_0075106 3300035242 Unclassified 1017
412 Ga0316574_0010275 3300035398 Bacteria 5281
413 Ga0373931_0076726 3300035691 Unclassified 1836
414 Ga0373931_0502202 3300035691 Unclassified 782
415 Ga0316584_0203616 3300036712 Bacteria 1459
416 Ga0395899_0069530 3300037312 Bacteria 2578
417 Ga0395900_0007315 3300037418 Bacteria 11418
418 Ga0395898_0007991 3300037466 Bacteria 11223
419 Ga0395901_0001940 3300038443 Bacteria 21295
420 Ga0395901_0947500 3300038443 Archaea 840
421 Ga0242420_008327 3300038996 Bacteria 1680
422 Ga0439450_009874 3300042008 Bacteria 1825
423 Ga0439458_0033762 3300042157 Unclassified 1226
424 Ga0439459_0001802 3300042438 Bacteria 3216
425 Ga0439464_0000744 3300042439 Bacteria 7050
426 Ga0439464_0025599 3300042439 Unclassified 1634
427 Ga0451577_0000878 3300042876 Bacteria 44604
428 Ga0451577_0028184 3300042876 Bacteria 5081
429 Ga0451577_0038148 3300042876 Bacteria 4321
430 Ga0451577_0049382 3300042876 Bacteria 3757
431 Ga0451577_0143179 3300042876 Unclassified 2149
432 Ga0451577_0840445 3300042876 Unclassified 828
433 Ga0439440_0057801 3300042993 Unclassified 984
434 Ga0466969_0083086 3300044656 Bacteria 1526
435 Ga0453683_0037873 3300044673 Bacteria 3033
436 Ga0453683_0046023 3300044673 Unclassified 2736
437 Ga0453683_0079947 3300044673 Bacteria 2047
438 Ga0453683_0106243 3300044673 Bacteria 1764
439 Ga0453684_0012709 3300044712 Bacteria 13824
440 Ga0453684_0215309 3300044712 Bacteria 2229
441 Ga0453684_0226606 3300044712 Bacteria 2161
442 Ga0453684_0738472 3300044712 Bacteria 1066
443 Ga0451576_0015692 3300045051 Bacteria 8385
444 Ga0451576_0019012 3300045051 Bacteria 7507
445 Ga0451576_0041522 3300045051 Bacteria 4862
446 Ga0451576_0043460 3300045051 Bacteria 4741
447 Ga0451576_0061029 3300045051 Bacteria 3932
448 Ga0451576_0069835 3300045051 Bacteria 3656
449 Ga0451576_0082041 3300045051 Bacteria 3353
450 Ga0451576_0091794 3300045051 Bacteria 3158
451 Ga0451576_0342465 3300045051 Bacteria 1565
452 Ga0451576_0618609 3300045051 Unclassified 1138
453 Ga0451576_0762182 3300045051 Bacteria 1016
454 Ga0495603_0022467 3300046455 Bacteria 3818
455 Ga0495580_0021426 3300046472 Bacteria 4768
456 Ga0495642_0014060 3300046528 Bacteria 3102
457 Ga0495659_0040755 3300046664 Bacteria 1657
458 Ga0495669_0072944 3300046684 Bacteria 1567
459 Ga0495636_0092391 3300047318 Bacteria 1315
460 Ga0496102_0035113 3300048905 Bacteria 4512
461 Ga0496102_0666917 3300048905 Archaea 963
462 Ga0496106_0085923 3300048909 Unclassified 2423
463 Ga0496106_0094228 3300048909 Bacteria 2315
464 Ga0496106_0410586 3300048909 Unclassified 1088
465 Ga0496107_0095529 3300048910 Bacteria 2175
466 Ga0496115_0001155 3300048918 Bacteria 19087
467 Ga0501032_0148239 3300049569 Bacteria 1544
468 Ga0501033_0031253 3300049570 Bacteria 4002
469 Ga0501033_0299833 3300049570 Bacteria 1132
470 Ga0501036_0092066 3300049572 Bacteria 2561
471 Ga0501036_0119661 3300049572 Bacteria 2224
472 Ga0501036_0313948 3300049572 Bacteria 1310
473 Ga0501036_0445280 3300049572 Unclassified 1079
474 Ga0501038_0130801 3300049574 Unclassified 2061
475 Ga0501039_0022257 3300049575 Bacteria 4866
476 Ga0501039_0184038 3300049575 Bacteria 1643
477 Ga0501040_0001245 3300049576 Bacteria 16185
478 Ga0501040_0013316 3300049576 Bacteria 5408
479 Ga0501040_0139421 3300049576 Bacteria 1708
480 Ga0501040_0140872 3300049576 Unclassified 1699
481 Ga0501040_0289471 3300049576 Bacteria 1170
482 Ga0501041_0017337 3300049577 Bacteria 4285
483 Ga0501041_0288963 3300049577 Unclassified 1032
484 Ga0501042_0001856 3300049578 Bacteria 12684
485 Ga0501042_0388475 3300049578 Unclassified 1011
486 Ga0501043_0065968 3300049579 Bacteria 2843
487 Ga0501046_0000340 3300049580 Bacteria 47112
488 Ga0501047_0030263 3300049581 Bacteria 5220
489 Ga0501048_0016182 3300049582 Bacteria 5498
490 Ga0501048_0130156 3300049582 Bacteria 1779
491 Ga0501048_0560674 3300049582 Bacteria 820
492 Ga0501067_0299284 3300049583 Bacteria 896
493 Ga0501068_0073474 3300049584 Bacteria 2089
494 Ga0501068_0137084 3300049584 Bacteria 1533
495 Ga0501069_0180493 3300049585 Bacteria 1220
496 Ga0501071_0030800 3300049587 Bacteria 3797
497 Ga0501072_0079754 3300049588 Unclassified 2593
498 Ga0501072_0108661 3300049588 Bacteria 2207
499 Ga0501072_0116304 3300049588 Bacteria 2130
500 Ga0501072_0189765 3300049588 Bacteria 1639
501 Ga0501072_0582813 3300049588 Bacteria 882
502 Ga0501073_0366498 3300049589 Bacteria 995
503 Ga0501074_0002344 3300049590 Bacteria 13180
504 Ga0501074_0195774 3300049590 Bacteria 1441
505 Ga0501075_0009602 3300049591 Bacteria 6774
506 Ga0501075_0058071 3300049591 Bacteria 2914
507 Ga0501075_0330210 3300049591 Bacteria 1162
508 Ga0501075_0635082 3300049591 Bacteria 814
509 Ga0501076_0000873 3300049592 Bacteria 19565
510 Ga0501077_0024356 3300049593 Bacteria 3843
511 Ga0501077_0030175 3300049593 Bacteria 3450
512 Ga0501079_0005909 3300049741 Bacteria 9167
513 Ga0501079_0076980 3300049741 Bacteria 2580
514 Ga0501079_0089628 3300049741 Bacteria 2382
515 Ga0501079_0552179 3300049741 Bacteria 906
516 Ga0501080_0049341 3300049742 Bacteria 3918
517 Ga0501081_0066887 3300049743 Bacteria 2499
518 Ga0501081_0110339 3300049743 Bacteria 1951
519 Ga0501081_0143473 3300049743 Bacteria 1712
520 Ga0501081_0262008 3300049743 Unclassified 1263
521 Ga0501083_0007233 3300049744 Bacteria 7883
522 Ga0501083_0206192 3300049744 Unclassified 1282
523 Ga0501035_0530607 3300049822 Unclassified 966
524 Ga0501045_0000589 3300049824 Bacteria 22827
525 Ga0501045_0092393 3300049824 Bacteria 2238
526 Ga0501045_0133072 3300049824 Bacteria 1849
527 Ga0501045_0335381 3300049824 Bacteria 1125
528 nmdc:mga05p37_107205_c1 3300050507 Bacteria 3437
529 nmdc:mga05p37_108908_c1 3300050507 Bacteria 3408
530 nmdc:mga05p37_133708_c1 3300050507 Bacteria 3043
531 nmdc:mga05p37_195046_c1 3300050507 Bacteria 2456
532 nmdc:mga05p37_21253_c1 3300050507 Bacteria 7857
533 nmdc:mga05p37_316868_c1 3300050507 Bacteria 1847
534 nmdc:mga05p37_409666_c1 3300050507 Unclassified 1581
535 nmdc:mga05p37_47871_c1 3300050507 Bacteria 5258
536 nmdc:mga05p37_49958_c1 3300050507 Bacteria 5144
537 nmdc:mga05p37_5956_c1 3300050507 Bacteria 14347
538 nmdc:mga05p37_6886_c1 3300050507 Bacteria 13400
539 nmdc:mga05p37_75873_c1 3300050507 Bacteria 4139
540 nmdc:mga05p37_75916_c1 3300050507 Bacteria 4137
541 nmdc:mga05p37_80081_c1 3300050507 Bacteria 4023
542 nmdc:mga05p37_82884_c1 3300050507 Bacteria 3952
543 nmdc:mga05p37_86612_c1 3300050507 Bacteria 3861
544 nmdc:mga09592_13050_c1 3300050508 Bacteria 6782
545 nmdc:mga09592_156868_c1 3300050508 Bacteria 1965
546 nmdc:mga09592_185057_c1 3300050508 Bacteria 1802
547 nmdc:mga09592_3438_c1 3300050508 Bacteria 12786
548 nmdc:mga09592_34540_c1 3300050508 Bacteria 4227
549 nmdc:mga09592_499978_c1 3300050508 Unclassified 1047
550 nmdc:mga09592_666552_c1 3300050508 Bacteria 887
551 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
552 nmdc:mga0qj67_15426_c1 3300050509 Bacteria 5785
553 nmdc:mga0qj67_1693_c1 3300050509 Bacteria 15545
554 nmdc:mga06r32_103558_c1 3300050510 Bacteria 2795
555 nmdc:mga06r32_104949_c1 3300050510 Bacteria 2776
556 nmdc:mga06r32_1336_c1 3300050510 Bacteria 22239
557 nmdc:mga06r32_388986_c1 3300050510 Bacteria 1377
558 nmdc:mga06r32_6869_c1 3300050510 Bacteria 10228
559 nmdc:mga06r32_862258_c1 3300050510 Bacteria 864
560 nmdc:mga08y16_16700_c1 3300050511 Bacteria 7725
561 nmdc:mga08y16_19457_c1 3300050511 Bacteria 7158
562 nmdc:mga08y16_282_c1 3300050511 Bacteria 46166
563 nmdc:mga08y16_35166_c1 3300050511 Bacteria 5262
564 nmdc:mga0n895_190392_c1 3300050512 Bacteria 2083
565 nmdc:mga0n895_22719_c1 3300050512 Bacteria 5883
566 nmdc:mga0n895_26864_c1 3300050512 Bacteria 5460
567 nmdc:mga0n895_29166_c1 3300050512 Bacteria 5259
568 nmdc:mga0n895_33354_c1 3300050512 Bacteria 4948
569 nmdc:mga0n895_366038_c1 3300050512 Unclassified 1460
570 nmdc:mga0n895_378903_c1 3300050512 Unclassified 1432
571 nmdc:mga0n895_43479_c1 3300050512 Bacteria 4377
572 nmdc:mga0n895_4365_c1 3300050512 Bacteria 11597
573 nmdc:mga0n895_462317_c1 3300050512 Bacteria 1281
574 nmdc:mga0n895_73279_c1 3300050512 Bacteria 3400
575 nmdc:mga0n895_87824_c1 3300050512 Bacteria 3108
576 nmdc:mga0n895_93488_c1 3300050512 Bacteria 3011
577 nmdc:mga0rr50_10860_c1 3300050513 Bacteria 5805
578 nmdc:mga0rr50_113087_c1 3300050513 Bacteria 2151
579 nmdc:mga0rr50_16594_c1 3300050513 Bacteria 4897
580 nmdc:mga0rr50_183837_c1 3300050513 Bacteria 1710
581 nmdc:mga0rr50_246629_c1 3300050513 Bacteria 1482
582 nmdc:mga0rr50_338532_c1 3300050513 Bacteria 1264
583 nmdc:mga0rr50_5747_c1 3300050513 Bacteria 7441
584 nmdc:mga0rr50_66680_c1 3300050513 Bacteria 2732
585 nmdc:mga08x19_398484_c1 3300050514 Bacteria 965
586 nmdc:mga08x19_42326_c1 3300050514 Bacteria 2904
587 nmdc:mga08x19_4288_c1 3300050514 Bacteria 8454
588 nmdc:mga08x19_92259_c1 3300050514 Bacteria 2000
589 nmdc:mga0a205_109287_c1 3300050515 Bacteria 2663
590 nmdc:mga0a205_120937_c1 3300050515 Bacteria 2518
591 nmdc:mga0a205_1303_c1 3300050515 Bacteria 20950
592 nmdc:mga0a205_2047_c1 3300050515 Bacteria 17616
593 nmdc:mga0a205_210454_c1 3300050515 Bacteria 1833
594 nmdc:mga0a205_303820_c1 3300050515 Bacteria 1468
595 nmdc:mga0a205_3065_c1 3300050515 Bacteria 14829
596 nmdc:mga0a205_424723_c1 3300050515 Bacteria 1191
597 nmdc:mga0a205_519_c1 3300050515 Bacteria 30276
598 nmdc:mga0a205_66440_c1 3300050515 Bacteria 3485
599 nmdc:mga0a205_84451_c1 3300050515 Bacteria 3067
600 Ga0501084_0001155 3300054114 Bacteria 20565
601 Ga0501084_0016260 3300054114 Bacteria 6178
602 Ga0501084_0091174 3300054114 Bacteria 2559
603 Ga0501084_0131293 3300054114 Bacteria 2108
604 Ga0501082_0005582 3300060353 Bacteria 10927
605 Ga0501082_0010644 3300060353 Bacteria 7919
606 Ga0501082_0030459 3300060353 Bacteria 4650
607 Ga0501082_0295333 3300060353 Bacteria 1411
608 Ga0501082_0304200 3300060353 Bacteria 1389
609 Ga0530510_0007086 3300061734 Bacteria 7803
610 Ga0530510_0007974 3300061734 Bacteria 7387
611 Ga0530510_0038421 3300061734 Bacteria 3456
612 Ga0530510_0282757 3300061734 Unclassified 1239
613 Ga0530510_0458254 3300061734 Bacteria 964
614 Ga0495580_0000199
615 JGI26141J51220_1000481
616 Ga0065715_10110360
617 Ga0065707_10122511
618 Ga0065707_10137545
619 Ga0065707_10164721
620 Ga0065707_10216997
621 Ga0070676_10000399
622 Ga0070690_100060776
623 Ga0070690_100338953
624 Ga0070670_100004255
625 Ga0068869_100000613
626 Ga0068869_100011722
627 Ga0070680_100001091
628 Ga0070680_100007333
629 Ga0070680_100037119
630 Ga0070680_100694874
631 Ga0070682_100002284
632 Ga0068868_100116059
633 Ga0068868_100220331
634 Ga0070660_100000294
635 Ga0070689_100082443
636 Ga0070689_100177398
637 Ga0070691_10000687
638 Ga0070691_10076673
639 Ga0070691_10239455
640 Ga0070687_100054868
641 Ga0070661_100000260
642 Ga0070692_10004434
643 Ga0070669_100015449
644 Ga0070669_100066249
645 Ga0070669_100452336
646 Ga0070671_100234227
647 Ga0070674_100566957
648 Ga0070673_100017884
649 Ga0070659_100000151
650 Ga0070703_10000647
651 Ga0070703_10006469
652 Ga0070701_10013851
653 Ga0070701_10058796
654 Ga0070705_100002359
655 Ga0070705_100009096
656 Ga0070705_100016225
657 Ga0070705_100118775
658 Ga0070705_100344237
659 Ga0070700_100173615
660 Ga0070700_100231280
661 Ga0070694_100000695
662 Ga0070694_100005251
663 Ga0070694_100005948
664 Ga0070694_100018670
665 Ga0070694_100024622
666 Ga0070694_100031878
667 Ga0070694_100039602
668 Ga0070694_100264797
669 Ga0070708_100025947
670 Ga0070708_100040335
671 Ga0070708_100089044
672 Ga0070708_100109732
673 Ga0070708_100241564
674 Ga0070663_100002162
675 Ga0070662_100034375
676 Ga0070681_10023687
677 Ga0068867_100001400
678 Ga0068867_100287845
679 Ga0070706_100004088
680 Ga0070706_100004202
681 Ga0070706_100017424
682 Ga0070706_100022670
683 Ga0070706_100052226
684 Ga0070706_100102914
685 Ga0070706_100142610
686 Ga0070707_100007093
687 Ga0070707_100007695
688 Ga0070707_100008529
689 Ga0070707_100011962
690 Ga0070707_100090105
691 Ga0070707_100209030
692 Ga0070707_100526955
693 Ga0070698_100009798
694 Ga0070698_100015241
695 Ga0070698_100015906
696 Ga0070698_100019196
697 Ga0070698_100062231
698 Ga0070698_100087259
699 Ga0070698_100136882
700 Ga0070698_100160709
701 Ga0070698_100241526
702 Ga0070698_100582581
703 Ga0070699_100000451
704 Ga0070699_100044991
705 Ga0070699_100046101
706 Ga0070699_100047434
707 Ga0070699_100075221
708 Ga0070699_100123171
709 Ga0070699_100135490
710 Ga0070699_100141883
711 Ga0070699_100164447
712 Ga0070699_100279031
713 Ga0070699_100529227
714 Ga0070679_100001088
715 Ga0070679_100112296
716 Ga0070684_100060742
717 Ga0070697_100005220
718 Ga0070697_100005819
719 Ga0070697_100009120
720 Ga0070697_100025914
721 Ga0070697_100027748
722 Ga0070697_100062426
723 Ga0070697_100099151
724 Ga0070697_100135723
725 Ga0068853_100001773
726 Ga0068853_100432155
727 Ga0070672_100016904
728 Ga0070672_100334733
729 Ga0070686_100285528
730 Ga0070695_100000773
731 Ga0070695_100003003
732 Ga0070695_100022956
733 Ga0070695_100029006
734 Ga0070695_100051249
735 Ga0070695_100057746
736 Ga0070695_100134894
737 Ga0070696_100003398
738 Ga0070696_100028096
739 Ga0070696_100092413
740 Ga0070696_100164230
741 Ga0070693_100000077
742 Ga0070693_100054458
743 Ga0070693_100230071
744 Ga0070704_100002730
745 Ga0070704_100011808
746 Ga0070704_100034747
747 Ga0068855_100012494
748 Ga0070664_100359308
749 Ga0068857_100077629
750 Ga0068857_100088735
751 Ga0068854_100126519
752 Ga0068856_100001162
753 Ga0070702_100013424
754 Ga0068859_100029275
755 Ga0068859_100046542
756 Ga0068859_100158150
757 Ga0068859_100561146
758 Ga0068864_100027654
759 Ga0068864_100171602
760 Ga0068866_10091065
761 Ga0068866_10092664
762 Ga0068861_100029167
763 Ga0068861_100760148
764 Ga0068851_10022727
765 Ga0068870_10000176
766 Ga0068863_100081333
767 Ga0068863_100139115
768 Ga0068863_100470142
769 Ga0068858_100033873
770 Ga0068858_100141156
771 Ga0068860_100024543
772 Ga0068860_100027528
773 Ga0068860_100153013
774 Ga0068860_100189029
775 Ga0068860_100353496
776 Ga0068860_100438307
777 Ga0068862_100007133
778 Ga0068862_100018101
779 Ga0068862_100031828
780 Ga0068862_100900369
781 Ga0081455_10001046
782 Ga0081538_10045113
783 Ga0081540_1052640
784 Ga0075432_10040547
785 Ga0070715_10101547
786 Ga0070716_100007237
787 Ga0070712_100002336
788 Ga0075428_100000367
789 Ga0075428_100170785
790 Ga0075428_100483630
791 Ga0075428_100543628
792 Ga0075428_101086963
793 Ga0075430_100000036
794 Ga0075430_100002234
795 Ga0075430_100100063
796 Ga0075430_100146711
797 Ga0075431_100000370
798 Ga0075431_100008603
799 Ga0075431_100009289
800 Ga0075431_100068951
801 Ga0075431_100134840
802 Ga0075431_100171244
803 Ga0075431_100562303
804 Ga0075433_10000826
805 Ga0075433_10002293
806 Ga0075433_10003279
807 Ga0075433_10028162
808 Ga0075433_10036013
809 Ga0075433_10071839
810 Ga0075433_10080618
811 Ga0075433_10184209
812 Ga0075434_100000463
813 Ga0075434_100008131
814 Ga0075434_100028275
815 Ga0075434_100043720
816 Ga0075434_100060425
817 Ga0075434_100076456
818 Ga0075434_100118923
819 Ga0075434_100120171
820 Ga0075434_100147900
821 Ga0075434_100326726
822 Ga0075434_100397839
823 Ga0075434_100469865
824 Ga0075429_100000001
825 Ga0075429_100005966
826 Ga0075429_100015623
827 Ga0075429_100017792
828 Ga0075429_100041160
829 Ga0075429_100096419
830 Ga0068865_100660689
831 Ga0075436_100046811
832 Ga0075436_100139570
833 Ga0075436_100318854
834 Ga0075436_100411065
835 Ga0097620_100029278
836 Ga0097620_100046541
837 Ga0097620_100158154
838 Ga0097620_100561156
839 Ga0075435_100004683
840 Ga0075435_100012041
841 Ga0075435_100018067
842 Ga0075435_100043070
843 Ga0075435_100062750
844 Ga0075435_100094075
845 Ga0099794_10011527
846 Ga0099794_10020881
847 Ga0099794_10165767
848 Ga0099794_10221634
849 Ga0111539_10002135
850 Ga0111539_10004822
851 Ga0111539_10041373
852 Ga0111539_10048850
853 Ga0111539_10140287
854 Ga0105245_10044329
855 Ga0105245_10598425
856 Ga0105247_10035909
857 Ga0114129_10007686
858 Ga0114129_10008853
859 Ga0114129_10018531
860 Ga0114129_10019523
861 Ga0114129_10025650
862 Ga0114129_10066229
863 Ga0114129_10074019
864 Ga0114129_10130966
865 Ga0114129_10178540
866 Ga0114129_10409230
867 Ga0114129_10414380
868 Ga0114129_10454778
869 Ga0105243_10006276
870 Ga0105241_10000054
871 Ga0105241_10246079
872 Ga0105241_10448001
873 Ga0105241_10786676
874 Ga0105242_10044087
875 Ga0105242_10165298
876 Ga0105242_10447853
877 Ga0105248_10171347
878 Ga0105249_10058052
879 Ga0105249_10064956
880 Ga0105249_10321343
881 Ga0157373_10000475
882 Ga0157371_10208471
883 Ga0157370_10122188
884 Ga0157378_10671690
885 Ga0157378_10820135
886 Ga0163162_10032345
887 Ga0163162_10654494
888 Ga0157372_10000420
889 Ga0157372_10560618
890 Ga0157375_10029085
891 Ga0157375_10224121
892 Ga0157375_10449168
893 Ga0163163_10016568
894 Ga0157380_10461750
895 Ga0157380_10814742
896 Ga0157379_10171887
897 Ga0157379_10302096
898 Ga0163161_10185894
899 Ga0206350_11330308
900 Ga0224712_10009291
901 Ga0224712_10234120
902 Ga0207653_10001345
903 Ga0207653_10003775
904 Ga0207642_10065024
905 Ga0207688_10040882
906 Ga0207680_10059445
907 Ga0207699_10022687
908 Ga0207645_10000589
909 Ga0207643_10000014
910 Ga0207684_10002192
911 Ga0207684_10008566
912 Ga0207684_10035152
913 Ga0207684_10130350
914 Ga0207684_10267175
915 Ga0207654_10001801
916 Ga0207707_10000138
917 Ga0207693_10018409
918 Ga0207660_10004489
919 Ga0207660_10066412
920 Ga0207662_10033894
921 Ga0207657_10000135
922 Ga0207649_10015242
923 Ga0207652_10001153
924 Ga0207652_10269647
925 Ga0207646_10003384
926 Ga0207646_10014999
927 Ga0207646_10016023
928 Ga0207646_10016096
929 Ga0207646_10020112
930 Ga0207646_10032684
931 Ga0207646_10045475
932 Ga0207646_10065967
933 Ga0207646_10206364
934 Ga0207646_10584595
935 Ga0207681_10038355
936 Ga0207681_10281326
937 Ga0207681_10352399
938 Ga0207681_10365331
939 Ga0207650_10018963
940 Ga0207687_10024290
941 Ga0207644_10199984
942 Ga0207690_10000884
943 Ga0207706_10029339
944 Ga0207706_10050454
945 Ga0207686_10149295
946 Ga0207686_10220950
947 Ga0207709_10018469
948 Ga0207709_10071812
949 Ga0207670_10069625
950 Ga0207670_10115221
951 Ga0207665_10002823
952 Ga0207691_10028455
953 Ga0207691_10192363
954 Ga0207711_10116608
955 Ga0207711_10177007
956 Ga0207689_10000340
957 Ga0207689_10042129
958 Ga0207679_10000492
959 Ga0207667_10002330
960 Ga0207651_10017408
961 Ga0207712_10007920
962 Ga0207712_10030502
963 Ga0207712_10154624
964 Ga0207640_10144963
965 Ga0207640_10375655
966 Ga0207658_10089871
967 Ga0207677_10085409
968 Ga0207703_10082351
969 Ga0207639_10001574
970 Ga0207678_10005156
971 Ga0207702_10048175
972 Ga0207641_10212641
973 Ga0207641_10480606
974 Ga0207648_10000374
975 Ga0207648_10164424
976 Ga0207648_10224532
977 Ga0207648_10866642
978 Ga0207676_10007758
979 Ga0207674_10000684
980 Ga0207674_10053858
981 Ga0207675_100006969
982 Ga0207675_100066607
983 Ga0207675_100087322
984 Ga0209969_1003922
985 Ga0209981_1004560
986 Ga0209996_1000947
987 Ga0210000_1006493
988 Ga0209995_1001163
989 Ga0209968_1000646
990 Ga0209999_1002573
991 Ga0209982_1006522
992 Ga0209588_1074045
993 Ga0209971_1000010
994 Ga0209966_1000110
995 Ga0209998_10000565
996 Ga0209974_10011504
997 Ga0207428_10000018
998 Ga0207428_10000119
999 Ga0207428_10017026
1000 Ga0268265_10014060
1001 Ga0268265_10015715
1002 Ga0268265_10220367
1003 Ga0268264_10032696
1004 Ga0268264_10128987
1005 Ga0307408_100119335
1006 Ga0316578_10152539
1007 Ga0307405_10042795
1008 Ga0307410_10054214
1009 Ga0307412_10160296
1010 Ga0307409_100131633
1011 Ga0307416_100053356
1012 Ga0307411_10343336
1013 Ga0316596_1057154
1014 Ga0373948_0010050
1015 Ga0373948_0059409
1016 Ga0373948_0072655
1017 Ga0373950_0032521
1018 Ga0373959_0009890
1019 Ga0373940_0111357
1020 Ga0373949_0048099
1021 Ga0373951_0007951
1022 Ga0373932_0161569
1023 Ga0373939_0052625
1024 Ga0373962_0075106
1025 Ga0316574_0010275
1026 Ga0373931_0076726
1027 Ga0373931_0502202
1028 Ga0316584_0203616
1029 Ga0395899_0069530
1030 Ga0395900_0007315
1031 Ga0395898_0007991
1032 Ga0395901_0001940
1033 Ga0395901_0947500
1034 Ga0242420_008327
1035 Ga0439450_009874
1036 Ga0439458_0033762
1037 Ga0439459_0001802
1038 Ga0439464_0000744
1039 Ga0439464_0025599
1040 Ga0451577_0000878
1041 Ga0451577_0028184
1042 Ga0451577_0038148
1043 Ga0451577_0049382
1044 Ga0451577_0143179
1045 Ga0451577_0840445
1046 Ga0439440_0057801
1047 Ga0466969_0083086
1048 Ga0453683_0037873
1049 Ga0453683_0046023
1050 Ga0453683_0079947
1051 Ga0453683_0106243
1052 Ga0453684_0012709
1053 Ga0453684_0215309
1054 Ga0453684_0226606
1055 Ga0453684_0738472
1056 Ga0451576_0015692
1057 Ga0451576_0019012
1058 Ga0451576_0041522
1059 Ga0451576_0043460
1060 Ga0451576_0061029
1061 Ga0451576_0069835
1062 Ga0451576_0082041
1063 Ga0451576_0091794
1064 Ga0451576_0342465
1065 Ga0451576_0618609
1066 Ga0451576_0762182
1067 Ga0495603_0022467
1068 Ga0495580_0021426
1069 Ga0495642_0014060
1070 Ga0495659_0040755
1071 Ga0495669_0072944
1072 Ga0495636_0092391
1073 Ga0496102_0035113
1074 Ga0496102_0666917
1075 Ga0496106_0085923
1076 Ga0496106_0094228
1077 Ga0496106_0410586
1078 Ga0496107_0095529
1079 Ga0496115_0001155
1080 Ga0501032_0148239
1081 Ga0501033_0031253
1082 Ga0501033_0299833
1083 Ga0501036_0092066
1084 Ga0501036_0119661
1085 Ga0501036_0313948
1086 Ga0501036_0445280
1087 Ga0501038_0130801
1088 Ga0501039_0022257
1089 Ga0501039_0184038
1090 Ga0501040_0001245
1091 Ga0501040_0013316
1092 Ga0501040_0139421
1093 Ga0501040_0140872
1094 Ga0501040_0289471
1095 Ga0501041_0017337
1096 Ga0501041_0288963
1097 Ga0501042_0001856
1098 Ga0501042_0388475
1099 Ga0501043_0065968
1100 Ga0501046_0000340
1101 Ga0501047_0030263
1102 Ga0501048_0016182
1103 Ga0501048_0130156
1104 Ga0501048_0560674
1105 Ga0501067_0299284
1106 Ga0501068_0073474
1107 Ga0501068_0137084
1108 Ga0501069_0180493
1109 Ga0501071_0030800
1110 Ga0501072_0079754
1111 Ga0501072_0108661
1112 Ga0501072_0116304
1113 Ga0501072_0189765
1114 Ga0501072_0582813
1115 Ga0501073_0366498
1116 Ga0501074_0002344
1117 Ga0501074_0195774
1118 Ga0501075_0009602
1119 Ga0501075_0058071
1120 Ga0501075_0330210
1121 Ga0501075_0635082
1122 Ga0501076_0000873
1123 Ga0501077_0024356
1124 Ga0501077_0030175
1125 Ga0501079_0005909
1126 Ga0501079_0076980
1127 Ga0501079_0089628
1128 Ga0501079_0552179
1129 Ga0501080_0049341
1130 Ga0501081_0066887
1131 Ga0501081_0110339
1132 Ga0501081_0143473
1133 Ga0501081_0262008
1134 Ga0501083_0007233
1135 Ga0501083_0206192
1136 Ga0501035_0530607
1137 Ga0501045_0000589
1138 Ga0501045_0092393
1139 Ga0501045_0133072
1140 Ga0501045_0335381
1141 nmdc:mga05p37_107205_c1
1142 nmdc:mga05p37_108908_c1
1143 nmdc:mga05p37_133708_c1
1144 nmdc:mga05p37_195046_c1
1145 nmdc:mga05p37_21253_c1
1146 nmdc:mga05p37_316868_c1
1147 nmdc:mga05p37_409666_c1
1148 nmdc:mga05p37_47871_c1
1149 nmdc:mga05p37_49958_c1
1150 nmdc:mga05p37_5956_c1
1151 nmdc:mga05p37_6886_c1
1152 nmdc:mga05p37_75873_c1
1153 nmdc:mga05p37_75916_c1
1154 nmdc:mga05p37_80081_c1
1155 nmdc:mga05p37_82884_c1
1156 nmdc:mga05p37_86612_c1
1157 nmdc:mga09592_13050_c1
1158 nmdc:mga09592_156868_c1
1159 nmdc:mga09592_185057_c1
1160 nmdc:mga09592_3438_c1
1161 nmdc:mga09592_34540_c1
1162 nmdc:mga09592_499978_c1
1163 nmdc:mga09592_666552_c1
1164 nmdc:mga09592_66_c1
1165 nmdc:mga0qj67_15426_c1
1166 nmdc:mga0qj67_1693_c1
1167 nmdc:mga06r32_103558_c1
1168 nmdc:mga06r32_104949_c1
1169 nmdc:mga06r32_1336_c1
1170 nmdc:mga06r32_388986_c1
1171 nmdc:mga06r32_6869_c1
1172 nmdc:mga06r32_862258_c1
1173 nmdc:mga08y16_16700_c1
1174 nmdc:mga08y16_19457_c1
1175 nmdc:mga08y16_282_c1
1176 nmdc:mga08y16_35166_c1
1177 nmdc:mga0n895_190392_c1
1178 nmdc:mga0n895_22719_c1
1179 nmdc:mga0n895_26864_c1
1180 nmdc:mga0n895_29166_c1
1181 nmdc:mga0n895_33354_c1
1182 nmdc:mga0n895_366038_c1
1183 nmdc:mga0n895_378903_c1
1184 nmdc:mga0n895_43479_c1
1185 nmdc:mga0n895_4365_c1
1186 nmdc:mga0n895_462317_c1
1187 nmdc:mga0n895_73279_c1
1188 nmdc:mga0n895_87824_c1
1189 nmdc:mga0n895_93488_c1
1190 nmdc:mga0rr50_10860_c1
1191 nmdc:mga0rr50_113087_c1
1192 nmdc:mga0rr50_16594_c1
1193 nmdc:mga0rr50_183837_c1
1194 nmdc:mga0rr50_246629_c1
1195 nmdc:mga0rr50_338532_c1
1196 nmdc:mga0rr50_5747_c1
1197 nmdc:mga0rr50_66680_c1
1198 nmdc:mga08x19_398484_c1
1199 nmdc:mga08x19_42326_c1
1200 nmdc:mga08x19_4288_c1
1201 nmdc:mga08x19_92259_c1
1202 nmdc:mga0a205_109287_c1
1203 nmdc:mga0a205_120937_c1
1204 nmdc:mga0a205_1303_c1
1205 nmdc:mga0a205_2047_c1
1206 nmdc:mga0a205_210454_c1
1207 nmdc:mga0a205_303820_c1
1208 nmdc:mga0a205_3065_c1
1209 nmdc:mga0a205_424723_c1
1210 nmdc:mga0a205_519_c1
1211 nmdc:mga0a205_66440_c1
1212 nmdc:mga0a205_84451_c1
1213 Ga0501084_0001155
1214 Ga0501084_0016260
1215 Ga0501084_0091174
1216 Ga0501084_0131293
1217 Ga0501082_0005582
1218 Ga0501082_0010644
1219 Ga0501082_0030459
1220 Ga0501082_0295333
1221 Ga0501082_0304200
1222 Ga0530510_0007086
1223 Ga0530510_0007974
1224 Ga0530510_0038421
1225 Ga0530510_0282757
1226 Ga0530510_0458254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

52

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9346 10 233
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9195 3 234
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9085 2 234
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.9013 7 233
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.8971 3 234
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9123 3 234 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9038 7 233 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8903 3 234 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8873 9 231 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8717 9 231 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A2V7CDQ6-F1-model_v4 PIG-L family deacetylase 0.9777 15 237 GO:0016811
AF-A0A2V6W9D8-F1-model_v4 PIG-L family deacetylase 0.9765 100 236
AF-A0A2V6X6Y4-F1-model_v4 Amidohydrolase 0.9704 140 237
AF-A0A2V7CDQ6-F1-model_v4 PIG-L family deacetylase 0.9691 15 237 GO:0016811
AF-A0A6I2YJT6-F1-model_v4 PIG-L family deacetylase 0.9688 8 234 GO:0016137
GO:0016811

Map