F469143

General Info

Members Datasets Scaffolds Average Seq Length
612 320 1225 111

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10000597|Ga0157375_1000059725
Length 131
Sequence MIRIDTIWLATEPMDMRAGTETALARVVAVFGAAKPHRAYLFANRRANRMKVLVHDGVGIWLAARRLNQGRFFWPGVRHGSEVELDVEQLQALVLGLPWQRVGSGGAITVLYLVCNGALASAISPSVYRRH

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
63 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
132 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
137 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
138 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
139 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
144 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
164 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
165 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
171 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
172 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
288 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
289 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
290 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
291 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
292 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
293 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
294 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
295 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
296 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
297 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
298 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
299 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
300 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
301 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
302 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
303 2818991446 Variovorax sp. 1180 Isolate Unclassified
304 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
305 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
306 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
307 2842733646 Variovorax sp. R-72446 Isolate Unclassified
308 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
309 2885198086 Variovorax sp. 679 Isolate Unclassified
310 2885211737 Variovorax sp. 553 Isolate Unclassified
311 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
312 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
313 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
314 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
315 2928051484 Variovorax sp. 1133 Isolate Unclassified
316 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
317 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
318 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
319 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
320 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 1.31
Rhizoplane 2.45
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10000597 3300013308 Bacteria 32113
2 MRS2a_Contig_13479 2124908027 Bacteria 565
3 MRS2a_Contig_18223 2124908027 Bacteria 1642
4 MRS2a_Contig_7367 2124908027 Bacteria 3968
5 LJQas_1036372 3300000549 Bacteria 580
6 JGI25159J45721_1005199 3300002987 Bacteria 4120
7 rootH1_10011074 3300003316 Bacteria 16023
8 rootH1_10011074 3300003323 Bacteria 5334
9 rootH1_10066180 3300003316 Bacteria 2101
10 rootH2_10023488 3300003320 Bacteria 2642
11 rootL2_10018921 3300003322 Bacteria 58132
12 rootH1_10003051 3300003323 Bacteria 4171
13 Ga0055532_1009973 3300003758 Bacteria 1144
14 Ga0055527_1009648 3300003760 Bacteria 1129
15 Ga0055535_1000790 3300003761 Bacteria 23053
16 Ga0055542_1000091 3300003762 Bacteria 121973
17 Ga0055536_1023893 3300003781 Bacteria 1785
18 Ga0055534_1002178 3300003784 Bacteria 6994
19 Ga0055534_1053848 3300003784 Bacteria 568
20 Ga0055531_10080365 3300003794 Bacteria 720
21 Ga0065714_10001798 3300005288 Bacteria 1264
22 Ga0065714_10003325 3300005288 Bacteria 8181
23 Ga0065714_10013118 3300005288 Bacteria 2787
24 Ga0065714_10013605 3300005288 Bacteria 2792
25 Ga0065714_10013744 3300005288 Bacteria 1864
26 Ga0065714_10026255 3300005288 Bacteria 2256
27 Ga0065714_10064889 3300005288 Bacteria 16017
28 Ga0065714_10066487 3300005288 Bacteria 6764
29 Ga0065714_10071075 3300005288 Bacteria 3678
30 Ga0065714_10087087 3300005288 Bacteria 2074
31 Ga0070690_100067249 3300005330 Bacteria 2321
32 Ga0070670_100000189 3300005331 Bacteria 56435
33 Ga0070670_100101849 3300005331 Bacteria 2473
34 Ga0070677_10119522 3300005333 Bacteria 1188
35 Ga0068868_100620272 3300005338 Bacteria 960
36 Ga0070689_100719381 3300005340 Bacteria 873
37 Ga0070661_100043294 3300005344 Bacteria 3288
38 Ga0070668_100667381 3300005347 Bacteria 914
39 Ga0070669_100124186 3300005353 Bacteria 1973
40 Ga0070675_100046838 3300005354 Bacteria 3542
41 Ga0070671_100188363 3300005355 Bacteria 1748
42 Ga0070671_100205919 3300005355 Bacteria 1668
43 Ga0070674_100236762 3300005356 Bacteria 1427
44 Ga0070673_100059424 3300005364 Bacteria 3026
45 Ga0070673_101657039 3300005364 Bacteria 605
46 Ga0070659_100025843 3300005366 Bacteria 4516
47 Ga0070667_100088857 3300005367 Bacteria 2654
48 Ga0070667_100343671 3300005367 Bacteria 1350
49 Ga0070667_100896901 3300005367 Bacteria 825
50 Ga0070701_10643696 3300005438 Bacteria 707
51 Ga0070700_100217311 3300005441 Bacteria 1352
52 Ga0070678_100054524 3300005456 Bacteria 2914
53 Ga0068867_100048300 3300005459 Bacteria 3130
54 Ga0068867_100081022 3300005459 Bacteria 2446
55 Ga0070672_100089493 3300005543 Bacteria 2480
56 Ga0070672_100490357 3300005543 Bacteria 1062
57 Ga0070665_100147796 3300005548 Bacteria 2353
58 Ga0070665_101111582 3300005548 Bacteria 802
59 Ga0070664_100000598 3300005564 Bacteria 27576
60 Ga0070664_100845418 3300005564 Bacteria 857
61 Ga0068852_100127320 3300005616 Bacteria 2341
62 Ga0068859_100347118 3300005617 Bacteria 1579
63 Ga0068866_11228327 3300005718 Bacteria 542
64 Ga0068851_10060960 3300005834 Bacteria 1933
65 Ga0068870_10113232 3300005840 Bacteria 1552
66 Ga0075364_10047541 3300006051 Bacteria 2795
67 Ga0075432_10005376 3300006058 Bacteria 4366
68 Ga0075432_10006043 3300006058 Bacteria 4119
69 Ga0075432_10013656 3300006058 Bacteria 2759
70 Ga0075432_10039514 3300006058 Bacteria 1646
71 Ga0075432_10129711 3300006058 Bacteria 954
72 Ga0075362_10089114 3300006177 Bacteria 1430
73 Ga0075369_10366040 3300006186 Bacteria 677
74 Ga0075366_10923990 3300006195 Bacteria 544
75 Ga0097621_100077493 3300006237 Bacteria 2759
76 Ga0075370_10521198 3300006353 Bacteria 718
77 Ga0068871_100052041 3300006358 Bacteria 3316
78 Ga0068865_101315686 3300006881 Bacteria 643
79 Ga0075436_100018461 3300006914 Bacteria 4775
80 Ga0075436_100052077 3300006914 Bacteria 2825
81 Ga0097620_100347157 3300006931 Bacteria 1579
82 Ga0099823_1000097 3300006944 Bacteria 42542
83 Ga0099823_1001821 3300006944 Bacteria 18430
84 Ga0105251_10001977 3300009011 Bacteria 16738
85 Ga0105251_10016814 3300009011 Bacteria 3938
86 Ga0105251_10037146 3300009011 Bacteria 2392
87 Ga0105251_10100774 3300009011 Bacteria 1320
88 Ga0105244_10000449 3300009036 Bacteria 37516
89 Ga0105244_10005665 3300009036 Bacteria 8248
90 Ga0105244_10029239 3300009036 Bacteria 2947
91 Ga0105244_10174359 3300009036 Bacteria 1022
92 Ga0105244_10236340 3300009036 Bacteria 854
93 Ga0105250_10016491 3300009092 Bacteria 3008
94 Ga0105240_10963470 3300009093 Bacteria 914
95 Ga0105247_10359865 3300009101 Bacteria 1026
96 Ga0105243_10487308 3300009148 Bacteria 1165
97 Ga0105237_12327660 3300009545 Bacteria 546
98 Ga0105237_12557483 3300009545 Bacteria 521
99 Ga0105148_112809 3300009978 Bacteria 652
100 Ga0105033_100642 3300009986 Bacteria 2706
101 Ga0157371_10001143 3300013102 Bacteria 28586
102 Ga0157371_10115502 3300013102 Bacteria 1906
103 Ga0157371_10506651 3300013102 Bacteria 892
104 Ga0157374_10440849 3300013296 Bacteria 1303
105 Ga0157372_11412231 3300013307 Bacteria 802
106 Ga0157375_10120187 3300013308 Bacteria 2736
107 Ga0157375_10126170 3300013308 Bacteria 2674
108 Ga0157375_10384447 3300013308 Bacteria 1570
109 Ga0182008_10000136 3300014497 Bacteria 55863
110 Ga0182008_10001486 3300014497 Bacteria 15652
111 Ga0182008_10002762 3300014497 Bacteria 10883
112 Ga0182008_10023337 3300014497 Bacteria 3160
113 Ga0182008_10063313 3300014497 Bacteria 1822
114 Ga0182008_10063792 3300014497 Bacteria 1814
115 Ga0182008_10162511 3300014497 Bacteria 1124
116 Ga0182008_10207993 3300014497 Bacteria 997
117 Ga0157376_11534291 3300014969 Bacteria 699
118 Ga0182006_1000879 3300015261 Bacteria 20208
119 Ga0182006_1001031 3300015261 Bacteria 18153
120 Ga0182006_1058680 3300015261 Bacteria 1459
121 Ga0182007_10000071 3300015262 Bacteria 81966
122 Ga0182007_10000982 3300015262 Bacteria 15642
123 Ga0182007_10000990 3300015262 Bacteria 15586
124 Ga0182007_10011978 3300015262 Bacteria 3351
125 Ga0182007_10080021 3300015262 Bacteria 1072
126 Ga0182007_10083347 3300015262 Bacteria 1050
127 Ga0182005_1000329 3300015265 Bacteria 28096
128 Ga0182005_1004500 3300015265 Bacteria 4495
129 Ga0182005_1005252 3300015265 Bacteria 4065
130 Ga0182005_1006439 3300015265 Bacteria 3589
131 Ga0182005_1008290 3300015265 Bacteria 3068
132 Ga0163161_10000506 3300017792 Bacteria 31825
133 Ga0163161_10000829 3300017792 Bacteria 24170
134 Ga0163161_10001068 3300017792 Bacteria 20766
135 Ga0163161_10059794 3300017792 Bacteria 2772
136 Ga0163161_10150328 3300017792 Bacteria 1769
137 Ga0163161_10346503 3300017792 Bacteria 1180
138 Ga0213872_10009178 3300021361 Bacteria 4753
139 Ga0209672_100855 3300025228 Bacteria 13973
140 Ga0209147_100347 3300025229 Bacteria 33903
141 Ga0209258_100143 3300025242 Bacteria 165551
142 Ga0209148_1000007 3300025254 Bacteria 1592273
143 Ga0209129_1019628 3300025258 Bacteria 1273
144 Ga0209130_1003889 3300025284 Bacteria 6009
145 Ga0209675_1001416 3300025291 Bacteria 13860
146 Ga0209675_1005457 3300025291 Bacteria 5317
147 Ga0209676_1007247 3300025292 Bacteria 5263
148 Ga0209025_1044815 3300025294 Bacteria 1843
149 Ga0209050_1017152 3300025298 Bacteria 2908
150 Ga0209257_1004544 3300025304 Bacteria 10626
151 Ga0209257_1007003 3300025304 Bacteria 6995
152 Ga0207656_10109054 3300025321 Bacteria 1277
153 Ga0207696_1012434 3300025711 Bacteria 3008
154 Ga0207655_1000070 3300025728 Bacteria 239196
155 Ga0207655_1014888 3300025728 Bacteria 4359
156 Ga0207655_1125828 3300025728 Bacteria 842
157 Ga0207713_1000626 3300025735 Bacteria 34700
158 Ga0207713_1023749 3300025735 Bacteria 2877
159 Ga0207713_1121159 3300025735 Bacteria 877
160 Ga0207645_10107025 3300025907 Bacteria 1808
161 Ga0207643_10105925 3300025908 Bacteria 1652
162 Ga0207705_10740815 3300025909 Bacteria 763
163 Ga0207649_10000417 3300025920 Bacteria 31299
164 Ga0207681_10113778 3300025923 Bacteria 1973
165 Ga0207650_10000153 3300025925 Bacteria 82970
166 Ga0207650_10430663 3300025925 Bacteria 1095
167 Ga0207659_10477040 3300025926 Bacteria 1053
168 Ga0207644_10160084 3300025931 Bacteria 1749
169 Ga0207644_10285329 3300025931 Bacteria 1326
170 Ga0207690_10050781 3300025932 Bacteria 2770
171 Ga0207709_10423617 3300025935 Bacteria 1023
172 Ga0207669_10285758 3300025937 Bacteria 1246
173 Ga0207704_11153686 3300025938 Bacteria 660
174 Ga0207704_11531231 3300025938 Bacteria 572
175 Ga0207691_10103181 3300025940 Bacteria 2543
176 Ga0207691_10790618 3300025940 Bacteria 798
177 Ga0207679_10000200 3300025945 Bacteria 48169
178 Ga0207667_10804002 3300025949 Bacteria 937
179 Ga0207651_10047317 3300025960 Bacteria 2899
180 Ga0207651_10829472 3300025960 Bacteria 821
181 Ga0207668_10858827 3300025972 Bacteria 806
182 Ga0207640_10341355 3300025981 Bacteria 1200
183 Ga0207640_10376787 3300025981 Bacteria 1149
184 Ga0207658_10182644 3300025986 Bacteria 1737
185 Ga0207658_10654292 3300025986 Bacteria 947
186 Ga0207677_10354854 3300026023 Bacteria 1230
187 Ga0207708_10260984 3300026075 Bacteria 1398
188 Ga0207641_10200609 3300026088 Bacteria 1839
189 Ga0207648_10073756 3300026089 Bacteria 2974
190 Ga0207648_10104389 3300026089 Bacteria 2485
191 Ga0207683_10081775 3300026121 Bacteria 2867
192 Ga0207683_10538087 3300026121 Bacteria 1080
193 Ga0207698_10026798 3300026142 Bacteria 4082
194 Ga0209389_1000013 3300027296 Bacteria 208890
195 Ga0209389_1001063 3300027296 Bacteria 18438
196 Ga0207428_10006914 3300027907 Bacteria 10397
197 Ga0207428_10022983 3300027907 Bacteria 5251
198 Ga0207428_10078349 3300027907 Bacteria 2586
199 Ga0268266_10110025 3300028379 Bacteria 2440
200 Ga0268266_11012292 3300028379 Bacteria 804
201 Ga0268266_11428750 3300028379 Bacteria 667
202 Ga0268264_10831765 3300028381 Bacteria 924
203 Ga0265336_10000053 3300028666 Bacteria 113034
204 Ga0265324_10000132 3300029957 Bacteria 58866
205 Ga0316176_1054283 3300030732 Bacteria 705
206 Ga0316178_1140883 3300030735 Bacteria 596
207 Ga0307408_100232526 3300031548 Bacteria 1510
208 Ga0307408_100913906 3300031548 Bacteria 804
209 Ga0307514_10004005 3300031649 Bacteria 13731
210 Ga0307516_10422376 3300031730 Bacteria 991
211 Ga0307406_10009277 3300031901 Bacteria 5514
212 Ga0307412_10065117 3300031911 Bacteria 2465
213 Ga0307412_10289531 3300031911 Bacteria 1289
214 Ga0307414_10786209 3300032004 Bacteria 867
215 Ga0307414_10900582 3300032004 Bacteria 811
216 Ga0307411_10144844 3300032005 Bacteria 1757
217 Ga0307510_10501277 3300033180 Bacteria 657
218 Ga0373948_0002905 3300034817 Bacteria 2584
219 Ga0373950_0087718 3300034818 Bacteria 657
220 Ga0373928_0004262 3300035084 Bacteria 2730
221 Ga0373932_0021035 3300035112 Bacteria 1718
222 Ga0373931_0037974 3300035691 Bacteria 2517
223 Ga0395901_0572297 3300038443 Bacteria 1142
224 Ga0400490_22953 3300038726 Bacteria 19337
225 Ga0400485_19312 3300038735 Bacteria 3106
226 Ga0400488_38723 3300038741 Bacteria 2022
227 Ga0400488_39784 3300038741 Bacteria 2087
228 Ga0400486_12901 3300038742 Bacteria 4474
229 Ga0400483_064281 3300039062 Bacteria 1371
230 Ga0400483_119403 3300039062 Bacteria 1479
231 Ga0400483_233370 3300039062 Bacteria 1377
232 Ga0436361_0256279 3300039447 Bacteria 4905
233 Ga0439436_0002699 3300041404 Bacteria 5357
234 Ga0439436_0110983 3300041404 Bacteria 765
235 Ga0439438_000022 3300041405 Bacteria 108022
236 Ga0439438_000285 3300041405 Bacteria 22724
237 Ga0439438_001466 3300041405 Bacteria 10395
238 Ga0439438_008009 3300041405 Bacteria 3554
239 Ga0439438_018379 3300041405 Bacteria 1992
240 Ga0439438_028171 3300041405 Bacteria 1512
241 Ga0439438_065748 3300041405 Bacteria 902
242 Ga0439447_000917 3300041407 Bacteria 10746
243 Ga0439447_012898 3300041407 Bacteria 2387
244 Ga0439447_030980 3300041407 Bacteria 1344
245 Ga0439447_035179 3300041407 Bacteria 1242
246 Ga0439447_102872 3300041407 Bacteria 655
247 Ga0439466_0000211 3300041411 Bacteria 22736
248 Ga0439466_0000519 3300041411 Bacteria 14548
249 Ga0439466_0008128 3300041411 Bacteria 3955
250 Ga0439466_0011682 3300041411 Bacteria 3244
251 Ga0439466_0018667 3300041411 Bacteria 2487
252 Ga0439466_0030634 3300041411 Bacteria 1843
253 Ga0439466_0031645 3300041411 Bacteria 1808
254 Ga0439466_0033972 3300041411 Bacteria 1730
255 Ga0439466_0052125 3300041411 Bacteria 1338
256 Ga0439465_0055132 3300041413 Bacteria 1308
257 Ga0439465_0353317 3300041413 Bacteria 555
258 Ga0451787_465771 3300041441 Bacteria 2012
259 Ga0451791_1379667 3300041451 Bacteria 741
260 Ga0451791_1837915 3300041451 Bacteria 1465
261 Ga0451793_0464016 3300041452 Bacteria 623
262 Ga0451793_0751250 3300041452 Unclassified 688
263 Ga0451798_0812633 3300041458 Bacteria 2424
264 Ga0451800_1332029 3300041459 Unclassified 2001
265 Ga0451802_0144739 3300041460 Bacteria 1395
266 Ga0451806_035333 3300041462 Bacteria 771
267 Ga0451807_0651459 3300041486 Bacteria 4489
268 Ga0451833_1145808 3300041491 Bacteria 1048
269 Ga0451841_0419266 3300041498 Bacteria 728
270 Ga0451851_0518536 3300041507 Bacteria 833
271 Ga0451843_1138578 3300041509 Bacteria 1890
272 Ga0451853_3898713 3300041512 Bacteria 767
273 Ga0439431_0000022 3300041997 Bacteria 24835
274 Ga0439432_000005 3300042006 Bacteria 103122
275 Ga0439432_000019 3300042006 Bacteria 60642
276 Ga0439432_000040 3300042006 Bacteria 40771
277 Ga0439432_017128 3300042006 Bacteria 2434
278 Ga0439432_149142 3300042006 Bacteria 686
279 Ga0439449_0131996 3300042007 Bacteria 929
280 Ga0439451_003207 3300042009 Bacteria 3324
281 Ga0439451_006753 3300042009 Bacteria 2346
282 Ga0439451_071922 3300042009 Bacteria 693
283 Ga0439452_001534 3300042010 Bacteria 9303
284 Ga0439452_015371 3300042010 Bacteria 2102
285 Ga0439456_000985 3300042013 Bacteria 5678
286 Ga0439456_002589 3300042013 Bacteria 3641
287 Ga0439456_004474 3300042013 Bacteria 2827
288 Ga0439456_034150 3300042013 Bacteria 1095
289 Ga0439462_0012502 3300042015 Bacteria 2169
290 Ga0439463_002911 3300042016 Bacteria 4342
291 Ga0450896_006894 3300042133 Bacteria 1563
292 Ga0450898_002829 3300042134 Bacteria 2440
293 Ga0450899_002643 3300042135 Bacteria 1935
294 Ga0450902_008131 3300042137 Bacteria 1633
295 Ga0450903_005806 3300042138 Bacteria 2060
296 Ga0439446_0001349 3300042156 Bacteria 5533
297 Ga0439446_0011517 3300042156 Bacteria 2402
298 Ga0439446_0015325 3300042156 Bacteria 2126
299 Ga0450909_002067 3300042185 Bacteria 2832
300 Ga0450909_080064 3300042185 Bacteria 528
301 Ga0439434_0003610 3300042435 Bacteria 4522
302 Ga0439434_0021483 3300042435 Bacteria 1939
303 Ga0451577_0000743 3300042876 Bacteria 50109
304 Ga0453684_0002107 3300044712 Bacteria 50213
305 Ga0466971_0376565 3300044719 Bacteria 689
306 Ga0466957_0333685 3300044842 Bacteria 1025
307 Ga0495617_000054 3300046452 Bacteria 102256
308 Ga0495617_000066 3300046452 Bacteria 92026
309 Ga0495617_000930 3300046452 Bacteria 13630
310 Ga0495617_069240 3300046452 Bacteria 1161
311 Ga0495617_076247 3300046452 Bacteria 1100
312 Ga0495617_077451 3300046452 Bacteria 1090
313 Ga0495617_090194 3300046452 Bacteria 1001
314 Ga0495627_000257 3300046453 Bacteria 54471
315 Ga0495627_020057 3300046453 Bacteria 2232
316 Ga0495627_051277 3300046453 Bacteria 1240
317 Ga0495603_0020933 3300046455 Bacteria 3960
318 Ga0495603_0065715 3300046455 Bacteria 2137
319 Ga0495603_0200077 3300046455 Bacteria 1154
320 Ga0495590_0012001 3300046457 Bacteria 3225
321 Ga0495590_0038015 3300046457 Bacteria 1677
322 Ga0495590_0039190 3300046457 Bacteria 1652
323 Ga0495590_0131154 3300046457 Bacteria 901
324 Ga0495591_003476 3300046458 Bacteria 8114
325 Ga0495591_006430 3300046458 Bacteria 5193
326 Ga0495591_029602 3300046458 Bacteria 1661
327 Ga0495591_089154 3300046458 Bacteria 776
328 Ga0495638_0000088 3300046460 Bacteria 152517
329 Ga0495638_0032433 3300046460 Bacteria 3348
330 Ga0495653_0000605 3300046463 Bacteria 27532
331 Ga0495650_0001073 3300046471 Bacteria 30193
332 Ga0495650_0018137 3300046471 Bacteria 3506
333 Ga0495650_0080635 3300046471 Bacteria 1255
334 Ga0495650_0122958 3300046471 Bacteria 953
335 Ga0495605_0000199 3300046474 Bacteria 74613
336 Ga0495605_0017367 3300046474 Bacteria 3877
337 Ga0495605_0025555 3300046474 Bacteria 3076
338 Ga0495605_0034412 3300046474 Bacteria 2565
339 Ga0495605_0042718 3300046474 Bacteria 2251
340 Ga0495605_0062548 3300046474 Bacteria 1778
341 Ga0495605_0080013 3300046474 Bacteria 1530
342 Ga0495605_0143940 3300046474 Bacteria 1067
343 Ga0495605_0267593 3300046474 Bacteria 728
344 Ga0495584_0000758 3300046491 Bacteria 21365
345 Ga0495584_0002746 3300046491 Bacteria 9855
346 Ga0495584_0005138 3300046491 Bacteria 6947
347 Ga0495584_0028333 3300046491 Bacteria 2837
348 Ga0495584_0224133 3300046491 Bacteria 955
349 Ga0495585_0204233 3300046492 Bacteria 1004
350 Ga0495594_0013633 3300046499 Bacteria 4247
351 Ga0495607_0001845 3300046501 Bacteria 18023
352 Ga0495607_0016494 3300046501 Bacteria 4765
353 Ga0495607_0030153 3300046501 Bacteria 3332
354 Ga0495607_0085585 3300046501 Bacteria 1721
355 Ga0495583_0086710 3300046506 Bacteria 1353
356 Ga0495610_0043897 3300046512 Bacteria 2223
357 Ga0495610_0044458 3300046512 Bacteria 2204
358 Ga0495610_0059358 3300046512 Bacteria 1826
359 Ga0495610_0081305 3300046512 Bacteria 1487
360 Ga0495610_0374022 3300046512 Bacteria 531
361 Ga0495616_0009052 3300046513 Bacteria 5846
362 Ga0495620_0001517 3300046515 Bacteria 13813
363 Ga0495620_0017467 3300046515 Bacteria 3575
364 Ga0495620_0050004 3300046515 Bacteria 1785
365 Ga0495620_0106226 3300046515 Bacteria 1115
366 Ga0495631_0000559 3300046518 Bacteria 24970
367 Ga0495631_0021617 3300046518 Bacteria 2995
368 Ga0495631_0085945 3300046518 Bacteria 1355
369 Ga0495632_0000128 3300046519 Bacteria 77316
370 Ga0495632_0000780 3300046519 Bacteria 28576
371 Ga0495632_0044337 3300046519 Bacteria 2220
372 Ga0495632_0103512 3300046519 Bacteria 1340
373 Ga0495637_0000395 3300046520 Bacteria 32319
374 Ga0495637_0011860 3300046520 Bacteria 4176
375 Ga0495637_0015377 3300046520 Bacteria 3588
376 Ga0495637_0034168 3300046520 Bacteria 2228
377 Ga0495637_0106216 3300046520 Bacteria 1092
378 Ga0495637_0121641 3300046520 Bacteria 1003
379 Ga0495643_0015445 3300046522 Bacteria 4511
380 Ga0495643_0081999 3300046522 Bacteria 1676
381 Ga0495643_0225822 3300046522 Bacteria 885
382 Ga0495643_0257276 3300046522 Bacteria 812
383 Ga0495644_0001265 3300046523 Bacteria 10377
384 Ga0495644_0077483 3300046523 Bacteria 1252
385 Ga0495648_0001941 3300046524 Bacteria 19703
386 Ga0495648_0002726 3300046524 Bacteria 15959
387 Ga0495648_0209446 3300046524 Bacteria 969
388 Ga0495648_0422421 3300046524 Bacteria 590
389 Ga0495663_0006609 3300046525 Bacteria 3198
390 Ga0495642_0136561 3300046528 Bacteria 1057
391 Ga0495642_0164324 3300046528 Bacteria 963
392 Ga0495654_0000075 3300046530 Bacteria 113720
393 Ga0495654_0000268 3300046530 Bacteria 47227
394 Ga0495654_0023287 3300046530 Bacteria 3207
395 Ga0495654_0026352 3300046530 Bacteria 2988
396 Ga0495654_0082321 3300046530 Bacteria 1506
397 Ga0495654_0158322 3300046530 Bacteria 996
398 Ga0495665_0217097 3300046531 Bacteria 989
399 Ga0495587_0031588 3300046536 Bacteria 3205
400 Ga0495609_0000221 3300046538 Bacteria 56297
401 Ga0495609_0020073 3300046538 Bacteria 3088
402 Ga0495609_0100191 3300046538 Bacteria 1256
403 Ga0495609_0146345 3300046538 Bacteria 1006
404 Ga0495621_0006264 3300046539 Bacteria 3462
405 Ga0495621_0259509 3300046539 Bacteria 711
406 Ga0495597_0001112 3300046542 Bacteria 20357
407 Ga0495597_0001394 3300046542 Bacteria 17465
408 Ga0495597_0003047 3300046542 Bacteria 10092
409 Ga0495597_0007478 3300046542 Bacteria 5544
410 Ga0495597_0015519 3300046542 Bacteria 3606
411 Ga0495597_0021650 3300046542 Bacteria 2987
412 Ga0495597_0224631 3300046542 Bacteria 744
413 Ga0495597_0376670 3300046542 Bacteria 542
414 Ga0495645_0145805 3300046543 Bacteria 1649
415 Ga0495645_0502739 3300046543 Bacteria 757
416 Ga0495622_0019843 3300046557 Bacteria 3129
417 Ga0495622_0031062 3300046557 Bacteria 2497
418 Ga0495622_0069294 3300046557 Bacteria 1628
419 Ga0495622_0084429 3300046557 Bacteria 1460
420 Ga0495633_0326907 3300046558 Bacteria 695
421 Ga0495656_0007104 3300046615 Bacteria 3949
422 Ga0495656_0205686 3300046615 Bacteria 978
423 Ga0495668_0042445 3300046616 Bacteria 2532
424 Ga0495668_0070909 3300046616 Bacteria 1915
425 Ga0495668_0311140 3300046616 Bacteria 864
426 Ga0495611_0001959 3300046648 Bacteria 9775
427 Ga0495625_0003263 3300046660 Bacteria 16397
428 Ga0495625_0044494 3300046660 Bacteria 3214
429 Ga0495625_0329265 3300046660 Bacteria 970
430 Ga0495659_0059778 3300046664 Bacteria 1405
431 Ga0495661_0030941 3300046665 Bacteria 3403
432 Ga0495661_0057408 3300046665 Bacteria 2324
433 Ga0495661_0249112 3300046665 Bacteria 907
434 Ga0495669_0161224 3300046684 Bacteria 1064
435 Ga0495669_0177063 3300046684 Bacteria 1015
436 Ga0495670_0098929 3300046691 Bacteria 1500
437 Ga0495670_0108434 3300046691 Bacteria 1435
438 Ga0495670_0117403 3300046691 Bacteria 1380
439 Ga0495671_0000646 3300046692 Bacteria 25342
440 Ga0495671_0014352 3300046692 Bacteria 4265
441 Ga0495671_0021685 3300046692 Bacteria 3371
442 Ga0495671_0032939 3300046692 Bacteria 2642
443 Ga0495671_0048554 3300046692 Bacteria 2117
444 Ga0495671_0048634 3300046692 Bacteria 2115
445 Ga0495671_0051005 3300046692 Bacteria 2059
446 Ga0495671_0188233 3300046692 Bacteria 1002
447 Ga0495671_0277060 3300046692 Bacteria 808
448 Ga0495671_0582861 3300046692 Bacteria 532
449 Ga0495649_0015375 3300046694 Bacteria 4357
450 Ga0495649_0086258 3300046694 Bacteria 1675
451 Ga0495649_0087560 3300046694 Bacteria 1662
452 Ga0495649_0097169 3300046694 Bacteria 1567
453 Ga0495589_0053471 3300046794 Bacteria 1992
454 Ga0495589_0119008 3300046794 Bacteria 1272
455 Ga0495589_0176469 3300046794 Bacteria 1014
456 Ga0495600_0418284 3300046809 Bacteria 832
457 Ga0495660_0002628 3300046810 Bacteria 11416
458 Ga0495660_0004196 3300046810 Bacteria 8758
459 Ga0495660_0005857 3300046810 Bacteria 7332
460 Ga0495660_0019026 3300046810 Bacteria 3943
461 Ga0495660_0102161 3300046810 Bacteria 1474
462 Ga0495660_0125242 3300046810 Bacteria 1295
463 Ga0495660_0170979 3300046810 Bacteria 1058
464 Ga0495660_0186252 3300046810 Bacteria 1000
465 Ga0495581_0007532 3300047315 Bacteria 6295
466 Ga0495636_0014776 3300047318 Bacteria 3106
467 Ga0495636_0127401 3300047318 Bacteria 1130
468 Ga0495672_0000639 3300047320 Bacteria 38948
469 Ga0495672_0006323 3300047320 Bacteria 9205
470 Ga0495672_0034939 3300047320 Bacteria 3100
471 Ga0495672_0099140 3300047320 Bacteria 1584
472 Ga0495672_0144894 3300047320 Bacteria 1237
473 Ga0495672_0197894 3300047320 Bacteria 1006
474 Ga0495676_0085415 3300047321 Bacteria 2377
475 Ga0495680_0069602 3300047322 Bacteria 2684
476 Ga0495680_0337536 3300047322 Bacteria 1052
477 Ga0495683_0028208 3300047323 Bacteria 2870
478 Ga0495683_0169192 3300047323 Bacteria 1005
479 Ga0495687_004519 3300047443 Bacteria 9345
480 Ga0495675_0002646 3300047444 Bacteria 10729
481 Ga0495677_0015509 3300047445 Bacteria 2768
482 Ga0495677_0128929 3300047445 Bacteria 967
483 Ga0495679_000053 3300047446 Bacteria 119015
484 Ga0495679_068705 3300047446 Bacteria 1024
485 Ga0495685_027089 3300047447 Bacteria 1971
486 Ga0495673_0000116 3300047469 Bacteria 154310
487 Ga0495673_0001747 3300047469 Bacteria 16569
488 Ga0495673_0012248 3300047469 Bacteria 4559
489 Ga0495673_0069810 3300047469 Bacteria 1481
490 Ga0495673_0110697 3300047469 Bacteria 1098
491 Ga0495681_0013329 3300047470 Bacteria 4777
492 Ga0495681_0019612 3300047470 Bacteria 3686
493 Ga0495681_0034872 3300047470 Bacteria 2502
494 Ga0495681_0079719 3300047470 Bacteria 1464
495 Ga0495686_0264103 3300047472 Bacteria 962
496 Ga0495686_0577664 3300047472 Bacteria 584
497 Ga0495593_0040891 3300047673 Bacteria 2494
498 Ga0495626_0000502 3300048091 Bacteria 39258
499 Ga0495626_0001773 3300048091 Bacteria 16400
500 Ga0495626_0030282 3300048091 Bacteria 2610
501 Ga0496108_0498331 3300048911 Bacteria 1064
502 Ga0496110_0352714 3300048913 Bacteria 1340
503 Ga0496110_0644026 3300048913 Bacteria 959
504 Ga0496116_0253724 3300048919 Bacteria 873
505 Ga0496117_0013428 3300048920 Bacteria 7148
506 Ga0496117_0298484 3300048920 Bacteria 854
507 Ga0496119_0028519 3300048922 Bacteria 3807
508 Ga0496120_0167989 3300048923 Bacteria 1087
509 Ga0496121_0001370 3300048924 Bacteria 41492
510 Ga0496121_0001552 3300048924 Bacteria 38440
511 Ga0496121_0005988 3300048924 Bacteria 15361
512 Ga0496121_0178422 3300048924 Bacteria 1536
513 Ga0496121_0373159 3300048924 Bacteria 943
514 Ga0496122_0001719 3300048925 Bacteria 33983
515 Ga0496122_0012764 3300048925 Bacteria 8313
516 Ga0496122_0075222 3300048925 Bacteria 2384
517 Ga0496122_0077415 3300048925 Bacteria 2335
518 Ga0496123_0000376 3300048926 Bacteria 83875
519 Ga0496123_0008645 3300048926 Bacteria 9311
520 Ga0496123_0047281 3300048926 Bacteria 2909
521 Ga0496123_0099985 3300048926 Bacteria 1691
522 Ga0496123_0362018 3300048926 Bacteria 671
523 Ga0496124_0303658 3300048927 Bacteria 1151
524 Ga0496125_0000216 3300048928 Bacteria 117897
525 Ga0496125_0033223 3300048928 Bacteria 4571
526 Ga0496125_0107596 3300048928 Bacteria 2031
527 Ga0496125_0212911 3300048928 Bacteria 1253
528 Ga0495678_018876 3300049459 Bacteria 3090
529 Ga0495678_100070 3300049459 Bacteria 1005
530 Ga0495678_103959 3300049459 Bacteria 980
531 Ga0495678_127827 3300049459 Bacteria 845
532 Ga0495682_0000632 3300049460 Bacteria 23528
533 Ga0495682_0026837 3300049460 Bacteria 2137
534 Ga0495682_0032640 3300049460 Bacteria 1923
535 Ga0495682_0064947 3300049460 Bacteria 1316
536 Ga0495682_0106190 3300049460 Bacteria 1006
537 Ga0501033_0672565 3300049570 Bacteria 706
538 Ga0501034_0166340 3300049571 Bacteria 2174
539 Ga0501034_0671705 3300049571 Bacteria 936
540 Ga0501039_0428258 3300049575 Bacteria 1039
541 Ga0501043_0426783 3300049579 Bacteria 999
542 Ga0501047_0058417 3300049581 Bacteria 3726
543 Ga0501222_001599 3300049662 Bacteria 3145
544 Ga0501279_006562 3300049775 Bacteria 1538
545 Ga0501282_041558 3300049778 Bacteria 550
546 Ga0501035_0086770 3300049822 Bacteria 2757
547 Ga0501044_0006781 3300049823 Bacteria 12624
548 nmdc:mga03683_45806_c1 3300050489 Bacteria 1811
549 nmdc:mga00v17_16744_c1 3300050491 Bacteria 4135
550 nmdc:mga0k408_182712_c1 3300050493 Bacteria 1251
551 nmdc:mga07m45_23205_c1 3300050496 Bacteria 3390
552 nmdc:mga07m45_344090_c1 3300050496 Bacteria 866
553 nmdc:mga07m45_482044_c1 3300050496 Bacteria 718
554 nmdc:mga08x19_54894_c1 3300050514 Bacteria 2566
555 nmdc:mga08x19_82148_c1 3300050514 Bacteria 2117
556 nmdc:mga08x19_86263_c1 3300050514 Bacteria 2067
557 nmdc:mga0sz30_334229_c1 3300050516 Bacteria 677
558 Ga0500610_0000205 3300053079 Bacteria 18114
559 Ga0500578_0080741 3300053086 Bacteria 2068
560 Ga0500644_0009065 3300053088 Bacteria 2650
561 Ga0500647_0115196 3300053091 Bacteria 1275
562 Ga0500566_0508339 3300053094 Bacteria 517
563 Ga0500572_033237 3300053111 Bacteria 1453
564 Ga0500592_007793 3300053116 Bacteria 1700
565 Ga0500594_0005632 3300053118 Bacteria 2780
566 Ga0500608_049902 3300053122 Bacteria 2012
567 Ga0500659_0010882 3300053135 Bacteria 4975
568 Ga0500568_0023595 3300053139 Bacteria 2615
569 Ga0500577_0069911 3300053142 Bacteria 1374
570 Ga0500586_030414 3300053145 Bacteria 1775
571 Ga0500616_0003164 3300053153 Bacteria 12828
572 Ga0500627_0102970 3300053158 Bacteria 1282
573 Ga0500634_0017944 3300053161 Bacteria 3794
574 Ga0500656_032497 3300053732 Bacteria 700
575 Ga0500596_004071 3300053735 Bacteria 2712
576 Ga0500661_011803 3300055283 Bacteria 1580
577 Ga0500661_023832 3300055283 Bacteria 1083
578 2511822783 2511231156 Bacteria 6845832
579 2511824261 2511231156 Bacteria 6845832
580 2511824859 2511231156 Bacteria 6845832
581 2511827186 2511231156 Bacteria 6845832
582 2527080969 2526164713 Bacteria 6780608
583 2587759947 2585428062 Bacteria 6842168
584 2597862730 2597489888 Bacteria 6179543
585 2600042942 2599185319 Bacteria 6637840
586 2601628812 2600255283 Bacteria 6061572
587 2621299873 2619619299 Bacteria 6649820
588 2644621595 2643221713 Bacteria 6554480
589 2677900879 2675903420 Bacteria 6247433
590 2738691357 2738541271 Bacteria 5657310
591 2739259194 2738543015 Bacteria 6750701
592 2739261419 2738543015 Bacteria 6750701
593 2739267132 2738543016 Bacteria 5657564
594 2819602708 2818991446 Bacteria 7757362
595 2842333019 2842324504 Bacteria 9364110
596 2842353256 2842348783 Bacteria 9002918
597 2842457697 2842454564 Bacteria 8730687
598 2842738071 2842733646 Bacteria 5716726
599 2842818269 2842815866 Bacteria 5947510
600 2885202146 2885198086 Bacteria 7212419
601 2885215797 2885211737 Bacteria 7212420
602 2908449550 2908446538 Bacteria 6829095
603 2919468046 2919462493 Bacteria 5817112
604 2919702674 2919697872 Bacteria 6553725
605 2923587732 2923586266 Bacteria 6565975
606 2928058623 2928051484 Bacteria 7773759
607 2945985876 2945984333 Bacteria 7358892
608 2945985921 2945984333 Bacteria 7358892
609 3007513927 3007511990 Bacteria 6481491
610 8018852315 8018845410 Bacteria 8933938
611 8019781024 8019775933 Bacteria 6858656
612 8019782330 8019775933 Bacteria 6858656
613 8056135258 8056131705 Bacteria 6107031
614 Ga0157375_10000597
615 MRS2a_Contig_13479
616 MRS2a_Contig_18223
617 MRS2a_Contig_7367
618 LJQas_1036372
619 JGI25159J45721_1005199
620 rootH1_10011074
621 rootH1_10066180
622 rootH2_10023488
623 rootL2_10018921
624 rootH1_10003051
625 Ga0055532_1009973
626 Ga0055527_1009648
627 Ga0055535_1000790
628 Ga0055542_1000091
629 Ga0055536_1023893
630 Ga0055534_1002178
631 Ga0055534_1053848
632 Ga0055531_10080365
633 Ga0065714_10001798
634 Ga0065714_10003325
635 Ga0065714_10013118
636 Ga0065714_10013605
637 Ga0065714_10013744
638 Ga0065714_10026255
639 Ga0065714_10064889
640 Ga0065714_10066487
641 Ga0065714_10071075
642 Ga0065714_10087087
643 Ga0070690_100067249
644 Ga0070670_100000189
645 Ga0070670_100101849
646 Ga0070677_10119522
647 Ga0068868_100620272
648 Ga0070689_100719381
649 Ga0070661_100043294
650 Ga0070668_100667381
651 Ga0070669_100124186
652 Ga0070675_100046838
653 Ga0070671_100188363
654 Ga0070671_100205919
655 Ga0070674_100236762
656 Ga0070673_100059424
657 Ga0070673_101657039
658 Ga0070659_100025843
659 Ga0070667_100088857
660 Ga0070667_100343671
661 Ga0070667_100896901
662 Ga0070701_10643696
663 Ga0070700_100217311
664 Ga0070678_100054524
665 Ga0068867_100048300
666 Ga0068867_100081022
667 Ga0070672_100089493
668 Ga0070672_100490357
669 Ga0070665_100147796
670 Ga0070665_101111582
671 Ga0070664_100000598
672 Ga0070664_100845418
673 Ga0068852_100127320
674 Ga0068859_100347118
675 Ga0068866_11228327
676 Ga0068851_10060960
677 Ga0068870_10113232
678 Ga0075364_10047541
679 Ga0075432_10005376
680 Ga0075432_10006043
681 Ga0075432_10013656
682 Ga0075432_10039514
683 Ga0075432_10129711
684 Ga0075362_10089114
685 Ga0075369_10366040
686 Ga0075366_10923990
687 Ga0097621_100077493
688 Ga0075370_10521198
689 Ga0068871_100052041
690 Ga0068865_101315686
691 Ga0075436_100018461
692 Ga0075436_100052077
693 Ga0097620_100347157
694 Ga0099823_1000097
695 Ga0099823_1001821
696 Ga0105251_10001977
697 Ga0105251_10016814
698 Ga0105251_10037146
699 Ga0105251_10100774
700 Ga0105244_10000449
701 Ga0105244_10005665
702 Ga0105244_10029239
703 Ga0105244_10174359
704 Ga0105244_10236340
705 Ga0105250_10016491
706 Ga0105240_10963470
707 Ga0105247_10359865
708 Ga0105243_10487308
709 Ga0105237_12327660
710 Ga0105237_12557483
711 Ga0105148_112809
712 Ga0105033_100642
713 Ga0157371_10001143
714 Ga0157371_10115502
715 Ga0157371_10506651
716 Ga0157374_10440849
717 Ga0157372_11412231
718 Ga0157375_10120187
719 Ga0157375_10126170
720 Ga0157375_10384447
721 Ga0182008_10000136
722 Ga0182008_10001486
723 Ga0182008_10002762
724 Ga0182008_10023337
725 Ga0182008_10063313
726 Ga0182008_10063792
727 Ga0182008_10162511
728 Ga0182008_10207993
729 Ga0157376_11534291
730 Ga0182006_1000879
731 Ga0182006_1001031
732 Ga0182006_1058680
733 Ga0182007_10000071
734 Ga0182007_10000982
735 Ga0182007_10000990
736 Ga0182007_10011978
737 Ga0182007_10080021
738 Ga0182007_10083347
739 Ga0182005_1000329
740 Ga0182005_1004500
741 Ga0182005_1005252
742 Ga0182005_1006439
743 Ga0182005_1008290
744 Ga0163161_10000506
745 Ga0163161_10000829
746 Ga0163161_10001068
747 Ga0163161_10059794
748 Ga0163161_10150328
749 Ga0163161_10346503
750 Ga0213872_10009178
751 Ga0209672_100855
752 Ga0209147_100347
753 Ga0209258_100143
754 Ga0209148_1000007
755 Ga0209129_1019628
756 Ga0209130_1003889
757 Ga0209675_1001416
758 Ga0209675_1005457
759 Ga0209676_1007247
760 Ga0209025_1044815
761 Ga0209050_1017152
762 Ga0209257_1004544
763 Ga0209257_1007003
764 Ga0207656_10109054
765 Ga0207696_1012434
766 Ga0207655_1000070
767 Ga0207655_1014888
768 Ga0207655_1125828
769 Ga0207713_1000626
770 Ga0207713_1023749
771 Ga0207713_1121159
772 Ga0207645_10107025
773 Ga0207643_10105925
774 Ga0207705_10740815
775 Ga0207649_10000417
776 Ga0207681_10113778
777 Ga0207650_10000153
778 Ga0207650_10430663
779 Ga0207659_10477040
780 Ga0207644_10160084
781 Ga0207644_10285329
782 Ga0207690_10050781
783 Ga0207709_10423617
784 Ga0207669_10285758
785 Ga0207704_11153686
786 Ga0207704_11531231
787 Ga0207691_10103181
788 Ga0207691_10790618
789 Ga0207679_10000200
790 Ga0207667_10804002
791 Ga0207651_10047317
792 Ga0207651_10829472
793 Ga0207668_10858827
794 Ga0207640_10341355
795 Ga0207640_10376787
796 Ga0207658_10182644
797 Ga0207658_10654292
798 Ga0207677_10354854
799 Ga0207708_10260984
800 Ga0207641_10200609
801 Ga0207648_10073756
802 Ga0207648_10104389
803 Ga0207683_10081775
804 Ga0207683_10538087
805 Ga0207698_10026798
806 Ga0209389_1000013
807 Ga0209389_1001063
808 Ga0207428_10006914
809 Ga0207428_10022983
810 Ga0207428_10078349
811 Ga0268266_10110025
812 Ga0268266_11012292
813 Ga0268266_11428750
814 Ga0268264_10831765
815 Ga0265336_10000053
816 Ga0265324_10000132
817 Ga0316176_1054283
818 Ga0316178_1140883
819 Ga0307408_100232526
820 Ga0307408_100913906
821 Ga0307514_10004005
822 Ga0307516_10422376
823 Ga0307406_10009277
824 Ga0307412_10065117
825 Ga0307412_10289531
826 Ga0307414_10786209
827 Ga0307414_10900582
828 Ga0307411_10144844
829 Ga0307510_10501277
830 Ga0373948_0002905
831 Ga0373950_0087718
832 Ga0373928_0004262
833 Ga0373932_0021035
834 Ga0373931_0037974
835 Ga0395901_0572297
836 Ga0400490_22953
837 Ga0400485_19312
838 Ga0400488_38723
839 Ga0400488_39784
840 Ga0400486_12901
841 Ga0400483_064281
842 Ga0400483_119403
843 Ga0400483_233370
844 Ga0436361_0256279
845 Ga0439436_0002699
846 Ga0439436_0110983
847 Ga0439438_000022
848 Ga0439438_000285
849 Ga0439438_001466
850 Ga0439438_008009
851 Ga0439438_018379
852 Ga0439438_028171
853 Ga0439438_065748
854 Ga0439447_000917
855 Ga0439447_012898
856 Ga0439447_030980
857 Ga0439447_035179
858 Ga0439447_102872
859 Ga0439466_0000211
860 Ga0439466_0000519
861 Ga0439466_0008128
862 Ga0439466_0011682
863 Ga0439466_0018667
864 Ga0439466_0030634
865 Ga0439466_0031645
866 Ga0439466_0033972
867 Ga0439466_0052125
868 Ga0439465_0055132
869 Ga0439465_0353317
870 Ga0451787_465771
871 Ga0451791_1379667
872 Ga0451791_1837915
873 Ga0451793_0464016
874 Ga0451793_0751250
875 Ga0451798_0812633
876 Ga0451800_1332029
877 Ga0451802_0144739
878 Ga0451806_035333
879 Ga0451807_0651459
880 Ga0451833_1145808
881 Ga0451841_0419266
882 Ga0451851_0518536
883 Ga0451843_1138578
884 Ga0451853_3898713
885 Ga0439431_0000022
886 Ga0439432_000005
887 Ga0439432_000019
888 Ga0439432_000040
889 Ga0439432_017128
890 Ga0439432_149142
891 Ga0439449_0131996
892 Ga0439451_003207
893 Ga0439451_006753
894 Ga0439451_071922
895 Ga0439452_001534
896 Ga0439452_015371
897 Ga0439456_000985
898 Ga0439456_002589
899 Ga0439456_004474
900 Ga0439456_034150
901 Ga0439462_0012502
902 Ga0439463_002911
903 Ga0450896_006894
904 Ga0450898_002829
905 Ga0450899_002643
906 Ga0450902_008131
907 Ga0450903_005806
908 Ga0439446_0001349
909 Ga0439446_0011517
910 Ga0439446_0015325
911 Ga0450909_002067
912 Ga0450909_080064
913 Ga0439434_0003610
914 Ga0439434_0021483
915 Ga0451577_0000743
916 Ga0453684_0002107
917 Ga0466971_0376565
918 Ga0466957_0333685
919 Ga0495617_000054
920 Ga0495617_000066
921 Ga0495617_000930
922 Ga0495617_069240
923 Ga0495617_076247
924 Ga0495617_077451
925 Ga0495617_090194
926 Ga0495627_000257
927 Ga0495627_020057
928 Ga0495627_051277
929 Ga0495603_0020933
930 Ga0495603_0065715
931 Ga0495603_0200077
932 Ga0495590_0012001
933 Ga0495590_0038015
934 Ga0495590_0039190
935 Ga0495590_0131154
936 Ga0495591_003476
937 Ga0495591_006430
938 Ga0495591_029602
939 Ga0495591_089154
940 Ga0495638_0000088
941 Ga0495638_0032433
942 Ga0495653_0000605
943 Ga0495650_0001073
944 Ga0495650_0018137
945 Ga0495650_0080635
946 Ga0495650_0122958
947 Ga0495605_0000199
948 Ga0495605_0017367
949 Ga0495605_0025555
950 Ga0495605_0034412
951 Ga0495605_0042718
952 Ga0495605_0062548
953 Ga0495605_0080013
954 Ga0495605_0143940
955 Ga0495605_0267593
956 Ga0495584_0000758
957 Ga0495584_0002746
958 Ga0495584_0005138
959 Ga0495584_0028333
960 Ga0495584_0224133
961 Ga0495585_0204233
962 Ga0495594_0013633
963 Ga0495607_0001845
964 Ga0495607_0016494
965 Ga0495607_0030153
966 Ga0495607_0085585
967 Ga0495583_0086710
968 Ga0495610_0043897
969 Ga0495610_0044458
970 Ga0495610_0059358
971 Ga0495610_0081305
972 Ga0495610_0374022
973 Ga0495616_0009052
974 Ga0495620_0001517
975 Ga0495620_0017467
976 Ga0495620_0050004
977 Ga0495620_0106226
978 Ga0495631_0000559
979 Ga0495631_0021617
980 Ga0495631_0085945
981 Ga0495632_0000128
982 Ga0495632_0000780
983 Ga0495632_0044337
984 Ga0495632_0103512
985 Ga0495637_0000395
986 Ga0495637_0011860
987 Ga0495637_0015377
988 Ga0495637_0034168
989 Ga0495637_0106216
990 Ga0495637_0121641
991 Ga0495643_0015445
992 Ga0495643_0081999
993 Ga0495643_0225822
994 Ga0495643_0257276
995 Ga0495644_0001265
996 Ga0495644_0077483
997 Ga0495648_0001941
998 Ga0495648_0002726
999 Ga0495648_0209446
1000 Ga0495648_0422421
1001 Ga0495663_0006609
1002 Ga0495642_0136561
1003 Ga0495642_0164324
1004 Ga0495654_0000075
1005 Ga0495654_0000268
1006 Ga0495654_0023287
1007 Ga0495654_0026352
1008 Ga0495654_0082321
1009 Ga0495654_0158322
1010 Ga0495665_0217097
1011 Ga0495587_0031588
1012 Ga0495609_0000221
1013 Ga0495609_0020073
1014 Ga0495609_0100191
1015 Ga0495609_0146345
1016 Ga0495621_0006264
1017 Ga0495621_0259509
1018 Ga0495597_0001112
1019 Ga0495597_0001394
1020 Ga0495597_0003047
1021 Ga0495597_0007478
1022 Ga0495597_0015519
1023 Ga0495597_0021650
1024 Ga0495597_0224631
1025 Ga0495597_0376670
1026 Ga0495645_0145805
1027 Ga0495645_0502739
1028 Ga0495622_0019843
1029 Ga0495622_0031062
1030 Ga0495622_0069294
1031 Ga0495622_0084429
1032 Ga0495633_0326907
1033 Ga0495656_0007104
1034 Ga0495656_0205686
1035 Ga0495668_0042445
1036 Ga0495668_0070909
1037 Ga0495668_0311140
1038 Ga0495611_0001959
1039 Ga0495625_0003263
1040 Ga0495625_0044494
1041 Ga0495625_0329265
1042 Ga0495659_0059778
1043 Ga0495661_0030941
1044 Ga0495661_0057408
1045 Ga0495661_0249112
1046 Ga0495669_0161224
1047 Ga0495669_0177063
1048 Ga0495670_0098929
1049 Ga0495670_0108434
1050 Ga0495670_0117403
1051 Ga0495671_0000646
1052 Ga0495671_0014352
1053 Ga0495671_0021685
1054 Ga0495671_0032939
1055 Ga0495671_0048554
1056 Ga0495671_0048634
1057 Ga0495671_0051005
1058 Ga0495671_0188233
1059 Ga0495671_0277060
1060 Ga0495671_0582861
1061 Ga0495649_0015375
1062 Ga0495649_0086258
1063 Ga0495649_0087560
1064 Ga0495649_0097169
1065 Ga0495589_0053471
1066 Ga0495589_0119008
1067 Ga0495589_0176469
1068 Ga0495600_0418284
1069 Ga0495660_0002628
1070 Ga0495660_0004196
1071 Ga0495660_0005857
1072 Ga0495660_0019026
1073 Ga0495660_0102161
1074 Ga0495660_0125242
1075 Ga0495660_0170979
1076 Ga0495660_0186252
1077 Ga0495581_0007532
1078 Ga0495636_0014776
1079 Ga0495636_0127401
1080 Ga0495672_0000639
1081 Ga0495672_0006323
1082 Ga0495672_0034939
1083 Ga0495672_0099140
1084 Ga0495672_0144894
1085 Ga0495672_0197894
1086 Ga0495676_0085415
1087 Ga0495680_0069602
1088 Ga0495680_0337536
1089 Ga0495683_0028208
1090 Ga0495683_0169192
1091 Ga0495687_004519
1092 Ga0495675_0002646
1093 Ga0495677_0015509
1094 Ga0495677_0128929
1095 Ga0495679_000053
1096 Ga0495679_068705
1097 Ga0495685_027089
1098 Ga0495673_0000116
1099 Ga0495673_0001747
1100 Ga0495673_0012248
1101 Ga0495673_0069810
1102 Ga0495673_0110697
1103 Ga0495681_0013329
1104 Ga0495681_0019612
1105 Ga0495681_0034872
1106 Ga0495681_0079719
1107 Ga0495686_0264103
1108 Ga0495686_0577664
1109 Ga0495593_0040891
1110 Ga0495626_0000502
1111 Ga0495626_0001773
1112 Ga0495626_0030282
1113 Ga0496108_0498331
1114 Ga0496110_0352714
1115 Ga0496110_0644026
1116 Ga0496116_0253724
1117 Ga0496117_0013428
1118 Ga0496117_0298484
1119 Ga0496119_0028519
1120 Ga0496120_0167989
1121 Ga0496121_0001370
1122 Ga0496121_0001552
1123 Ga0496121_0005988
1124 Ga0496121_0178422
1125 Ga0496121_0373159
1126 Ga0496122_0001719
1127 Ga0496122_0012764
1128 Ga0496122_0075222
1129 Ga0496122_0077415
1130 Ga0496123_0000376
1131 Ga0496123_0008645
1132 Ga0496123_0047281
1133 Ga0496123_0099985
1134 Ga0496123_0362018
1135 Ga0496124_0303658
1136 Ga0496125_0000216
1137 Ga0496125_0033223
1138 Ga0496125_0107596
1139 Ga0496125_0212911
1140 Ga0495678_018876
1141 Ga0495678_100070
1142 Ga0495678_103959
1143 Ga0495678_127827
1144 Ga0495682_0000632
1145 Ga0495682_0026837
1146 Ga0495682_0032640
1147 Ga0495682_0064947
1148 Ga0495682_0106190
1149 Ga0501033_0672565
1150 Ga0501034_0166340
1151 Ga0501034_0671705
1152 Ga0501039_0428258
1153 Ga0501043_0426783
1154 Ga0501047_0058417
1155 Ga0501222_001599
1156 Ga0501279_006562
1157 Ga0501282_041558
1158 Ga0501035_0086770
1159 Ga0501044_0006781
1160 nmdc:mga03683_45806_c1
1161 nmdc:mga00v17_16744_c1
1162 nmdc:mga0k408_182712_c1
1163 nmdc:mga07m45_23205_c1
1164 nmdc:mga07m45_344090_c1
1165 nmdc:mga07m45_482044_c1
1166 nmdc:mga08x19_54894_c1
1167 nmdc:mga08x19_82148_c1
1168 nmdc:mga08x19_86263_c1
1169 nmdc:mga0sz30_334229_c1
1170 Ga0500610_0000205
1171 Ga0500578_0080741
1172 Ga0500644_0009065
1173 Ga0500647_0115196
1174 Ga0500566_0508339
1175 Ga0500572_033237
1176 Ga0500592_007793
1177 Ga0500594_0005632
1178 Ga0500608_049902
1179 Ga0500659_0010882
1180 Ga0500568_0023595
1181 Ga0500577_0069911
1182 Ga0500586_030414
1183 Ga0500616_0003164
1184 Ga0500627_0102970
1185 Ga0500634_0017944
1186 Ga0500656_032497
1187 Ga0500596_004071
1188 Ga0500661_011803
1189 Ga0500661_023832
1190 2511822783
1191 2511824261
1192 2511824859
1193 2511827186
1194 2527080969
1195 2587759947
1196 2597862730
1197 2600042942
1198 2601628812
1199 2621299873
1200 2644621595
1201 2677900879
1202 2738691357
1203 2739259194
1204 2739261419
1205 2739267132
1206 2819602708
1207 2842333019
1208 2842353256
1209 2842457697
1210 2842738071
1211 2842818269
1212 2885202146
1213 2885215797
1214 2908449550
1215 2919468046
1216 2919702674
1217 2923587732
1218 2928058623
1219 2945985876
1220 2945985921
1221 3007513927
1222 8018852315
1223 8019781024
1224 8019782330
1225 8056135258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05717

TnpB_IS66

IS66 Orf2 like protein

5

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lfo-assembly1.cif.gz_A nmr structure of cl-babp/ss complexed with glycochenodeoxycholic and glycocholic acids 0.8242 39 66
3vx8-assembly1.cif.gz_A crystal structure of arabidopsis thaliana atg7ntd-atg3 complex 0.747 38 53
6on7-assembly1.cif.gz_B crystal structure of apo domain-swapped dimer q108k:t51d:a28c:l36c mutant of human cellular retinol binding protein ii 0.7446 41 68
3t7g-assembly2.cif.gz_B atg8 transfer from atg7 to atg3: a distinctive e1-e2 architecture and mechanism in the autophagy pathway 0.7396 38 53
4g4g-assembly1.cif.gz_A crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution 0.7385 34 64
ID Description Score Start End Superfamily
af_Q1AMT3_1_127_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8552 39 66 2.40.128.20
af_G5EDE5_128_278_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.8536 41 66 3.40.1000.10
af_Q9UQ49_4_416_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.826 36 66 2.120.10.10
af_F4HSY9_27_364_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8156 38 64 2.130.10.10
af_Q9SU05_63_382_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8067 38 65 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6I1VZR1-F1-model_v4 IS66 family insertion sequence element accessory protein TnpB 0.9719 1 68
AF-A0A1C7BQ89-F1-model_v4 deleted 0.9691 1 65
AF-A0A2A4MAJ3-F1-model_v4 deleted 0.9604 1 58
AF-A0A837PNF3-F1-model_v4 deleted 0.9596 3 58
AF-A0A1I0H0D8-F1-model_v4 Transposase and inactivated derivatives 0.958 1 61 GO:0003677
GO:0004803
GO:0006313

Map