F469134

General Info

Members Datasets Scaffolds Average Seq Length
612 220 1224 248

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10605048|Ga0111539_106050482
Length 250
Sequence MAGMPSDPDRKLEIVTEVPESAMVIFAHPDDAEIGAGGVVAGWVAAGCEVTYVLCTNGDSGTADRALTAVELARRRAVEQRASADFMGVRHVEMLGYPDGELEDTRQLLGDIVRAIRKHRPHTVFVHDPYRMNGFQHRDHRKAGIATTDAVYPFARDHLHFPEHVGEGLEPHKVRELWYWGMDHPNVIVDVTGAIDRQIAALVRHESQMPGFNVPAGQTIGERVKRNAAELADGYGFQYGAVFRRLIARR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10605048 3300009094 Bacteria 1276
2 Ga0065707_10355609 3300005295 Bacteria 912
3 Ga0070690_100056734 3300005330 Bacteria 2512
4 Ga0070670_100032578 3300005331 Bacteria 4488
5 Ga0068869_100002746 3300005334 Bacteria 10658
6 Ga0068869_100010742 3300005334 Bacteria 5979
7 Ga0068869_100016771 3300005334 Unclassified 4946
8 Ga0070666_10250938 3300005335 Unclassified 1253
9 Ga0070680_100001773 3300005336 Bacteria 15847
10 Ga0070680_100129163 3300005336 Bacteria 2113
11 Ga0070682_100000361 3300005337 Bacteria 30657
12 Ga0068868_100090823 3300005338 Bacteria 2460
13 Ga0070660_100000774 3300005339 Bacteria 21216
14 Ga0070689_100084368 3300005340 Bacteria 2496
15 Ga0070691_10030349 3300005341 Bacteria 2532
16 Ga0070691_10118053 3300005341 Bacteria 1333
17 Ga0070687_100128309 3300005343 Unclassified 1461
18 Ga0070661_100002097 3300005344 Bacteria 13727
19 Ga0070692_10000489 3300005345 Bacteria 12180
20 Ga0070692_10459696 3300005345 Unclassified 816
21 Ga0070669_100494646 3300005353 Bacteria 1014
22 Ga0070671_100469049 3300005355 Unclassified 1081
23 Ga0070674_100097600 3300005356 Bacteria 2134
24 Ga0070673_100005335 3300005364 Bacteria 8208
25 Ga0070688_100098315 3300005365 Bacteria 1925
26 Ga0070659_100000893 3300005366 Bacteria 21822
27 Ga0070667_100610766 3300005367 Bacteria 1005
28 Ga0070703_10000963 3300005406 Bacteria 9130
29 Ga0070709_10047395 3300005434 Bacteria 2677
30 Ga0070713_100753537 3300005436 Bacteria 932
31 Ga0070705_100000121 3300005440 Bacteria 44994
32 Ga0070705_100003686 3300005440 Bacteria 7498
33 Ga0070694_100001250 3300005444 Bacteria 14750
34 Ga0070694_100011038 3300005444 Bacteria 5589
35 Ga0070694_100020430 3300005444 Bacteria 4222
36 Ga0070694_100044784 3300005444 Bacteria 2962
37 Ga0070708_100000996 3300005445 Bacteria 21625
38 Ga0070708_100013711 3300005445 Bacteria 6649
39 Ga0070708_100019647 3300005445 Bacteria 5681
40 Ga0070708_100025885 3300005445 Bacteria 5017
41 Ga0070708_100026693 3300005445 Bacteria 4947
42 Ga0070708_100060310 3300005445 Bacteria 3385
43 Ga0070708_100902230 3300005445 Bacteria 830
44 Ga0070663_100003284 3300005455 Bacteria 9308
45 Ga0070662_100088163 3300005457 Bacteria 2325
46 Ga0070662_100178955 3300005457 Bacteria 1671
47 Ga0070681_10002152 3300005458 Bacteria 17909
48 Ga0070681_10250259 3300005458 Bacteria 1685
49 Ga0068867_100014542 3300005459 Bacteria 5578
50 Ga0070706_100125222 3300005467 Unclassified 2396
51 Ga0070706_100242730 3300005467 Bacteria 1682
52 Ga0070706_100251400 3300005467 Bacteria 1650
53 Ga0070706_100252064 3300005467 Bacteria 1648
54 Ga0070707_100016761 3300005468 Bacteria 6878
55 Ga0070707_100016869 3300005468 Bacteria 6858
56 Ga0070707_100056008 3300005468 Bacteria 3780
57 Ga0070707_100061027 3300005468 Bacteria 3616
58 Ga0070707_100105229 3300005468 Bacteria 2736
59 Ga0070707_100404436 3300005468 Bacteria 1325
60 Ga0070698_100000760 3300005471 Bacteria 34891
61 Ga0070698_100017243 3300005471 Bacteria 7609
62 Ga0070698_100056494 3300005471 Bacteria 3977
63 Ga0070698_100068522 3300005471 Bacteria 3565
64 Ga0070698_100076922 3300005471 Bacteria 3338
65 Ga0070698_100155615 3300005471 Bacteria 2231
66 Ga0070698_100281027 3300005471 Unclassified 1596
67 Ga0070699_100003846 3300005518 Bacteria 13268
68 Ga0070699_100015886 3300005518 Bacteria 6463
69 Ga0070699_100033416 3300005518 Bacteria 4444
70 Ga0070699_100056060 3300005518 Bacteria 3412
71 Ga0070699_100062796 3300005518 Bacteria 3220
72 Ga0070699_100169824 3300005518 Bacteria 1932
73 Ga0070699_100328811 3300005518 Bacteria 1374
74 Ga0070699_100438226 3300005518 Bacteria 1184
75 Ga0070679_100001563 3300005530 Bacteria 20480
76 Ga0070684_100078114 3300005535 Bacteria 2924
77 Ga0070697_100001953 3300005536 Bacteria 15786
78 Ga0070697_100002594 3300005536 Bacteria 13901
79 Ga0070697_100010807 3300005536 Bacteria 7130
80 Ga0070697_100257139 3300005536 Bacteria 1494
81 Ga0070697_100500445 3300005536 Bacteria 1062
82 Ga0068853_100001571 3300005539 Bacteria 16641
83 Ga0070672_100006825 3300005543 Bacteria 7709
84 Ga0070686_100135574 3300005544 Unclassified 1708
85 Ga0070695_100004752 3300005545 Bacteria 7995
86 Ga0070695_100023457 3300005545 Bacteria 3792
87 Ga0070695_100040247 3300005545 Bacteria 2958
88 Ga0070695_100081037 3300005545 Bacteria 2147
89 Ga0070695_100148863 3300005545 Bacteria 1631
90 Ga0070696_100000744 3300005546 Bacteria 20821
91 Ga0070696_100031916 3300005546 Bacteria 3612
92 Ga0070696_100223471 3300005546 Archaea 1414
93 Ga0070693_100000569 3300005547 Bacteria 16376
94 Ga0070704_100006298 3300005549 Bacteria 6991
95 Ga0070704_100019884 3300005549 Bacteria 4321
96 Ga0070704_100031992 3300005549 Bacteria 3543
97 Ga0070704_100112222 3300005549 Bacteria 2076
98 Ga0070704_100190867 3300005549 Bacteria 1647
99 Ga0070704_100516178 3300005549 Unclassified 1039
100 Ga0070664_100007639 3300005564 Bacteria 8732
101 Ga0068857_100005571 3300005577 Bacteria 10747
102 Ga0068857_100012639 3300005577 Bacteria 7355
103 Ga0068854_100006947 3300005578 Bacteria 7220
104 Ga0068856_100002868 3300005614 Bacteria 17647
105 Ga0068852_100372092 3300005616 Bacteria 1400
106 Ga0068859_100002856 3300005617 Bacteria 17528
107 Ga0068859_100024260 3300005617 Bacteria 6085
108 Ga0068859_100028506 3300005617 Bacteria 5598
109 Ga0068864_100003508 3300005618 Bacteria 12967
110 Ga0068861_100034541 3300005719 Bacteria 3740
111 Ga0068870_10004581 3300005840 Bacteria 5957
112 Ga0068870_10069700 3300005840 Bacteria 1914
113 Ga0068863_100043504 3300005841 Bacteria 4263
114 Ga0068863_100372013 3300005841 Bacteria 1394
115 Ga0068858_100051778 3300005842 Bacteria 3799
116 Ga0068860_100037495 3300005843 Bacteria 4640
117 Ga0068860_100113252 3300005843 Bacteria 2594
118 Ga0068860_100280913 3300005843 Unclassified 1627
119 Ga0068862_100175906 3300005844 Bacteria 1919
120 Ga0068862_100186546 3300005844 Bacteria 1864
121 Ga0081455_10001825 3300005937 Bacteria 25634
122 Ga0081455_10023848 3300005937 Bacteria 5683
123 Ga0081539_10000259 3300005985 Bacteria 121997
124 Ga0070716_100019728 3300006173 Bacteria 3528
125 Ga0070712_100013253 3300006175 Bacteria 5264
126 Ga0075428_100002633 3300006844 Bacteria 19529
127 Ga0075428_100005970 3300006844 Bacteria 13526
128 Ga0075428_100007156 3300006844 Bacteria 12364
129 Ga0075428_100039173 3300006844 Bacteria 5216
130 Ga0075428_100108133 3300006844 Bacteria 3031
131 Ga0075428_100182321 3300006844 Bacteria 2272
132 Ga0075430_100000104 3300006846 Bacteria 50931
133 Ga0075430_100000499 3300006846 Bacteria 29432
134 Ga0075430_100003206 3300006846 Bacteria 13695
135 Ga0075430_100089822 3300006846 Bacteria 2570
136 Ga0075430_100111029 3300006846 Bacteria 2286
137 Ga0075430_100150532 3300006846 Bacteria 1938
138 Ga0075431_100000176 3300006847 Bacteria 45497
139 Ga0075431_100000226 3300006847 Bacteria 42242
140 Ga0075431_100038668 3300006847 Bacteria 4914
141 Ga0075431_100054990 3300006847 Bacteria 4105
142 Ga0075431_100159292 3300006847 Bacteria 2321
143 Ga0075431_100212111 3300006847 Unclassified 1978
144 Ga0075431_100251695 3300006847 Bacteria 1795
145 Ga0075431_100504357 3300006847 Bacteria 1201
146 Ga0075433_10002922 3300006852 Bacteria 13112
147 Ga0075433_10004756 3300006852 Bacteria 10594
148 Ga0075433_10023995 3300006852 Bacteria 5142
149 Ga0075433_10040493 3300006852 Bacteria 4033
150 Ga0075433_10325495 3300006852 Bacteria 1359
151 Ga0075433_10646324 3300006852 Bacteria 927
152 Ga0075433_10650102 3300006852 Bacteria 924
153 Ga0075434_100001694 3300006871 Bacteria 18862
154 Ga0075434_100031556 3300006871 Bacteria 5224
155 Ga0075434_100046848 3300006871 Bacteria 4290
156 Ga0075434_100092103 3300006871 Bacteria 3033
157 Ga0075434_100104645 3300006871 Bacteria 2840
158 Ga0075434_100106513 3300006871 Bacteria 2813
159 Ga0075434_100144255 3300006871 Bacteria 2401
160 Ga0075434_100403252 3300006871 Bacteria 1388
161 Ga0075434_100579319 3300006871 Bacteria 1141
162 Ga0075429_100000299 3300006880 Bacteria 35084
163 Ga0075429_100001416 3300006880 Bacteria 19655
164 Ga0075429_100053700 3300006880 Bacteria 3506
165 Ga0075429_100106731 3300006880 Bacteria 2447
166 Ga0075429_100128029 3300006880 Bacteria 2221
167 Ga0075429_100156049 3300006880 Bacteria 1999
168 Ga0075429_100166205 3300006880 Bacteria 1933
169 Ga0075429_100246462 3300006880 Bacteria 1564
170 Ga0075429_100380727 3300006880 Bacteria 1235
171 Ga0068865_100180753 3300006881 Bacteria 1624
172 Ga0075436_100001627 3300006914 Bacteria 15377
173 Ga0075436_100420238 3300006914 Bacteria 971
174 Ga0097620_100002855 3300006931 Bacteria 17528
175 Ga0097620_100024262 3300006931 Bacteria 6085
176 Ga0097620_100028506 3300006931 Bacteria 5598
177 Ga0075435_100002061 3300007076 Bacteria 13176
178 Ga0075435_100010051 3300007076 Bacteria 6900
179 Ga0075435_100017331 3300007076 Bacteria 5450
180 Ga0075435_100030315 3300007076 Bacteria 4251
181 Ga0075435_100163523 3300007076 Bacteria 1876
182 Ga0075435_100239263 3300007076 Bacteria 1544
183 Ga0075435_100554115 3300007076 Unclassified 996
184 Ga0099794_10007722 3300007265 Bacteria 4435
185 Ga0099794_10026105 3300007265 Bacteria 2697
186 Ga0099794_10117677 3300007265 Bacteria 1335
187 Ga0111539_10000139 3300009094 Bacteria 82909
188 Ga0111539_10018531 3300009094 Bacteria 8623
189 Ga0111539_10064304 3300009094 Bacteria 4340
190 Ga0105247_10067988 3300009101 Bacteria 2221
191 Ga0114129_10003964 3300009147 Bacteria 20904
192 Ga0114129_10009508 3300009147 Bacteria 13865
193 Ga0114129_10032360 3300009147 Bacteria 7392
194 Ga0114129_10046302 3300009147 Bacteria 6113
195 Ga0114129_10054892 3300009147 Bacteria 5584
196 Ga0114129_10059567 3300009147 Bacteria 5338
197 Ga0114129_10085039 3300009147 Bacteria 4389
198 Ga0114129_10115253 3300009147 Bacteria 3704
199 Ga0114129_10148862 3300009147 Bacteria 3204
200 Ga0114129_10180738 3300009147 Bacteria 2870
201 Ga0114129_10184235 3300009147 Bacteria 2839
202 Ga0114129_10196443 3300009147 Bacteria 2735
203 Ga0114129_10245111 3300009147 Bacteria 2408
204 Ga0114129_10348224 3300009147 Unclassified 1963
205 Ga0114129_10940331 3300009147 Bacteria 1092
206 Ga0114129_11144208 3300009147 Unclassified 972
207 Ga0114129_11616351 3300009147 Unclassified 793
208 Ga0105243_10122111 3300009148 Bacteria 2198
209 Ga0105243_10450254 3300009148 Bacteria 1208
210 Ga0105241_10000226 3300009174 Bacteria 42618
211 Ga0105241_10010819 3300009174 Bacteria 6693
212 Ga0105241_10145800 3300009174 Bacteria 1932
213 Ga0105242_10008964 3300009176 Bacteria 7680
214 Ga0105242_10415160 3300009176 Bacteria 1260
215 Ga0105248_10154241 3300009177 Bacteria 2591
216 Ga0105248_10329247 3300009177 Bacteria 1720
217 Ga0105249_10090788 3300009553 Unclassified 2856
218 Ga0105249_10132601 3300009553 Bacteria 2380
219 Ga0105249_10318321 3300009553 Bacteria 1566
220 Ga0157373_10007885 3300013100 Bacteria 7923
221 Ga0157371_10240025 3300013102 Bacteria 1303
222 Ga0157369_10056965 3300013105 Bacteria 4217
223 Ga0157378_10186043 3300013297 Bacteria 1956
224 Ga0163162_10080333 3300013306 Bacteria 3328
225 Ga0163162_10495108 3300013306 Bacteria 1353
226 Ga0157372_10000368 3300013307 Bacteria 50004
227 Ga0157372_10132379 3300013307 Bacteria 2870
228 Ga0157375_10220042 3300013308 Bacteria 2057
229 Ga0157375_10311808 3300013308 Unclassified 1738
230 Ga0157375_10361799 3300013308 Bacteria 1617
231 Ga0157375_11078598 3300013308 Unclassified 939
232 Ga0163163_10031406 3300014325 Bacteria 5125
233 Ga0157380_10076165 3300014326 Bacteria 2729
234 Ga0206356_11786192 3300020070 Bacteria 1294
235 Ga0207680_10234801 3300025903 Bacteria 1261
236 Ga0207647_10066901 3300025904 Unclassified 2178
237 Ga0207699_10030385 3300025906 Bacteria 3022
238 Ga0207645_10001584 3300025907 Bacteria 18542
239 Ga0207645_10088333 3300025907 Bacteria 1993
240 Ga0207643_10000263 3300025908 Bacteria 36580
241 Ga0207643_10047268 3300025908 Bacteria 2434
242 Ga0207684_10003709 3300025910 Bacteria 14790
243 Ga0207684_10004629 3300025910 Bacteria 12914
244 Ga0207684_10006841 3300025910 Bacteria 10325
245 Ga0207684_10012495 3300025910 Bacteria 7382
246 Ga0207684_10021091 3300025910 Bacteria 5563
247 Ga0207684_10068721 3300025910 Bacteria 3010
248 Ga0207684_10422595 3300025910 Bacteria 1145
249 Ga0207684_10634032 3300025910 Bacteria 911
250 Ga0207654_10002663 3300025911 Bacteria 9066
251 Ga0207654_10028849 3300025911 Bacteria 3029
252 Ga0207707_10000092 3300025912 Bacteria 90462
253 Ga0207693_10003315 3300025915 Bacteria 13773
254 Ga0207663_10098006 3300025916 Unclassified 1962
255 Ga0207663_10403887 3300025916 Bacteria 1045
256 Ga0207660_10009278 3300025917 Bacteria 6370
257 Ga0207660_10018368 3300025917 Bacteria 4659
258 Ga0207660_10077132 3300025917 Bacteria 2438
259 Ga0207660_10086650 3300025917 Bacteria 2313
260 Ga0207662_10071030 3300025918 Unclassified 2107
261 Ga0207657_10000288 3300025919 Bacteria 53618
262 Ga0207649_10005261 3300025920 Bacteria 6996
263 Ga0207652_10000853 3300025921 Bacteria 28976
264 Ga0207646_10011619 3300025922 Bacteria 8514
265 Ga0207646_10013482 3300025922 Bacteria 7814
266 Ga0207646_10024288 3300025922 Bacteria 5555
267 Ga0207646_10029169 3300025922 Bacteria 5017
268 Ga0207646_10037320 3300025922 Bacteria 4381
269 Ga0207646_10068590 3300025922 Bacteria 3167
270 Ga0207646_10149528 3300025922 Bacteria 2106
271 Ga0207646_10297768 3300025922 Bacteria 1457
272 Ga0207646_10584843 3300025922 Unclassified 1003
273 Ga0207644_10476767 3300025931 Archaea 1027
274 Ga0207690_10033151 3300025932 Bacteria 3319
275 Ga0207706_10005447 3300025933 Bacteria 11859
276 Ga0207706_10059395 3300025933 Bacteria 3367
277 Ga0207706_10152423 3300025933 Bacteria 2033
278 Ga0207686_10077766 3300025934 Bacteria 2155
279 Ga0207686_10172037 3300025934 Bacteria 1528
280 Ga0207709_10088201 3300025935 Unclassified 2019
281 Ga0207670_10084500 3300025936 Bacteria 2228
282 Ga0207670_10325464 3300025936 Unclassified 1210
283 Ga0207669_10689510 3300025937 Bacteria 839
284 Ga0207704_10152472 3300025938 Bacteria 1633
285 Ga0207704_10187058 3300025938 Unclassified 1503
286 Ga0207665_10035680 3300025939 Bacteria 3302
287 Ga0207691_10016892 3300025940 Bacteria 6924
288 Ga0207691_10043900 3300025940 Bacteria 4117
289 Ga0207689_10000020 3300025942 Bacteria 110705
290 Ga0207689_10020939 3300025942 Bacteria 5497
291 Ga0207689_10030078 3300025942 Bacteria 4527
292 Ga0207679_10001128 3300025945 Bacteria 17017
293 Ga0207667_10003725 3300025949 Bacteria 18797
294 Ga0207651_10186187 3300025960 Bacteria 1652
295 Ga0207712_10022328 3300025961 Bacteria 4165
296 Ga0207712_10075022 3300025961 Bacteria 2444
297 Ga0207712_10314079 3300025961 Unclassified 1290
298 Ga0207658_10615987 3300025986 Bacteria 976
299 Ga0207677_10147180 3300026023 Bacteria 1812
300 Ga0207639_10001053 3300026041 Bacteria 18742
301 Ga0207678_10004290 3300026067 Bacteria 12792
302 Ga0207708_10036989 3300026075 Bacteria 3718
303 Ga0207702_10001607 3300026078 Bacteria 22350
304 Ga0207641_10095039 3300026088 Bacteria 2615
305 Ga0207648_10040810 3300026089 Bacteria 4077
306 Ga0207648_10069779 3300026089 Bacteria 3062
307 Ga0207648_10100255 3300026089 Bacteria 2537
308 Ga0207674_10002451 3300026116 Bacteria 23433
309 Ga0207674_10008377 3300026116 Bacteria 11957
310 Ga0207675_100112368 3300026118 Bacteria 2571
311 Ga0207675_100549704 3300026118 Unclassified 1154
312 Ga0207675_100659130 3300026118 Bacteria 1053
313 Ga0209996_1005665 3300027395 Bacteria 1601
314 Ga0209984_1001643 3300027424 Bacteria 2433
315 Ga0209968_1001301 3300027526 Bacteria 3813
316 Ga0209999_1001813 3300027543 Bacteria 3709
317 Ga0209970_1013773 3300027614 Bacteria 1342
318 Ga0209983_1001052 3300027665 Bacteria 6084
319 Ga0209588_1013296 3300027671 Bacteria 2510
320 Ga0209971_1000153 3300027682 Bacteria 20347
321 Ga0209966_1000096 3300027695 Bacteria 39019
322 Ga0209998_10000233 3300027717 Bacteria 18775
323 Ga0209974_10004036 3300027876 Bacteria 5248
324 Ga0207428_10001002 3300027907 Bacteria 31338
325 Ga0207428_10036694 3300027907 Bacteria 3995
326 Ga0207428_10066709 3300027907 Bacteria 2835
327 Ga0268265_10053180 3300028380 Bacteria 3067
328 Ga0268265_10169859 3300028380 Unclassified 1862
329 Ga0268265_10192342 3300028380 Bacteria 1763
330 Ga0268265_10934874 3300028380 Unclassified 853
331 Ga0268264_10009262 3300028381 Bacteria 8153
332 Ga0268264_10150749 3300028381 Bacteria 2084
333 Ga0268264_10543712 3300028381 Unclassified 1138
334 Ga0307408_100095702 3300031548 Bacteria 2251
335 Ga0307408_100730201 3300031548 Bacteria 893
336 Ga0307413_10428528 3300031824 Bacteria 1044
337 Ga0307410_10498872 3300031852 Bacteria 1001
338 Ga0307416_100014762 3300032002 Bacteria 5368
339 Ga0373928_0023549 3300035084 Bacteria 1314
340 Ga0373949_0007330 3300035090 Bacteria 2414
341 Ga0373951_0010401 3300035091 Bacteria 2088
342 Ga0373932_0006671 3300035112 Bacteria 2736
343 Ga0373932_0061095 3300035112 Bacteria 1145
344 Ga0373932_0159843 3300035112 Unclassified 779
345 Ga0373961_0027700 3300035241 Unclassified 1557
346 Ga0373962_0024609 3300035242 Bacteria 1612
347 Ga0373931_0063417 3300035691 Bacteria 1997
348 Ga0395900_0186552 3300037418 Bacteria 2105
349 Ga0395898_0007242 3300037466 Bacteria 11774
350 Ga0395901_0465857 3300038443 Bacteria 1290
351 Ga0439441_017471 3300042001 Bacteria 1288
352 Ga0439448_0137571 3300042005 Bacteria 844
353 Ga0439463_028248 3300042016 Bacteria 1413
354 Ga0439459_0006198 3300042438 Unclassified 1985
355 Ga0439460_0000272 3300042461 Bacteria 10717
356 Ga0439460_0017837 3300042461 Bacteria 1906
357 Ga0451577_0050002 3300042876 Bacteria 3731
358 Ga0451577_0340544 3300042876 Bacteria 1360
359 Ga0451577_0621379 3300042876 Bacteria 980
360 Ga0453683_0017570 3300044673 Bacteria 4604
361 Ga0453683_0035706 3300044673 Bacteria 3132
362 Ga0453683_0055344 3300044673 Bacteria 2483
363 Ga0453684_0076282 3300044712 Bacteria 4209
364 Ga0453684_0170347 3300044712 Bacteria 2567
365 Ga0453684_0202653 3300044712 Bacteria 2312
366 Ga0453684_0642643 3300044712 Bacteria 1158
367 Ga0451576_0033808 3300045051 Bacteria 5433
368 Ga0451576_0049643 3300045051 Bacteria 4403
369 Ga0451576_0116377 3300045051 Bacteria 2783
370 Ga0451576_0158661 3300045051 Unclassified 2360
371 Ga0451576_0180611 3300045051 Bacteria 2203
372 Ga0451576_0259136 3300045051 Bacteria 1817
373 Ga0451576_0757907 3300045051 Bacteria 1019
374 Ga0495580_0002329 3300046472 Bacteria 16575
375 Ga0495580_0043709 3300046472 Bacteria 3188
376 Ga0495594_0086945 3300046499 Bacteria 1749
377 Ga0495642_0014938 3300046528 Bacteria 3014
378 Ga0495656_0087748 3300046615 Bacteria 1417
379 Ga0495659_0009095 3300046664 Bacteria 3168
380 Ga0495659_0049523 3300046664 Bacteria 1526
381 Ga0495669_0044753 3300046684 Bacteria 1972
382 Ga0496102_0047602 3300048905 Bacteria 3898
383 Ga0496106_0103539 3300048909 Bacteria 2209
384 Ga0496112_0165582 3300048915 Bacteria 2177
385 Ga0501299_048942 3300049522 Bacteria 869
386 Ga0501032_0162515 3300049569 Bacteria 1466
387 Ga0501033_0060565 3300049570 Bacteria 2792
388 Ga0501036_0078252 3300049572 Bacteria 2797
389 Ga0501036_0111854 3300049572 Bacteria 2308
390 Ga0501037_0277621 3300049573 Bacteria 1168
391 Ga0501038_0023208 3300049574 Bacteria 5550
392 Ga0501038_0113792 3300049574 Bacteria 2239
393 Ga0501038_0227448 3300049574 Unclassified 1486
394 Ga0501038_0238932 3300049574 Bacteria 1443
395 Ga0501039_0020944 3300049575 Bacteria 5014
396 Ga0501039_0145053 3300049575 Bacteria 1866
397 Ga0501039_0422031 3300049575 Bacteria 1048
398 Ga0501039_0712515 3300049575 Bacteria 784
399 Ga0501040_0004023 3300049576 Bacteria 9549
400 Ga0501040_0011971 3300049576 Bacteria 5676
401 Ga0501040_0024346 3300049576 Bacteria 4063
402 Ga0501040_0024881 3300049576 Bacteria 4022
403 Ga0501040_0037737 3300049576 Bacteria 3283
404 Ga0501040_0041032 3300049576 Bacteria 3151
405 Ga0501040_0063679 3300049576 Bacteria 2538
406 Ga0501040_0070436 3300049576 Bacteria 2413
407 Ga0501040_0124146 3300049576 Unclassified 1813
408 Ga0501041_0030431 3300049577 Bacteria 3258
409 Ga0501041_0045912 3300049577 Bacteria 2657
410 Ga0501041_0134236 3300049577 Unclassified 1542
411 Ga0501041_0190905 3300049577 Bacteria 1283
412 Ga0501042_0060214 3300049578 Bacteria 2712
413 Ga0501042_0120664 3300049578 Bacteria 1887
414 Ga0501042_0257134 3300049578 Bacteria 1260
415 Ga0501046_0006412 3300049580 Bacteria 10431
416 Ga0501046_0025677 3300049580 Bacteria 4818
417 Ga0501046_0059676 3300049580 Bacteria 2987
418 Ga0501046_0090159 3300049580 Bacteria 2359
419 Ga0501046_0114348 3300049580 Unclassified 2059
420 Ga0501046_0334581 3300049580 Bacteria 1101
421 Ga0501047_0358748 3300049581 Unclassified 1293
422 Ga0501048_0010258 3300049582 Bacteria 7004
423 Ga0501048_0203855 3300049582 Bacteria 1402
424 Ga0501048_0208415 3300049582 Bacteria 1386
425 Ga0501048_0339779 3300049582 Unclassified 1070
426 Ga0501067_0063812 3300049583 Bacteria 2040
427 Ga0501068_0069537 3300049584 Bacteria 2147
428 Ga0501068_0072159 3300049584 Bacteria 2108
429 Ga0501068_0072313 3300049584 Unclassified 2106
430 Ga0501068_0104057 3300049584 Bacteria 1761
431 Ga0501069_0056510 3300049585 Bacteria 2187
432 Ga0501070_0161708 3300049586 Bacteria 1846
433 Ga0501070_0198290 3300049586 Bacteria 1649
434 Ga0501070_0268131 3300049586 Bacteria 1395
435 Ga0501071_0337123 3300049587 Bacteria 1146
436 Ga0501071_0636100 3300049587 Bacteria 821
437 Ga0501072_0005549 3300049588 Bacteria 9595
438 Ga0501072_0034745 3300049588 Bacteria 3950
439 Ga0501072_0046794 3300049588 Bacteria 3405
440 Ga0501072_0049212 3300049588 Bacteria 3318
441 Ga0501072_0079849 3300049588 Bacteria 2591
442 Ga0501072_0112079 3300049588 Bacteria 2172
443 Ga0501072_0332838 3300049588 Bacteria 1206
444 Ga0501073_0082251 3300049589 Bacteria 2240
445 Ga0501074_0004382 3300049590 Bacteria 10086
446 Ga0501074_0219334 3300049590 Bacteria 1354
447 Ga0501074_0248037 3300049590 Bacteria 1266
448 Ga0501074_0319173 3300049590 Unclassified 1103
449 Ga0501075_0011720 3300049591 Bacteria 6213
450 Ga0501075_0017477 3300049591 Bacteria 5182
451 Ga0501075_0020838 3300049591 Bacteria 4773
452 Ga0501075_0025734 3300049591 Bacteria 4324
453 Ga0501075_0049210 3300049591 Bacteria 3168
454 Ga0501075_0052693 3300049591 Bacteria 3059
455 Ga0501075_0265039 3300049591 Bacteria 1309
456 Ga0501075_0348527 3300049591 Bacteria 1128
457 Ga0501076_0004216 3300049592 Bacteria 10175
458 Ga0501076_0006916 3300049592 Bacteria 8241
459 Ga0501076_0009909 3300049592 Bacteria 7044
460 Ga0501076_0011632 3300049592 Bacteria 6565
461 Ga0501076_0012002 3300049592 Bacteria 6472
462 Ga0501076_0027100 3300049592 Bacteria 4445
463 Ga0501077_0005608 3300049593 Bacteria 7644
464 Ga0501077_0012311 3300049593 Bacteria 5357
465 Ga0501077_0013541 3300049593 Bacteria 5115
466 Ga0501077_0074349 3300049593 Bacteria 2152
467 Ga0501077_0100307 3300049593 Bacteria 1835
468 Ga0501077_0317615 3300049593 Bacteria 993
469 Ga0501079_0005563 3300049741 Bacteria 9402
470 Ga0501079_0008453 3300049741 Bacteria 7804
471 Ga0501079_0013762 3300049741 Bacteria 6169
472 Ga0501079_0017647 3300049741 Bacteria 5451
473 Ga0501079_0068861 3300049741 Bacteria 2731
474 Ga0501080_0012544 3300049742 Bacteria 7770
475 Ga0501080_0084381 3300049742 Bacteria 2951
476 Ga0501080_0212487 3300049742 Bacteria 1773
477 Ga0501080_0261980 3300049742 Bacteria 1575
478 Ga0501080_0606450 3300049742 Unclassified 971
479 Ga0501081_0000736 3300049743 Bacteria 19096
480 Ga0501081_0007606 3300049743 Bacteria 7025
481 Ga0501081_0021885 3300049743 Bacteria 4271
482 Ga0501081_0023404 3300049743 Bacteria 4140
483 Ga0501081_0029969 3300049743 Bacteria 3679
484 Ga0501081_0053847 3300049743 Bacteria 2779
485 Ga0501081_0058201 3300049743 Bacteria 2674
486 Ga0501081_0121756 3300049743 Bacteria 1859
487 Ga0501081_0368873 3300049743 Bacteria 1060
488 Ga0501081_0494941 3300049743 Bacteria 911
489 Ga0501083_0026315 3300049744 Bacteria 4022
490 Ga0501083_0078429 3300049744 Bacteria 2191
491 Ga0501035_0117174 3300049822 Bacteria 2331
492 Ga0501035_0438610 3300049822 Bacteria 1082
493 Ga0501045_0023238 3300049824 Bacteria 4443
494 Ga0501045_0033681 3300049824 Bacteria 3715
495 Ga0501045_0051781 3300049824 Bacteria 2996
496 Ga0501045_0058741 3300049824 Bacteria 2817
497 Ga0501045_0080726 3300049824 Bacteria 2398
498 Ga0501045_0087396 3300049824 Bacteria 2302
499 Ga0501045_0171786 3300049824 Bacteria 1614
500 Ga0501045_0204590 3300049824 Unclassified 1471
501 nmdc:mga05p37_117359_c1 3300050507 Bacteria 3270
502 nmdc:mga05p37_1199_c1 3300050507 Bacteria 29983
503 nmdc:mga05p37_1276_c1 3300050507 Bacteria 27574
504 nmdc:mga05p37_142856_c1 3300050507 Bacteria 2932
505 nmdc:mga05p37_227205_c2 3300050507 Unclassified 1717
506 nmdc:mga05p37_25893_c1 3300050507 Bacteria 7131
507 nmdc:mga05p37_276902_c1 3300050507 Bacteria 2003
508 nmdc:mga05p37_306123_c1 3300050507 Bacteria 1886
509 nmdc:mga05p37_344977_c1 3300050507 Unclassified 1755
510 nmdc:mga05p37_38951_c1 3300050507 Bacteria 5832
511 nmdc:mga05p37_40114_c1 3300050507 Bacteria 5749
512 nmdc:mga05p37_51427_c1 3300050507 Bacteria 5067
513 nmdc:mga05p37_530344_c1 3300050507 Bacteria 1345
514 nmdc:mga05p37_558326_c1 3300050507 Bacteria 1302
515 nmdc:mga05p37_59743_c1 3300050507 Bacteria 4694
516 nmdc:mga05p37_61744_c1 3300050507 Bacteria 4612
517 nmdc:mga05p37_6557_c1 3300050507 Bacteria 13718
518 nmdc:mga05p37_667701_c1 3300050507 Bacteria 1161
519 nmdc:mga05p37_8072_c1 3300050507 Bacteria 12436
520 nmdc:mga09592_119110_c1 3300050508 Bacteria 2267
521 nmdc:mga09592_12030_c1 3300050508 Bacteria 7041
522 nmdc:mga09592_180178_c1 3300050508 Bacteria 1828
523 nmdc:mga09592_34648_c1 3300050508 Bacteria 4221
524 nmdc:mga09592_49798_c1 3300050508 Bacteria 3532
525 nmdc:mga09592_573095_c1 3300050508 Bacteria 969
526 nmdc:mga09592_63447_c1 3300050508 Bacteria 3127
527 nmdc:mga09592_756_c1 3300050508 Bacteria 24845
528 nmdc:mga0qj67_158236_c1 3300050509 Bacteria 1839
529 nmdc:mga0qj67_177360_c1 3300050509 Bacteria 1730
530 nmdc:mga0qj67_3168_c1 3300050509 Bacteria 11850
531 nmdc:mga0qj67_59943_c1 3300050509 Bacteria 3019
532 nmdc:mga06r32_123785_c1 3300050510 Bacteria 2552
533 nmdc:mga06r32_1480_c1 3300050510 Bacteria 21119
534 nmdc:mga06r32_151117_c1 3300050510 Bacteria 2300
535 nmdc:mga06r32_15468_c1 3300050510 Bacteria 6926
536 nmdc:mga06r32_2066_c1 3300050510 Bacteria 17966
537 nmdc:mga06r32_267083_c1 3300050510 Bacteria 1698
538 nmdc:mga06r32_268_c1 3300050510 Bacteria 43133
539 nmdc:mga06r32_496707_c1 3300050510 Bacteria 1197
540 nmdc:mga06r32_602147_c1 3300050510 Bacteria 1070
541 nmdc:mga06r32_69358_c1 3300050510 Bacteria 3407
542 nmdc:mga06r32_87915_c1 3300050510 Bacteria 3033
543 nmdc:mga06r32_9211_c1 3300050510 Bacteria 8902
544 nmdc:mga06r32_95165_c1 3300050510 Bacteria 2915
545 nmdc:mga08y16_37350_c1 3300050511 Bacteria 5102
546 nmdc:mga08y16_40630_c1 3300050511 Bacteria 4874
547 nmdc:mga08y16_71147_c1 3300050511 Bacteria 3626
548 nmdc:mga0n895_125268_c1 3300050512 Bacteria 2593
549 nmdc:mga0n895_135622_c1 3300050512 Bacteria 2488
550 nmdc:mga0n895_19543_c1 3300050512 Bacteria 6299
551 nmdc:mga0n895_229892_c1 3300050512 Bacteria 1883
552 nmdc:mga0n895_24928_c1 3300050512 Bacteria 5644
553 nmdc:mga0n895_282502_c1 3300050512 Unclassified 957
554 nmdc:mga0n895_375616_c1 3300050512 Bacteria 1439
555 nmdc:mga0n895_42164_c1 3300050512 Bacteria 4440
556 nmdc:mga0n895_61989_c1 3300050512 Bacteria 3694
557 nmdc:mga0n895_83481_c1 3300050512 Bacteria 3187
558 nmdc:mga0rr50_10147_c1 3300050513 Bacteria 5963
559 nmdc:mga0rr50_12508_c1 3300050513 Bacteria 5490
560 nmdc:mga0rr50_1722_c1 3300050513 Bacteria 4305
561 nmdc:mga0rr50_25182_c1 3300050513 Bacteria 4133
562 nmdc:mga0rr50_374674_c1 3300050513 Unclassified 1200
563 nmdc:mga0rr50_399642_c1 3300050513 Bacteria 1161
564 nmdc:mga0rr50_44791_c1 3300050513 Bacteria 3247
565 nmdc:mga08x19_20926_c1 3300050514 Bacteria 4034
566 nmdc:mga08x19_239820_c1 3300050514 Unclassified 1249
567 nmdc:mga08x19_593245_c1 3300050514 Bacteria 785
568 nmdc:mga08x19_69029_c1 3300050514 Bacteria 2301
569 nmdc:mga0a205_10081_c1 3300050515 Bacteria 8671
570 nmdc:mga0a205_1221_c1 3300050515 Bacteria 21531
571 nmdc:mga0a205_225691_c1 3300050515 Bacteria 1758
572 nmdc:mga0a205_33610_c1 3300050515 Bacteria 4917
573 nmdc:mga0a205_3596_c1 3300050515 Bacteria 13873
574 nmdc:mga0a205_4281_c1 3300050515 Bacteria 12813
575 nmdc:mga0a205_50744_c1 3300050515 Bacteria 4005
576 nmdc:mga0a205_555018_c1 3300050515 Bacteria 1004
577 nmdc:mga0a205_60959_c1 3300050515 Bacteria 3644
578 nmdc:mga0a205_8830_c1 3300050515 Bacteria 9180
579 Ga0501084_0015866 3300054114 Bacteria 6249
580 Ga0501084_0025252 3300054114 Bacteria 4955
581 Ga0501084_0030529 3300054114 Bacteria 4506
582 Ga0501084_0034727 3300054114 Bacteria 4216
583 Ga0501084_0047767 3300054114 Bacteria 3584
584 Ga0501084_0053142 3300054114 Bacteria 3389
585 Ga0501084_0066038 3300054114 Bacteria 3027
586 Ga0501084_0117007 3300054114 Bacteria 2241
587 Ga0501084_0176117 3300054114 Bacteria 1805
588 Ga0501082_0000922 3300060353 Bacteria 25914
589 Ga0501082_0003964 3300060353 Bacteria 12924
590 Ga0501082_0008798 3300060353 Bacteria 8705
591 Ga0501082_0026098 3300060353 Bacteria 5035
592 Ga0501082_0031945 3300060353 Bacteria 4541
593 Ga0501082_0051210 3300060353 Bacteria 3559
594 Ga0501082_0084096 3300060353 Bacteria 2745
595 Ga0501082_0125599 3300060353 Bacteria 2225
596 Ga0501082_0142239 3300060353 Bacteria 2082
597 Ga0501082_0157190 3300060353 Bacteria 1975
598 Ga0501082_0215539 3300060353 Bacteria 1670
599 Ga0501082_0344477 3300060353 Unclassified 1299
600 Ga0501082_0385765 3300060353 Unclassified 1222
601 Ga0501082_0402345 3300060353 Bacteria 1195
602 Ga0530510_0000443 3300061734 Bacteria 26727
603 Ga0530510_0008495 3300061734 Bacteria 7161
604 Ga0530510_0010117 3300061734 Bacteria 6611
605 Ga0530510_0017507 3300061734 Bacteria 5079
606 Ga0530510_0022183 3300061734 Bacteria 4522
607 Ga0530510_0033882 3300061734 Bacteria 3677
608 Ga0530510_0042555 3300061734 Unclassified 3282
609 Ga0530510_0093248 3300061734 Bacteria 2198
610 Ga0530510_0098429 3300061734 Bacteria 2139
611 Ga0530510_0133552 3300061734 Bacteria 1827
612 Ga0530510_0582904 3300061734 Bacteria 850
613 Ga0111539_10605048
614 Ga0065707_10355609
615 Ga0070690_100056734
616 Ga0070670_100032578
617 Ga0068869_100002746
618 Ga0068869_100010742
619 Ga0068869_100016771
620 Ga0070666_10250938
621 Ga0070680_100001773
622 Ga0070680_100129163
623 Ga0070682_100000361
624 Ga0068868_100090823
625 Ga0070660_100000774
626 Ga0070689_100084368
627 Ga0070691_10030349
628 Ga0070691_10118053
629 Ga0070687_100128309
630 Ga0070661_100002097
631 Ga0070692_10000489
632 Ga0070692_10459696
633 Ga0070669_100494646
634 Ga0070671_100469049
635 Ga0070674_100097600
636 Ga0070673_100005335
637 Ga0070688_100098315
638 Ga0070659_100000893
639 Ga0070667_100610766
640 Ga0070703_10000963
641 Ga0070709_10047395
642 Ga0070713_100753537
643 Ga0070705_100000121
644 Ga0070705_100003686
645 Ga0070694_100001250
646 Ga0070694_100011038
647 Ga0070694_100020430
648 Ga0070694_100044784
649 Ga0070708_100000996
650 Ga0070708_100013711
651 Ga0070708_100019647
652 Ga0070708_100025885
653 Ga0070708_100026693
654 Ga0070708_100060310
655 Ga0070708_100902230
656 Ga0070663_100003284
657 Ga0070662_100088163
658 Ga0070662_100178955
659 Ga0070681_10002152
660 Ga0070681_10250259
661 Ga0068867_100014542
662 Ga0070706_100125222
663 Ga0070706_100242730
664 Ga0070706_100251400
665 Ga0070706_100252064
666 Ga0070707_100016761
667 Ga0070707_100016869
668 Ga0070707_100056008
669 Ga0070707_100061027
670 Ga0070707_100105229
671 Ga0070707_100404436
672 Ga0070698_100000760
673 Ga0070698_100017243
674 Ga0070698_100056494
675 Ga0070698_100068522
676 Ga0070698_100076922
677 Ga0070698_100155615
678 Ga0070698_100281027
679 Ga0070699_100003846
680 Ga0070699_100015886
681 Ga0070699_100033416
682 Ga0070699_100056060
683 Ga0070699_100062796
684 Ga0070699_100169824
685 Ga0070699_100328811
686 Ga0070699_100438226
687 Ga0070679_100001563
688 Ga0070684_100078114
689 Ga0070697_100001953
690 Ga0070697_100002594
691 Ga0070697_100010807
692 Ga0070697_100257139
693 Ga0070697_100500445
694 Ga0068853_100001571
695 Ga0070672_100006825
696 Ga0070686_100135574
697 Ga0070695_100004752
698 Ga0070695_100023457
699 Ga0070695_100040247
700 Ga0070695_100081037
701 Ga0070695_100148863
702 Ga0070696_100000744
703 Ga0070696_100031916
704 Ga0070696_100223471
705 Ga0070693_100000569
706 Ga0070704_100006298
707 Ga0070704_100019884
708 Ga0070704_100031992
709 Ga0070704_100112222
710 Ga0070704_100190867
711 Ga0070704_100516178
712 Ga0070664_100007639
713 Ga0068857_100005571
714 Ga0068857_100012639
715 Ga0068854_100006947
716 Ga0068856_100002868
717 Ga0068852_100372092
718 Ga0068859_100002856
719 Ga0068859_100024260
720 Ga0068859_100028506
721 Ga0068864_100003508
722 Ga0068861_100034541
723 Ga0068870_10004581
724 Ga0068870_10069700
725 Ga0068863_100043504
726 Ga0068863_100372013
727 Ga0068858_100051778
728 Ga0068860_100037495
729 Ga0068860_100113252
730 Ga0068860_100280913
731 Ga0068862_100175906
732 Ga0068862_100186546
733 Ga0081455_10001825
734 Ga0081455_10023848
735 Ga0081539_10000259
736 Ga0070716_100019728
737 Ga0070712_100013253
738 Ga0075428_100002633
739 Ga0075428_100005970
740 Ga0075428_100007156
741 Ga0075428_100039173
742 Ga0075428_100108133
743 Ga0075428_100182321
744 Ga0075430_100000104
745 Ga0075430_100000499
746 Ga0075430_100003206
747 Ga0075430_100089822
748 Ga0075430_100111029
749 Ga0075430_100150532
750 Ga0075431_100000176
751 Ga0075431_100000226
752 Ga0075431_100038668
753 Ga0075431_100054990
754 Ga0075431_100159292
755 Ga0075431_100212111
756 Ga0075431_100251695
757 Ga0075431_100504357
758 Ga0075433_10002922
759 Ga0075433_10004756
760 Ga0075433_10023995
761 Ga0075433_10040493
762 Ga0075433_10325495
763 Ga0075433_10646324
764 Ga0075433_10650102
765 Ga0075434_100001694
766 Ga0075434_100031556
767 Ga0075434_100046848
768 Ga0075434_100092103
769 Ga0075434_100104645
770 Ga0075434_100106513
771 Ga0075434_100144255
772 Ga0075434_100403252
773 Ga0075434_100579319
774 Ga0075429_100000299
775 Ga0075429_100001416
776 Ga0075429_100053700
777 Ga0075429_100106731
778 Ga0075429_100128029
779 Ga0075429_100156049
780 Ga0075429_100166205
781 Ga0075429_100246462
782 Ga0075429_100380727
783 Ga0068865_100180753
784 Ga0075436_100001627
785 Ga0075436_100420238
786 Ga0097620_100002855
787 Ga0097620_100024262
788 Ga0097620_100028506
789 Ga0075435_100002061
790 Ga0075435_100010051
791 Ga0075435_100017331
792 Ga0075435_100030315
793 Ga0075435_100163523
794 Ga0075435_100239263
795 Ga0075435_100554115
796 Ga0099794_10007722
797 Ga0099794_10026105
798 Ga0099794_10117677
799 Ga0111539_10000139
800 Ga0111539_10018531
801 Ga0111539_10064304
802 Ga0105247_10067988
803 Ga0114129_10003964
804 Ga0114129_10009508
805 Ga0114129_10032360
806 Ga0114129_10046302
807 Ga0114129_10054892
808 Ga0114129_10059567
809 Ga0114129_10085039
810 Ga0114129_10115253
811 Ga0114129_10148862
812 Ga0114129_10180738
813 Ga0114129_10184235
814 Ga0114129_10196443
815 Ga0114129_10245111
816 Ga0114129_10348224
817 Ga0114129_10940331
818 Ga0114129_11144208
819 Ga0114129_11616351
820 Ga0105243_10122111
821 Ga0105243_10450254
822 Ga0105241_10000226
823 Ga0105241_10010819
824 Ga0105241_10145800
825 Ga0105242_10008964
826 Ga0105242_10415160
827 Ga0105248_10154241
828 Ga0105248_10329247
829 Ga0105249_10090788
830 Ga0105249_10132601
831 Ga0105249_10318321
832 Ga0157373_10007885
833 Ga0157371_10240025
834 Ga0157369_10056965
835 Ga0157378_10186043
836 Ga0163162_10080333
837 Ga0163162_10495108
838 Ga0157372_10000368
839 Ga0157372_10132379
840 Ga0157375_10220042
841 Ga0157375_10311808
842 Ga0157375_10361799
843 Ga0157375_11078598
844 Ga0163163_10031406
845 Ga0157380_10076165
846 Ga0206356_11786192
847 Ga0207680_10234801
848 Ga0207647_10066901
849 Ga0207699_10030385
850 Ga0207645_10001584
851 Ga0207645_10088333
852 Ga0207643_10000263
853 Ga0207643_10047268
854 Ga0207684_10003709
855 Ga0207684_10004629
856 Ga0207684_10006841
857 Ga0207684_10012495
858 Ga0207684_10021091
859 Ga0207684_10068721
860 Ga0207684_10422595
861 Ga0207684_10634032
862 Ga0207654_10002663
863 Ga0207654_10028849
864 Ga0207707_10000092
865 Ga0207693_10003315
866 Ga0207663_10098006
867 Ga0207663_10403887
868 Ga0207660_10009278
869 Ga0207660_10018368
870 Ga0207660_10077132
871 Ga0207660_10086650
872 Ga0207662_10071030
873 Ga0207657_10000288
874 Ga0207649_10005261
875 Ga0207652_10000853
876 Ga0207646_10011619
877 Ga0207646_10013482
878 Ga0207646_10024288
879 Ga0207646_10029169
880 Ga0207646_10037320
881 Ga0207646_10068590
882 Ga0207646_10149528
883 Ga0207646_10297768
884 Ga0207646_10584843
885 Ga0207644_10476767
886 Ga0207690_10033151
887 Ga0207706_10005447
888 Ga0207706_10059395
889 Ga0207706_10152423
890 Ga0207686_10077766
891 Ga0207686_10172037
892 Ga0207709_10088201
893 Ga0207670_10084500
894 Ga0207670_10325464
895 Ga0207669_10689510
896 Ga0207704_10152472
897 Ga0207704_10187058
898 Ga0207665_10035680
899 Ga0207691_10016892
900 Ga0207691_10043900
901 Ga0207689_10000020
902 Ga0207689_10020939
903 Ga0207689_10030078
904 Ga0207679_10001128
905 Ga0207667_10003725
906 Ga0207651_10186187
907 Ga0207712_10022328
908 Ga0207712_10075022
909 Ga0207712_10314079
910 Ga0207658_10615987
911 Ga0207677_10147180
912 Ga0207639_10001053
913 Ga0207678_10004290
914 Ga0207708_10036989
915 Ga0207702_10001607
916 Ga0207641_10095039
917 Ga0207648_10040810
918 Ga0207648_10069779
919 Ga0207648_10100255
920 Ga0207674_10002451
921 Ga0207674_10008377
922 Ga0207675_100112368
923 Ga0207675_100549704
924 Ga0207675_100659130
925 Ga0209996_1005665
926 Ga0209984_1001643
927 Ga0209968_1001301
928 Ga0209999_1001813
929 Ga0209970_1013773
930 Ga0209983_1001052
931 Ga0209588_1013296
932 Ga0209971_1000153
933 Ga0209966_1000096
934 Ga0209998_10000233
935 Ga0209974_10004036
936 Ga0207428_10001002
937 Ga0207428_10036694
938 Ga0207428_10066709
939 Ga0268265_10053180
940 Ga0268265_10169859
941 Ga0268265_10192342
942 Ga0268265_10934874
943 Ga0268264_10009262
944 Ga0268264_10150749
945 Ga0268264_10543712
946 Ga0307408_100095702
947 Ga0307408_100730201
948 Ga0307413_10428528
949 Ga0307410_10498872
950 Ga0307416_100014762
951 Ga0373928_0023549
952 Ga0373949_0007330
953 Ga0373951_0010401
954 Ga0373932_0006671
955 Ga0373932_0061095
956 Ga0373932_0159843
957 Ga0373961_0027700
958 Ga0373962_0024609
959 Ga0373931_0063417
960 Ga0395900_0186552
961 Ga0395898_0007242
962 Ga0395901_0465857
963 Ga0439441_017471
964 Ga0439448_0137571
965 Ga0439463_028248
966 Ga0439459_0006198
967 Ga0439460_0000272
968 Ga0439460_0017837
969 Ga0451577_0050002
970 Ga0451577_0340544
971 Ga0451577_0621379
972 Ga0453683_0017570
973 Ga0453683_0035706
974 Ga0453683_0055344
975 Ga0453684_0076282
976 Ga0453684_0170347
977 Ga0453684_0202653
978 Ga0453684_0642643
979 Ga0451576_0033808
980 Ga0451576_0049643
981 Ga0451576_0116377
982 Ga0451576_0158661
983 Ga0451576_0180611
984 Ga0451576_0259136
985 Ga0451576_0757907
986 Ga0495580_0002329
987 Ga0495580_0043709
988 Ga0495594_0086945
989 Ga0495642_0014938
990 Ga0495656_0087748
991 Ga0495659_0009095
992 Ga0495659_0049523
993 Ga0495669_0044753
994 Ga0496102_0047602
995 Ga0496106_0103539
996 Ga0496112_0165582
997 Ga0501299_048942
998 Ga0501032_0162515
999 Ga0501033_0060565
1000 Ga0501036_0078252
1001 Ga0501036_0111854
1002 Ga0501037_0277621
1003 Ga0501038_0023208
1004 Ga0501038_0113792
1005 Ga0501038_0227448
1006 Ga0501038_0238932
1007 Ga0501039_0020944
1008 Ga0501039_0145053
1009 Ga0501039_0422031
1010 Ga0501039_0712515
1011 Ga0501040_0004023
1012 Ga0501040_0011971
1013 Ga0501040_0024346
1014 Ga0501040_0024881
1015 Ga0501040_0037737
1016 Ga0501040_0041032
1017 Ga0501040_0063679
1018 Ga0501040_0070436
1019 Ga0501040_0124146
1020 Ga0501041_0030431
1021 Ga0501041_0045912
1022 Ga0501041_0134236
1023 Ga0501041_0190905
1024 Ga0501042_0060214
1025 Ga0501042_0120664
1026 Ga0501042_0257134
1027 Ga0501046_0006412
1028 Ga0501046_0025677
1029 Ga0501046_0059676
1030 Ga0501046_0090159
1031 Ga0501046_0114348
1032 Ga0501046_0334581
1033 Ga0501047_0358748
1034 Ga0501048_0010258
1035 Ga0501048_0203855
1036 Ga0501048_0208415
1037 Ga0501048_0339779
1038 Ga0501067_0063812
1039 Ga0501068_0069537
1040 Ga0501068_0072159
1041 Ga0501068_0072313
1042 Ga0501068_0104057
1043 Ga0501069_0056510
1044 Ga0501070_0161708
1045 Ga0501070_0198290
1046 Ga0501070_0268131
1047 Ga0501071_0337123
1048 Ga0501071_0636100
1049 Ga0501072_0005549
1050 Ga0501072_0034745
1051 Ga0501072_0046794
1052 Ga0501072_0049212
1053 Ga0501072_0079849
1054 Ga0501072_0112079
1055 Ga0501072_0332838
1056 Ga0501073_0082251
1057 Ga0501074_0004382
1058 Ga0501074_0219334
1059 Ga0501074_0248037
1060 Ga0501074_0319173
1061 Ga0501075_0011720
1062 Ga0501075_0017477
1063 Ga0501075_0020838
1064 Ga0501075_0025734
1065 Ga0501075_0049210
1066 Ga0501075_0052693
1067 Ga0501075_0265039
1068 Ga0501075_0348527
1069 Ga0501076_0004216
1070 Ga0501076_0006916
1071 Ga0501076_0009909
1072 Ga0501076_0011632
1073 Ga0501076_0012002
1074 Ga0501076_0027100
1075 Ga0501077_0005608
1076 Ga0501077_0012311
1077 Ga0501077_0013541
1078 Ga0501077_0074349
1079 Ga0501077_0100307
1080 Ga0501077_0317615
1081 Ga0501079_0005563
1082 Ga0501079_0008453
1083 Ga0501079_0013762
1084 Ga0501079_0017647
1085 Ga0501079_0068861
1086 Ga0501080_0012544
1087 Ga0501080_0084381
1088 Ga0501080_0212487
1089 Ga0501080_0261980
1090 Ga0501080_0606450
1091 Ga0501081_0000736
1092 Ga0501081_0007606
1093 Ga0501081_0021885
1094 Ga0501081_0023404
1095 Ga0501081_0029969
1096 Ga0501081_0053847
1097 Ga0501081_0058201
1098 Ga0501081_0121756
1099 Ga0501081_0368873
1100 Ga0501081_0494941
1101 Ga0501083_0026315
1102 Ga0501083_0078429
1103 Ga0501035_0117174
1104 Ga0501035_0438610
1105 Ga0501045_0023238
1106 Ga0501045_0033681
1107 Ga0501045_0051781
1108 Ga0501045_0058741
1109 Ga0501045_0080726
1110 Ga0501045_0087396
1111 Ga0501045_0171786
1112 Ga0501045_0204590
1113 nmdc:mga05p37_117359_c1
1114 nmdc:mga05p37_1199_c1
1115 nmdc:mga05p37_1276_c1
1116 nmdc:mga05p37_142856_c1
1117 nmdc:mga05p37_227205_c2
1118 nmdc:mga05p37_25893_c1
1119 nmdc:mga05p37_276902_c1
1120 nmdc:mga05p37_306123_c1
1121 nmdc:mga05p37_344977_c1
1122 nmdc:mga05p37_38951_c1
1123 nmdc:mga05p37_40114_c1
1124 nmdc:mga05p37_51427_c1
1125 nmdc:mga05p37_530344_c1
1126 nmdc:mga05p37_558326_c1
1127 nmdc:mga05p37_59743_c1
1128 nmdc:mga05p37_61744_c1
1129 nmdc:mga05p37_6557_c1
1130 nmdc:mga05p37_667701_c1
1131 nmdc:mga05p37_8072_c1
1132 nmdc:mga09592_119110_c1
1133 nmdc:mga09592_12030_c1
1134 nmdc:mga09592_180178_c1
1135 nmdc:mga09592_34648_c1
1136 nmdc:mga09592_49798_c1
1137 nmdc:mga09592_573095_c1
1138 nmdc:mga09592_63447_c1
1139 nmdc:mga09592_756_c1
1140 nmdc:mga0qj67_158236_c1
1141 nmdc:mga0qj67_177360_c1
1142 nmdc:mga0qj67_3168_c1
1143 nmdc:mga0qj67_59943_c1
1144 nmdc:mga06r32_123785_c1
1145 nmdc:mga06r32_1480_c1
1146 nmdc:mga06r32_151117_c1
1147 nmdc:mga06r32_15468_c1
1148 nmdc:mga06r32_2066_c1
1149 nmdc:mga06r32_267083_c1
1150 nmdc:mga06r32_268_c1
1151 nmdc:mga06r32_496707_c1
1152 nmdc:mga06r32_602147_c1
1153 nmdc:mga06r32_69358_c1
1154 nmdc:mga06r32_87915_c1
1155 nmdc:mga06r32_9211_c1
1156 nmdc:mga06r32_95165_c1
1157 nmdc:mga08y16_37350_c1
1158 nmdc:mga08y16_40630_c1
1159 nmdc:mga08y16_71147_c1
1160 nmdc:mga0n895_125268_c1
1161 nmdc:mga0n895_135622_c1
1162 nmdc:mga0n895_19543_c1
1163 nmdc:mga0n895_229892_c1
1164 nmdc:mga0n895_24928_c1
1165 nmdc:mga0n895_282502_c1
1166 nmdc:mga0n895_375616_c1
1167 nmdc:mga0n895_42164_c1
1168 nmdc:mga0n895_61989_c1
1169 nmdc:mga0n895_83481_c1
1170 nmdc:mga0rr50_10147_c1
1171 nmdc:mga0rr50_12508_c1
1172 nmdc:mga0rr50_1722_c1
1173 nmdc:mga0rr50_25182_c1
1174 nmdc:mga0rr50_374674_c1
1175 nmdc:mga0rr50_399642_c1
1176 nmdc:mga0rr50_44791_c1
1177 nmdc:mga08x19_20926_c1
1178 nmdc:mga08x19_239820_c1
1179 nmdc:mga08x19_593245_c1
1180 nmdc:mga08x19_69029_c1
1181 nmdc:mga0a205_10081_c1
1182 nmdc:mga0a205_1221_c1
1183 nmdc:mga0a205_225691_c1
1184 nmdc:mga0a205_33610_c1
1185 nmdc:mga0a205_3596_c1
1186 nmdc:mga0a205_4281_c1
1187 nmdc:mga0a205_50744_c1
1188 nmdc:mga0a205_555018_c1
1189 nmdc:mga0a205_60959_c1
1190 nmdc:mga0a205_8830_c1
1191 Ga0501084_0015866
1192 Ga0501084_0025252
1193 Ga0501084_0030529
1194 Ga0501084_0034727
1195 Ga0501084_0047767
1196 Ga0501084_0053142
1197 Ga0501084_0066038
1198 Ga0501084_0117007
1199 Ga0501084_0176117
1200 Ga0501082_0000922
1201 Ga0501082_0003964
1202 Ga0501082_0008798
1203 Ga0501082_0026098
1204 Ga0501082_0031945
1205 Ga0501082_0051210
1206 Ga0501082_0084096
1207 Ga0501082_0125599
1208 Ga0501082_0142239
1209 Ga0501082_0157190
1210 Ga0501082_0215539
1211 Ga0501082_0344477
1212 Ga0501082_0385765
1213 Ga0501082_0402345
1214 Ga0530510_0000443
1215 Ga0530510_0008495
1216 Ga0530510_0010117
1217 Ga0530510_0017507
1218 Ga0530510_0022183
1219 Ga0530510_0033882
1220 Ga0530510_0042555
1221 Ga0530510_0093248
1222 Ga0530510_0098429
1223 Ga0530510_0133552
1224 Ga0530510_0582904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

23

151

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9091 17 247
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.8891 17 247
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8889 9 245
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.8855 17 247
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8749 9 245
ID Description Score Start End Superfamily
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8869 10 245 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8849 17 247 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8625 10 245 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8339 16 249 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8322 15 249 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A2V6ZCI0-F1-model_v4 PIG-L family deacetylase 0.9731 71 249
AF-A0A1Q7GDT3-F1-model_v4 PIG-L domain-containing protein 0.9726 21 249 GO:0016811
AF-A0A2V7E2D4-F1-model_v4 PIG-L family deacetylase 0.9709 3 249 GO:0016811
AF-A0A1Q7GDT3-F1-model_v4 PIG-L domain-containing protein 0.9685 21 249 GO:0016811
AF-A0A7C3M1J2-F1-model_v4 PIG-L family deacetylase 0.9674 14 122 GO:0016811

Map