F469101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 299 | 585 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0071418|Ga0501048_0071418_685_2145 |
| Length | 486 |
| Sequence | MRLPALEGVDGMIQHSRSNGLRPFWSSRKRTDLGRHFIRTRIDIMTSAGPNEMPSDEELGKDLHNFIAELYPICRSITGEGVRQTLRAIRKRIPLEMFEVPSGTKVFDWTVPLEWNVKDAYVMNREGERVVDFKAHNLHLMSYSAPVRKKMSLAELRPHLFTLPNHPEWIPYRTSYYKESWGFCLRHANLEQLSDDEYEVVIDSSFHSGSLTYGEFCVPGEMSDEILVSCHVCHPSMCNDNLSGITVAVKLAETMAARPRRYSYRFLFIPGTIGSITWLAQNEQMVSRIKHGLVLTGVGDAGNVTYKKSRKGNAEIDRAMAHVLKHSGKAYTMIDFFPYGYDERQYCSPGFDLPVGCFMRTPHGQYTEYHSSADNLDFVKAESLVQSYGECLKAFELLEANRMYMNQNPKCEPQLGRRGLYRSVAGQQEKQWTELALFWVLNASDGHHTLLDIAERADLPFGHIQSATNALLEVGLLQECQRPGNC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 2 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 3 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 4 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 5 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 6 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 7 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 8 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 9 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 10 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 11 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 12 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 13 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 14 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 15 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 16 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 17 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 18 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 19 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 20 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 21 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 22 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 23 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 24 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 189 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 190 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 191 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 285 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 288 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 293 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 295 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 298 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 299 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.74 |
| Metatranscriptomes | 0 |
| Isolates | 4.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.09 |
| Nodule | 1.15 |
| Rhizoplane | 4.58 |
| Rhizosphere | 83.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10011688 | 3300003203 | Bacteria | 3839 |
| 2 | rootH2_10148679 | 3300003320 | Bacteria | 2726 |
| 3 | rootL2_10023383 | 3300003322 | Bacteria | 9730 |
| 4 | rootL2_10049817 | 3300003322 | Bacteria | 1711 |
| 5 | rootH1_10252599 | 3300003323 | Bacteria | 3266 |
| 6 | rootH1_10339880 | 3300003323 | Bacteria | 3576 |
| 7 | JGI25407J50210_10004743 | 3300003373 | Bacteria | 3318 |
| 8 | Ga0065712_10073889 | 3300005290 | Bacteria | 4251 |
| 9 | Ga0065715_10000174 | 3300005293 | Bacteria | 48416 |
| 10 | Ga0065707_10113639 | 3300005295 | Bacteria | 2321 |
| 11 | Ga0070658_10123749 | 3300005327 | Bacteria | 2151 |
| 12 | Ga0070676_10001826 | 3300005328 | Bacteria | 10829 |
| 13 | Ga0070676_10014946 | 3300005328 | Bacteria | 4273 |
| 14 | Ga0070676_10015035 | 3300005328 | Bacteria | 4264 |
| 15 | Ga0070683_100012713 | 3300005329 | Bacteria | 7320 |
| 16 | Ga0070683_100097143 | 3300005329 | Bacteria | 2771 |
| 17 | Ga0070670_100012584 | 3300005331 | Bacteria | 7243 |
| 18 | Ga0070670_100081499 | 3300005331 | Unclassified | 2780 |
| 19 | Ga0068869_100005780 | 3300005334 | Bacteria | 7804 |
| 20 | Ga0070666_10021962 | 3300005335 | Bacteria | 4140 |
| 21 | Ga0070682_100005312 | 3300005337 | Bacteria | 7167 |
| 22 | Ga0070660_100007356 | 3300005339 | Bacteria | 7672 |
| 23 | Ga0070660_100133021 | 3300005339 | Bacteria | 1991 |
| 24 | Ga0070689_100012177 | 3300005340 | Bacteria | 6187 |
| 25 | Ga0070689_100240204 | 3300005340 | Unclassified | 1492 |
| 26 | Ga0070691_10032015 | 3300005341 | Bacteria | 2469 |
| 27 | Ga0070661_100011204 | 3300005344 | Bacteria | 6247 |
| 28 | Ga0070668_100012740 | 3300005347 | Bacteria | 6258 |
| 29 | Ga0070668_100018462 | 3300005347 | Bacteria | 5236 |
| 30 | Ga0070668_100105242 | 3300005347 | Bacteria | 2240 |
| 31 | Ga0070668_100134103 | 3300005347 | Bacteria | 1990 |
| 32 | Ga0070669_100009145 | 3300005353 | Bacteria | 7061 |
| 33 | Ga0070669_100119079 | 3300005353 | Bacteria | 2012 |
| 34 | Ga0070675_100004047 | 3300005354 | Bacteria | 11129 |
| 35 | Ga0070675_100009586 | 3300005354 | Bacteria | 7537 |
| 36 | Ga0070675_100010451 | 3300005354 | Bacteria | 7251 |
| 37 | Ga0070675_100019620 | 3300005354 | Bacteria | 5388 |
| 38 | Ga0070675_100046141 | 3300005354 | Bacteria | 3567 |
| 39 | Ga0070675_100067291 | 3300005354 | Unclassified | 2964 |
| 40 | Ga0070675_100069664 | 3300005354 | Bacteria | 2915 |
| 41 | Ga0070671_100002729 | 3300005355 | Bacteria | 13705 |
| 42 | Ga0070671_100012387 | 3300005355 | Bacteria | 6867 |
| 43 | Ga0070674_100013879 | 3300005356 | Bacteria | 4992 |
| 44 | Ga0070673_100002710 | 3300005364 | Bacteria | 10858 |
| 45 | Ga0070673_100028244 | 3300005364 | Bacteria | 4169 |
| 46 | Ga0070673_100240045 | 3300005364 | Bacteria | 1575 |
| 47 | Ga0070688_100040025 | 3300005365 | Unclassified | 2870 |
| 48 | Ga0070688_100064522 | 3300005365 | Bacteria | 2324 |
| 49 | Ga0070667_100010040 | 3300005367 | Bacteria | 7845 |
| 50 | Ga0070667_100035403 | 3300005367 | Bacteria | 4182 |
| 51 | Ga0070709_10008665 | 3300005434 | Bacteria | 5595 |
| 52 | Ga0070700_100043732 | 3300005441 | Bacteria | 2756 |
| 53 | Ga0070678_100007881 | 3300005456 | Bacteria | 6339 |
| 54 | Ga0070678_100082698 | 3300005456 | Unclassified | 2438 |
| 55 | Ga0070681_10001710 | 3300005458 | Bacteria | 19643 |
| 56 | Ga0070681_10047867 | 3300005458 | Bacteria | 4274 |
| 57 | Ga0070681_10056799 | 3300005458 | Bacteria | 3895 |
| 58 | Ga0070681_10101142 | 3300005458 | Bacteria | 2828 |
| 59 | Ga0068867_100005112 | 3300005459 | Bacteria | 9269 |
| 60 | Ga0068867_100043028 | 3300005459 | Bacteria | 3306 |
| 61 | Ga0070685_10006771 | 3300005466 | Bacteria | 5847 |
| 62 | Ga0070685_10132508 | 3300005466 | Unclassified | 1560 |
| 63 | Ga0070707_100000358 | 3300005468 | Bacteria | 44828 |
| 64 | Ga0070698_100029949 | 3300005471 | Bacteria | 5648 |
| 65 | Ga0070698_100030202 | 3300005471 | Bacteria | 5621 |
| 66 | Ga0070699_100002557 | 3300005518 | Bacteria | 16330 |
| 67 | Ga0070699_100020246 | 3300005518 | Bacteria | 5736 |
| 68 | Ga0070699_100042906 | 3300005518 | Bacteria | 3915 |
| 69 | Ga0070679_100016854 | 3300005530 | Bacteria | 7062 |
| 70 | Ga0070679_100030697 | 3300005530 | Bacteria | 5308 |
| 71 | Ga0070679_100203828 | 3300005530 | Bacteria | 1943 |
| 72 | Ga0070684_100012529 | 3300005535 | Bacteria | 6802 |
| 73 | Ga0070684_100029313 | 3300005535 | Bacteria | 4662 |
| 74 | Ga0070684_100100769 | 3300005535 | Bacteria | 2580 |
| 75 | Ga0068853_100000804 | 3300005539 | Bacteria | 21823 |
| 76 | Ga0068853_100045751 | 3300005539 | Bacteria | 3749 |
| 77 | Ga0070672_100010203 | 3300005543 | Bacteria | 6506 |
| 78 | Ga0070672_100023669 | 3300005543 | Bacteria | 4530 |
| 79 | Ga0070696_100104890 | 3300005546 | Bacteria | 2030 |
| 80 | Ga0070665_100016444 | 3300005548 | Bacteria | 7417 |
| 81 | Ga0070665_100132038 | 3300005548 | Bacteria | 2499 |
| 82 | Ga0068855_100075189 | 3300005563 | Bacteria | 3923 |
| 83 | Ga0068855_100355637 | 3300005563 | Unclassified | 1612 |
| 84 | Ga0070664_100056686 | 3300005564 | Bacteria | 3329 |
| 85 | Ga0070664_100060363 | 3300005564 | Bacteria | 3229 |
| 86 | Ga0070664_100112941 | 3300005564 | Bacteria | 2373 |
| 87 | Ga0070664_100266915 | 3300005564 | Bacteria | 1541 |
| 88 | Ga0068857_100004115 | 3300005577 | Bacteria | 12259 |
| 89 | Ga0068852_100043933 | 3300005616 | Bacteria | 3792 |
| 90 | Ga0068852_100092307 | 3300005616 | Bacteria | 2711 |
| 91 | Ga0068859_100002746 | 3300005617 | Bacteria | 17844 |
| 92 | Ga0068859_100024104 | 3300005617 | Bacteria | 6106 |
| 93 | Ga0068859_100085637 | 3300005617 | Bacteria | 3197 |
| 94 | Ga0068859_100118403 | 3300005617 | Unclassified | 2714 |
| 95 | Ga0068861_100191462 | 3300005719 | Bacteria | 1710 |
| 96 | Ga0068851_10003920 | 3300005834 | Bacteria | 6662 |
| 97 | Ga0068870_10017270 | 3300005840 | Bacteria | 3464 |
| 98 | Ga0068858_100000162 | 3300005842 | Bacteria | 71107 |
| 99 | Ga0068858_100031212 | 3300005842 | Bacteria | 4948 |
| 100 | Ga0068858_100051726 | 3300005842 | Unclassified | 3801 |
| 101 | Ga0068858_100060263 | 3300005842 | Bacteria | 3508 |
| 102 | Ga0068858_100252829 | 3300005842 | Bacteria | 1674 |
| 103 | Ga0068860_100264790 | 3300005843 | Bacteria | 1676 |
| 104 | Ga0068862_100000909 | 3300005844 | Bacteria | 28692 |
| 105 | Ga0081455_10007276 | 3300005937 | Bacteria | 11682 |
| 106 | Ga0081455_10014788 | 3300005937 | Bacteria | 7614 |
| 107 | Ga0081538_10000046 | 3300005981 | Bacteria | 114285 |
| 108 | Ga0081538_10000244 | 3300005981 | Bacteria | 61457 |
| 109 | Ga0081538_10000642 | 3300005981 | Bacteria | 38717 |
| 110 | Ga0081538_10000783 | 3300005981 | Bacteria | 34707 |
| 111 | Ga0081538_10001180 | 3300005981 | Bacteria | 27546 |
| 112 | Ga0081538_10019105 | 3300005981 | Bacteria | 5113 |
| 113 | Ga0081538_10058253 | 3300005981 | Bacteria | 2242 |
| 114 | Ga0081538_10061157 | 3300005981 | Bacteria | 2159 |
| 115 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 116 | Ga0081539_10003969 | 3300005985 | Bacteria | 17115 |
| 117 | Ga0081539_10054751 | 3300005985 | Bacteria | 2225 |
| 118 | Ga0070717_10035209 | 3300006028 | Unclassified | 4051 |
| 119 | Ga0075363_100008827 | 3300006048 | Bacteria | 4715 |
| 120 | Ga0075364_10017736 | 3300006051 | Bacteria | 4452 |
| 121 | Ga0075362_10004057 | 3300006177 | Bacteria | 5217 |
| 122 | Ga0075367_10052715 | 3300006178 | Bacteria | 2408 |
| 123 | Ga0075366_10012587 | 3300006195 | Bacteria | 4803 |
| 124 | Ga0097621_100009693 | 3300006237 | Bacteria | 7005 |
| 125 | Ga0097621_100178619 | 3300006237 | Unclassified | 1833 |
| 126 | Ga0068871_100053710 | 3300006358 | Bacteria | 3267 |
| 127 | Ga0068871_100146038 | 3300006358 | Bacteria | 2014 |
| 128 | Ga0075428_100006634 | 3300006844 | Bacteria | 12872 |
| 129 | Ga0075428_100027750 | 3300006844 | Bacteria | 6263 |
| 130 | Ga0075428_100052918 | 3300006844 | Bacteria | 4448 |
| 131 | Ga0075428_100054082 | 3300006844 | Unclassified | 4399 |
| 132 | Ga0075428_100092687 | 3300006844 | Bacteria | 3293 |
| 133 | Ga0075428_100176180 | 3300006844 | Bacteria | 2316 |
| 134 | Ga0075428_100261096 | 3300006844 | Bacteria | 1865 |
| 135 | Ga0075428_100303402 | 3300006844 | Bacteria | 1717 |
| 136 | Ga0075430_100001319 | 3300006846 | Bacteria | 20034 |
| 137 | Ga0075430_100005418 | 3300006846 | Bacteria | 10780 |
| 138 | Ga0075430_100014302 | 3300006846 | Bacteria | 6762 |
| 139 | Ga0075430_100046779 | 3300006846 | Bacteria | 3654 |
| 140 | Ga0075430_100063657 | 3300006846 | Bacteria | 3097 |
| 141 | Ga0075430_100144898 | 3300006846 | Bacteria | 1979 |
| 142 | Ga0075431_100001013 | 3300006847 | Bacteria | 25006 |
| 143 | Ga0075431_100006560 | 3300006847 | Bacteria | 11563 |
| 144 | Ga0075431_100031930 | 3300006847 | Bacteria | 5425 |
| 145 | Ga0075431_100048503 | 3300006847 | Bacteria | 4380 |
| 146 | Ga0075431_100177348 | 3300006847 | Bacteria | 2188 |
| 147 | Ga0075431_100185344 | 3300006847 | Bacteria | 2134 |
| 148 | Ga0075431_100208135 | 3300006847 | Bacteria | 1999 |
| 149 | Ga0075431_100237148 | 3300006847 | Bacteria | 1857 |
| 150 | Ga0075433_10014086 | 3300006852 | Bacteria | 6520 |
| 151 | Ga0075433_10084192 | 3300006852 | Bacteria | 2807 |
| 152 | Ga0075434_100001803 | 3300006871 | Bacteria | 18515 |
| 153 | Ga0075434_100002123 | 3300006871 | Bacteria | 17253 |
| 154 | Ga0075434_100179957 | 3300006871 | Unclassified | 2134 |
| 155 | Ga0075429_100001229 | 3300006880 | Bacteria | 20798 |
| 156 | Ga0075429_100007253 | 3300006880 | Bacteria | 9618 |
| 157 | Ga0075429_100019270 | 3300006880 | Bacteria | 5909 |
| 158 | Ga0075429_100049463 | 3300006880 | Bacteria | 3655 |
| 159 | Ga0075429_100064360 | 3300006880 | Bacteria | 3194 |
| 160 | Ga0075429_100099768 | 3300006880 | Bacteria | 2534 |
| 161 | Ga0075429_100115671 | 3300006880 | Bacteria | 2345 |
| 162 | Ga0097620_100002746 | 3300006931 | Bacteria | 17844 |
| 163 | Ga0097620_100024104 | 3300006931 | Bacteria | 6106 |
| 164 | Ga0097620_100085625 | 3300006931 | Bacteria | 3197 |
| 165 | Ga0097620_100118394 | 3300006931 | Unclassified | 2714 |
| 166 | Ga0075435_100006393 | 3300007076 | Bacteria | 8330 |
| 167 | Ga0075435_100013993 | 3300007076 | Bacteria | 5983 |
| 168 | Ga0105240_10011457 | 3300009093 | Bacteria | 12347 |
| 169 | Ga0105240_10031302 | 3300009093 | Bacteria | 6901 |
| 170 | Ga0111539_10010935 | 3300009094 | Bacteria | 11423 |
| 171 | Ga0111539_10011267 | 3300009094 | Bacteria | 11234 |
| 172 | Ga0111539_10026766 | 3300009094 | Bacteria | 7047 |
| 173 | Ga0111539_10061346 | 3300009094 | Bacteria | 4455 |
| 174 | Ga0111539_10105836 | 3300009094 | Bacteria | 3300 |
| 175 | Ga0111539_10106140 | 3300009094 | Bacteria | 3295 |
| 176 | Ga0111539_10172635 | 3300009094 | Bacteria | 2526 |
| 177 | Ga0111539_10173933 | 3300009094 | Unclassified | 2515 |
| 178 | Ga0111539_10545837 | 3300009094 | Bacteria | 1350 |
| 179 | Ga0105245_10218785 | 3300009098 | Bacteria | 1837 |
| 180 | Ga0105245_10274077 | 3300009098 | Bacteria | 1647 |
| 181 | Ga0105247_10000913 | 3300009101 | Bacteria | 22156 |
| 182 | Ga0105247_10001875 | 3300009101 | Bacteria | 14722 |
| 183 | Ga0114129_10000163 | 3300009147 | Bacteria | 71730 |
| 184 | Ga0114129_10014221 | 3300009147 | Bacteria | 11340 |
| 185 | Ga0114129_10019473 | 3300009147 | Bacteria | 9664 |
| 186 | Ga0114129_10020657 | 3300009147 | Bacteria | 9361 |
| 187 | Ga0114129_10024176 | 3300009147 | Bacteria | 8611 |
| 188 | Ga0114129_10057331 | 3300009147 | Bacteria | 5452 |
| 189 | Ga0114129_10070367 | 3300009147 | Bacteria | 4878 |
| 190 | Ga0114129_10152195 | 3300009147 | Bacteria | 3165 |
| 191 | Ga0114129_10366579 | 3300009147 | Bacteria | 1905 |
| 192 | Ga0105241_10169265 | 3300009174 | Bacteria | 1803 |
| 193 | Ga0105242_10032645 | 3300009176 | Bacteria | 4164 |
| 194 | Ga0105242_10182824 | 3300009176 | Bacteria | 1851 |
| 195 | Ga0105248_10007736 | 3300009177 | Bacteria | 11803 |
| 196 | Ga0105237_10006095 | 3300009545 | Bacteria | 13480 |
| 197 | Ga0105237_10037862 | 3300009545 | Bacteria | 4873 |
| 198 | Ga0105237_10065026 | 3300009545 | Bacteria | 3644 |
| 199 | Ga0105238_10000679 | 3300009551 | Bacteria | 35795 |
| 200 | Ga0105238_10003664 | 3300009551 | Bacteria | 15310 |
| 201 | Ga0105249_10008095 | 3300009553 | Bacteria | 9166 |
| 202 | Ga0105239_10010253 | 3300010375 | Bacteria | 10493 |
| 203 | Ga0105246_10005664 | 3300011119 | Bacteria | 7622 |
| 204 | Ga0105246_10046978 | 3300011119 | Bacteria | 2947 |
| 205 | Ga0157370_10005882 | 3300013104 | Bacteria | 13674 |
| 206 | Ga0157369_10000744 | 3300013105 | Bacteria | 42014 |
| 207 | Ga0157369_10001683 | 3300013105 | Bacteria | 26984 |
| 208 | Ga0157369_10110065 | 3300013105 | Bacteria | 2928 |
| 209 | Ga0157374_10001080 | 3300013296 | Bacteria | 23602 |
| 210 | Ga0157374_10006463 | 3300013296 | Bacteria | 9947 |
| 211 | Ga0157374_10010229 | 3300013296 | Bacteria | 8068 |
| 212 | Ga0157374_10013896 | 3300013296 | Bacteria | 7035 |
| 213 | Ga0157374_10033354 | 3300013296 | Bacteria | 4698 |
| 214 | Ga0157374_10104578 | 3300013296 | Bacteria | 2718 |
| 215 | Ga0157374_10229227 | 3300013296 | Unclassified | 1824 |
| 216 | Ga0157378_10017330 | 3300013297 | Bacteria | 6319 |
| 217 | Ga0157378_10020306 | 3300013297 | Bacteria | 5843 |
| 218 | Ga0157378_10044857 | 3300013297 | Unclassified | 3927 |
| 219 | Ga0157378_10172811 | 3300013297 | Unclassified | 2028 |
| 220 | Ga0163162_10007245 | 3300013306 | Bacteria | 10766 |
| 221 | Ga0163162_10011825 | 3300013306 | Bacteria | 8515 |
| 222 | Ga0163162_10054106 | 3300013306 | Bacteria | 4036 |
| 223 | Ga0157372_10289128 | 3300013307 | Bacteria | 1906 |
| 224 | Ga0157375_10010387 | 3300013308 | Bacteria | 8198 |
| 225 | Ga0157375_10028139 | 3300013308 | Bacteria | 5263 |
| 226 | Ga0157375_10051322 | 3300013308 | Bacteria | 4050 |
| 227 | Ga0163163_10001522 | 3300014325 | Bacteria | 19554 |
| 228 | Ga0163163_10017185 | 3300014325 | Bacteria | 6741 |
| 229 | Ga0157380_10083037 | 3300014326 | Unclassified | 2623 |
| 230 | Ga0157380_10152593 | 3300014326 | Bacteria | 1999 |
| 231 | Ga0157379_10000355 | 3300014968 | Bacteria | 36758 |
| 232 | Ga0157379_10029980 | 3300014968 | Bacteria | 4838 |
| 233 | Ga0157376_10032003 | 3300014969 | Bacteria | 4218 |
| 234 | Ga0157376_10128871 | 3300014969 | Bacteria | 2255 |
| 235 | Ga0209257_1018208 | 3300025304 | Bacteria | 2718 |
| 236 | Ga0207697_10000619 | 3300025315 | Bacteria | 20144 |
| 237 | Ga0207697_10004290 | 3300025315 | Bacteria | 6837 |
| 238 | Ga0207697_10005063 | 3300025315 | Bacteria | 6172 |
| 239 | Ga0207656_10011654 | 3300025321 | Bacteria | 3326 |
| 240 | Ga0207710_10000019 | 3300025900 | Bacteria | 339682 |
| 241 | Ga0207688_10005446 | 3300025901 | Bacteria | 6918 |
| 242 | Ga0207680_10043715 | 3300025903 | Bacteria | 2629 |
| 243 | Ga0207647_10000980 | 3300025904 | Bacteria | 22136 |
| 244 | Ga0207699_10051285 | 3300025906 | Bacteria | 2437 |
| 245 | Ga0207645_10005993 | 3300025907 | Bacteria | 8749 |
| 246 | Ga0207645_10006095 | 3300025907 | Bacteria | 8668 |
| 247 | Ga0207705_10068427 | 3300025909 | Bacteria | 2571 |
| 248 | Ga0207684_10035364 | 3300025910 | Unclassified | 4242 |
| 249 | Ga0207707_10019922 | 3300025912 | Bacteria | 5855 |
| 250 | Ga0207707_10085693 | 3300025912 | Bacteria | 2753 |
| 251 | Ga0207671_10013147 | 3300025914 | Bacteria | 6611 |
| 252 | Ga0207671_10171175 | 3300025914 | Bacteria | 1687 |
| 253 | Ga0207693_10155172 | 3300025915 | Bacteria | 1800 |
| 254 | Ga0207660_10079089 | 3300025917 | Bacteria | 2411 |
| 255 | Ga0207657_10000717 | 3300025919 | Bacteria | 35166 |
| 256 | Ga0207652_10002172 | 3300025921 | Bacteria | 16777 |
| 257 | Ga0207652_10013614 | 3300025921 | Bacteria | 6577 |
| 258 | Ga0207652_10049979 | 3300025921 | Unclassified | 3582 |
| 259 | Ga0207652_10236203 | 3300025921 | Bacteria | 1648 |
| 260 | Ga0207646_10000008 | 3300025922 | Bacteria | 457143 |
| 261 | Ga0207646_10000009 | 3300025922 | Bacteria | 453146 |
| 262 | Ga0207681_10038290 | 3300025923 | Bacteria | 3176 |
| 263 | Ga0207681_10066978 | 3300025923 | Bacteria | 2488 |
| 264 | Ga0207694_10007672 | 3300025924 | Bacteria | 8172 |
| 265 | Ga0207694_10077483 | 3300025924 | Bacteria | 2605 |
| 266 | Ga0207659_10004027 | 3300025926 | Bacteria | 8865 |
| 267 | Ga0207659_10019474 | 3300025926 | Bacteria | 4469 |
| 268 | Ga0207659_10038362 | 3300025926 | Unclassified | 3332 |
| 269 | Ga0207659_10061024 | 3300025926 | Bacteria | 2716 |
| 270 | Ga0207659_10115396 | 3300025926 | Bacteria | 2048 |
| 271 | Ga0207687_10185661 | 3300025927 | Bacteria | 1614 |
| 272 | Ga0207644_10061184 | 3300025931 | Bacteria | 2726 |
| 273 | Ga0207644_10101394 | 3300025931 | Bacteria | 2163 |
| 274 | Ga0207690_10062260 | 3300025932 | Bacteria | 2539 |
| 275 | Ga0207706_10016300 | 3300025933 | Bacteria | 6710 |
| 276 | Ga0207706_10099830 | 3300025933 | Bacteria | 2554 |
| 277 | Ga0207686_10084288 | 3300025934 | Bacteria | 2082 |
| 278 | Ga0207670_10018592 | 3300025936 | Bacteria | 4229 |
| 279 | Ga0207670_10197721 | 3300025936 | Bacteria | 1525 |
| 280 | Ga0207669_10010949 | 3300025937 | Bacteria | 4390 |
| 281 | Ga0207691_10001669 | 3300025940 | Bacteria | 21966 |
| 282 | Ga0207691_10004830 | 3300025940 | Bacteria | 13038 |
| 283 | Ga0207691_10010462 | 3300025940 | Bacteria | 8899 |
| 284 | Ga0207691_10103100 | 3300025940 | Bacteria | 2544 |
| 285 | Ga0207691_10188881 | 3300025940 | Unclassified | 1798 |
| 286 | Ga0207689_10021724 | 3300025942 | Bacteria | 5398 |
| 287 | Ga0207661_10008495 | 3300025944 | Bacteria | 7340 |
| 288 | Ga0207679_10061185 | 3300025945 | Unclassified | 2802 |
| 289 | Ga0207679_10068786 | 3300025945 | Bacteria | 2662 |
| 290 | Ga0207679_10078358 | 3300025945 | Bacteria | 2517 |
| 291 | Ga0207667_10005568 | 3300025949 | Bacteria | 15371 |
| 292 | Ga0207667_10156179 | 3300025949 | Bacteria | 2347 |
| 293 | Ga0207658_10011282 | 3300025986 | Bacteria | 6085 |
| 294 | Ga0207703_10000013 | 3300026035 | Bacteria | 305126 |
| 295 | Ga0207703_10053619 | 3300026035 | Bacteria | 3278 |
| 296 | Ga0207639_10209178 | 3300026041 | Bacteria | 1678 |
| 297 | Ga0207678_10006667 | 3300026067 | Bacteria | 10234 |
| 298 | Ga0207708_10042773 | 3300026075 | Bacteria | 3453 |
| 299 | Ga0207708_10136537 | 3300026075 | Bacteria | 1921 |
| 300 | Ga0207708_10215919 | 3300026075 | Unclassified | 1535 |
| 301 | Ga0207641_10044169 | 3300026088 | Bacteria | 3747 |
| 302 | Ga0207641_10288615 | 3300026088 | Bacteria | 1546 |
| 303 | Ga0207648_10006007 | 3300026089 | Bacteria | 12124 |
| 304 | Ga0207648_10034358 | 3300026089 | Bacteria | 4470 |
| 305 | Ga0207674_10004212 | 3300026116 | Bacteria | 17356 |
| 306 | Ga0207674_10007348 | 3300026116 | Bacteria | 12832 |
| 307 | Ga0207683_10003028 | 3300026121 | Bacteria | 14681 |
| 308 | Ga0207683_10036654 | 3300026121 | Bacteria | 4271 |
| 309 | Ga0207683_10216385 | 3300026121 | Bacteria | 1745 |
| 310 | Ga0207698_10118471 | 3300026142 | Bacteria | 2236 |
| 311 | Ga0209974_10016483 | 3300027876 | Bacteria | 2454 |
| 312 | Ga0207428_10007392 | 3300027907 | Bacteria | 10018 |
| 313 | Ga0207428_10024711 | 3300027907 | Bacteria | 5043 |
| 314 | Ga0207428_10038696 | 3300027907 | Bacteria | 3875 |
| 315 | Ga0207428_10039831 | 3300027907 | Bacteria | 3815 |
| 316 | Ga0207428_10090799 | 3300027907 | Bacteria | 2372 |
| 317 | Ga0268266_10144786 | 3300028379 | Bacteria | 2135 |
| 318 | Ga0268266_10156316 | 3300028379 | Bacteria | 2060 |
| 319 | Ga0268265_10001085 | 3300028380 | Bacteria | 24236 |
| 320 | Ga0268264_10223428 | 3300028381 | Bacteria | 1735 |
| 321 | Ga0265323_10000045 | 3300028653 | Bacteria | 67774 |
| 322 | Ga0265322_10013015 | 3300028654 | Unclassified | 2408 |
| 323 | Ga0307515_10097821 | 3300028794 | Bacteria | 3582 |
| 324 | Ga0307515_10103951 | 3300028794 | Bacteria | 3399 |
| 325 | Ga0307408_100049663 | 3300031548 | Bacteria | 3014 |
| 326 | Ga0265342_10118887 | 3300031712 | Unclassified | 1490 |
| 327 | Ga0307405_10011066 | 3300031731 | Bacteria | 4710 |
| 328 | Ga0307413_10011378 | 3300031824 | Bacteria | 4372 |
| 329 | Ga0307410_10070226 | 3300031852 | Bacteria | 2425 |
| 330 | Ga0307410_10130263 | 3300031852 | Bacteria | 1847 |
| 331 | Ga0307407_10002306 | 3300031903 | Bacteria | 7408 |
| 332 | Ga0307409_100000840 | 3300031995 | Bacteria | 14150 |
| 333 | Ga0307416_100006262 | 3300032002 | Bacteria | 7432 |
| 334 | Ga0307416_100007369 | 3300032002 | Bacteria | 6989 |
| 335 | Ga0307416_100014083 | 3300032002 | Bacteria | 5462 |
| 336 | Ga0307414_10067788 | 3300032004 | Bacteria | 2558 |
| 337 | Ga0307415_100000108 | 3300032126 | Bacteria | 35307 |
| 338 | Ga0307415_100007195 | 3300032126 | Bacteria | 6071 |
| 339 | Ga0307415_100037601 | 3300032126 | Bacteria | 3183 |
| 340 | Ga0307415_100067191 | 3300032126 | Bacteria | 2504 |
| 341 | Ga0373950_0000029 | 3300034818 | Bacteria | 165216 |
| 342 | Ga0373937_0002956 | 3300036401 | Bacteria | 14220 |
| 343 | Ga0395898_0097113 | 3300037466 | Bacteria | 2830 |
| 344 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 345 | Ga0395905_0059275 | 3300037471 | Bacteria | 3579 |
| 346 | Ga0395905_0094162 | 3300037471 | Bacteria | 2810 |
| 347 | Ga0436364_1164223 | 3300037853 | Unclassified | 1294 |
| 348 | Ga0395901_0358010 | 3300038443 | Bacteria | 1505 |
| 349 | Ga0400485_12796 | 3300038735 | Bacteria | 4470 |
| 350 | Ga0400488_07402 | 3300038741 | Bacteria | 3440 |
| 351 | Ga0400486_05082 | 3300038742 | Bacteria | 1997 |
| 352 | Ga0400486_13186 | 3300038742 | Bacteria | 20320 |
| 353 | Ga0400483_005012 | 3300039062 | Bacteria | 6958 |
| 354 | Ga0400483_021136 | 3300039062 | Bacteria | 11759 |
| 355 | Ga0400483_153264 | 3300039062 | Bacteria | 2050 |
| 356 | Ga0400483_183966 | 3300039062 | Bacteria | 71423 |
| 357 | Ga0439445_0003229 | 3300042004 | Bacteria | 3656 |
| 358 | Ga0439446_0001990 | 3300042156 | Bacteria | 4827 |
| 359 | Ga0466960_0013517 | 3300044901 | Bacteria | 3471 |
| 360 | Ga0451576_0029194 | 3300045051 | Bacteria | 5902 |
| 361 | Ga0495592_0069064 | 3300046454 | Bacteria | 2577 |
| 362 | Ga0495638_0024876 | 3300046460 | Bacteria | 3897 |
| 363 | Ga0495653_0037170 | 3300046463 | Bacteria | 3829 |
| 364 | Ga0495580_0000530 | 3300046472 | Bacteria | 32278 |
| 365 | Ga0495585_0092069 | 3300046492 | Bacteria | 1632 |
| 366 | Ga0495607_0060078 | 3300046501 | Bacteria | 2165 |
| 367 | Ga0495608_0051764 | 3300046511 | Bacteria | 2720 |
| 368 | Ga0495643_0002144 | 3300046522 | Bacteria | 16235 |
| 369 | Ga0495652_0052111 | 3300046529 | Bacteria | 3491 |
| 370 | Ga0495665_0005197 | 3300046531 | Bacteria | 7016 |
| 371 | Ga0495587_0001604 | 3300046536 | Bacteria | 15042 |
| 372 | Ga0495645_0022101 | 3300046543 | Bacteria | 4601 |
| 373 | Ga0495667_0075665 | 3300046559 | Bacteria | 2190 |
| 374 | Ga0495668_0018990 | 3300046616 | Bacteria | 3969 |
| 375 | Ga0495625_0128730 | 3300046660 | Bacteria | 1716 |
| 376 | Ga0495635_0139838 | 3300046663 | Bacteria | 1649 |
| 377 | Ga0495599_0032848 | 3300046678 | Bacteria | 3258 |
| 378 | Ga0495647_0068438 | 3300046681 | Bacteria | 1416 |
| 379 | Ga0495669_0030750 | 3300046684 | Bacteria | 2357 |
| 380 | Ga0495670_0000927 | 3300046691 | Bacteria | 14161 |
| 381 | Ga0495600_0089097 | 3300046809 | Bacteria | 2013 |
| 382 | Ga0495660_0086710 | 3300046810 | Bacteria | 1634 |
| 383 | Ga0495604_0069440 | 3300047317 | Bacteria | 2670 |
| 384 | Ga0495673_0031878 | 3300047469 | Bacteria | 2465 |
| 385 | Ga0495684_0002032 | 3300047471 | Bacteria | 16287 |
| 386 | Ga0495602_0034366 | 3300048088 | Bacteria | 4743 |
| 387 | Ga0496101_0032367 | 3300048904 | Bacteria | 3681 |
| 388 | Ga0496102_0024503 | 3300048905 | Bacteria | 5365 |
| 389 | Ga0496104_0003817 | 3300048907 | Bacteria | 13038 |
| 390 | Ga0496104_0060490 | 3300048907 | Bacteria | 3588 |
| 391 | Ga0496105_0004224 | 3300048908 | Bacteria | 10793 |
| 392 | Ga0496105_0020723 | 3300048908 | Bacteria | 5314 |
| 393 | Ga0496105_0183002 | 3300048908 | Bacteria | 1715 |
| 394 | Ga0496107_0072565 | 3300048910 | Unclassified | 2503 |
| 395 | Ga0496108_0009656 | 3300048911 | Bacteria | 7820 |
| 396 | Ga0496108_0028909 | 3300048911 | Bacteria | 4587 |
| 397 | Ga0496108_0036793 | 3300048911 | Bacteria | 4074 |
| 398 | Ga0496108_0078282 | 3300048911 | Bacteria | 2798 |
| 399 | Ga0496108_0130930 | 3300048911 | Bacteria | 2156 |
| 400 | Ga0496109_0003247 | 3300048912 | Bacteria | 13547 |
| 401 | Ga0496109_0015248 | 3300048912 | Bacteria | 6691 |
| 402 | Ga0496109_0079484 | 3300048912 | Bacteria | 3021 |
| 403 | Ga0496110_0016329 | 3300048913 | Bacteria | 6198 |
| 404 | Ga0496110_0022515 | 3300048913 | Bacteria | 5352 |
| 405 | Ga0496111_0090603 | 3300048914 | Bacteria | 2240 |
| 406 | Ga0496111_0199279 | 3300048914 | Unclassified | 1488 |
| 407 | Ga0496112_0002430 | 3300048915 | Bacteria | 15005 |
| 408 | Ga0496112_0004187 | 3300048915 | Bacteria | 12151 |
| 409 | Ga0496112_0132048 | 3300048915 | Bacteria | 2468 |
| 410 | Ga0496113_0042020 | 3300048916 | Bacteria | 3376 |
| 411 | Ga0496113_0140266 | 3300048916 | Bacteria | 1901 |
| 412 | Ga0496114_0001640 | 3300048917 | Bacteria | 16982 |
| 413 | Ga0496114_0055147 | 3300048917 | Bacteria | 3315 |
| 414 | Ga0496114_0137114 | 3300048917 | Bacteria | 2116 |
| 415 | Ga0496119_0000930 | 3300048922 | Bacteria | 37751 |
| 416 | Ga0496119_0010914 | 3300048922 | Bacteria | 7589 |
| 417 | Ga0496119_0041721 | 3300048922 | Bacteria | 2918 |
| 418 | Ga0496121_0017549 | 3300048924 | Bacteria | 7301 |
| 419 | Ga0496121_0065494 | 3300048924 | Bacteria | 2956 |
| 420 | Ga0496125_0022711 | 3300048928 | Bacteria | 5816 |
| 421 | Ga0501031_0000761 | 3300049568 | Bacteria | 19398 |
| 422 | Ga0501031_0002603 | 3300049568 | Bacteria | 11490 |
| 423 | Ga0501031_0032414 | 3300049568 | Bacteria | 3407 |
| 424 | Ga0501032_0036179 | 3300049569 | Bacteria | 3372 |
| 425 | Ga0501033_0005927 | 3300049570 | Bacteria | 9593 |
| 426 | Ga0501033_0036977 | 3300049570 | Bacteria | 3657 |
| 427 | Ga0501033_0069970 | 3300049570 | Bacteria | 2578 |
| 428 | Ga0501034_0060947 | 3300049571 | Bacteria | 3790 |
| 429 | Ga0501034_0089138 | 3300049571 | Bacteria | 3082 |
| 430 | Ga0501036_0000024 | 3300049572 | Bacteria | 110026 |
| 431 | Ga0501036_0006465 | 3300049572 | Bacteria | 9521 |
| 432 | Ga0501036_0267128 | 3300049572 | Bacteria | 1433 |
| 433 | Ga0501037_0008123 | 3300049573 | Bacteria | 7690 |
| 434 | Ga0501037_0009848 | 3300049573 | Bacteria | 7015 |
| 435 | Ga0501037_0094433 | 3300049573 | Bacteria | 2163 |
| 436 | Ga0501038_0003033 | 3300049574 | Bacteria | 15665 |
| 437 | Ga0501038_0004862 | 3300049574 | Bacteria | 12484 |
| 438 | Ga0501038_0013425 | 3300049574 | Bacteria | 7466 |
| 439 | Ga0501039_0000676 | 3300049575 | Bacteria | 24615 |
| 440 | Ga0501039_0001763 | 3300049575 | Bacteria | 15968 |
| 441 | Ga0501040_0001477 | 3300049576 | Bacteria | 14918 |
| 442 | Ga0501040_0007699 | 3300049576 | Bacteria | 6969 |
| 443 | Ga0501040_0008548 | 3300049576 | Bacteria | 6644 |
| 444 | Ga0501041_0000229 | 3300049577 | Bacteria | 26123 |
| 445 | Ga0501041_0000920 | 3300049577 | Bacteria | 15948 |
| 446 | Ga0501041_0004336 | 3300049577 | Bacteria | 8203 |
| 447 | Ga0501042_0000661 | 3300049578 | Bacteria | 18527 |
| 448 | Ga0501042_0000814 | 3300049578 | Bacteria | 17228 |
| 449 | Ga0501042_0001626 | 3300049578 | Bacteria | 13368 |
| 450 | Ga0501043_0014454 | 3300049579 | Bacteria | 6179 |
| 451 | Ga0501043_0024895 | 3300049579 | Bacteria | 4696 |
| 452 | Ga0501043_0092599 | 3300049579 | Bacteria | 2376 |
| 453 | Ga0501046_0000495 | 3300049580 | Bacteria | 39248 |
| 454 | Ga0501046_0000525 | 3300049580 | Bacteria | 38015 |
| 455 | Ga0501046_0004429 | 3300049580 | Bacteria | 12748 |
| 456 | Ga0501046_0041164 | 3300049580 | Bacteria | 3688 |
| 457 | Ga0501046_0046310 | 3300049580 | Bacteria | 3452 |
| 458 | Ga0501047_0069688 | 3300049581 | Bacteria | 3386 |
| 459 | Ga0501047_0095941 | 3300049581 | Bacteria | 2844 |
| 460 | Ga0501047_0217425 | 3300049581 | Bacteria | 1768 |
| 461 | Ga0501048_0000192 | 3300049582 | Bacteria | 39421 |
| 462 | Ga0501048_0002770 | 3300049582 | Bacteria | 13375 |
| 463 | Ga0501048_0003386 | 3300049582 | Bacteria | 12119 |
| 464 | Ga0501048_0071418 | 3300049582 | Bacteria | 2451 |
| 465 | Ga0501067_0000296 | 3300049583 | Bacteria | 27251 |
| 466 | Ga0501067_0011861 | 3300049583 | Bacteria | 4830 |
| 467 | Ga0501067_0041189 | 3300049583 | Bacteria | 2565 |
| 468 | Ga0501068_0015517 | 3300049584 | Bacteria | 4376 |
| 469 | Ga0501070_0006304 | 3300049586 | Bacteria | 10096 |
| 470 | Ga0501070_0102977 | 3300049586 | Bacteria | 2361 |
| 471 | Ga0501070_0107894 | 3300049586 | Bacteria | 2301 |
| 472 | Ga0501071_0000269 | 3300049587 | Bacteria | 24497 |
| 473 | Ga0501071_0001060 | 3300049587 | Bacteria | 15229 |
| 474 | Ga0501071_0017459 | 3300049587 | Bacteria | 4949 |
| 475 | Ga0501072_0000756 | 3300049588 | Bacteria | 23584 |
| 476 | Ga0501072_0001510 | 3300049588 | Bacteria | 17434 |
| 477 | Ga0501073_0002717 | 3300049589 | Bacteria | 13254 |
| 478 | Ga0501073_0012269 | 3300049589 | Bacteria | 6253 |
| 479 | Ga0501073_0063622 | 3300049589 | Bacteria | 2573 |
| 480 | Ga0501074_0001129 | 3300049590 | Bacteria | 17480 |
| 481 | Ga0501074_0004833 | 3300049590 | Bacteria | 9655 |
| 482 | Ga0501074_0007128 | 3300049590 | Bacteria | 8078 |
| 483 | Ga0501075_0000100 | 3300049591 | Bacteria | 39814 |
| 484 | Ga0501075_0000132 | 3300049591 | Bacteria | 37143 |
| 485 | Ga0501075_0002038 | 3300049591 | Bacteria | 13369 |
| 486 | Ga0501075_0022828 | 3300049591 | Bacteria | 4575 |
| 487 | Ga0501076_0000403 | 3300049592 | Bacteria | 26968 |
| 488 | Ga0501076_0008195 | 3300049592 | Bacteria | 7653 |
| 489 | Ga0501076_0008372 | 3300049592 | Bacteria | 7579 |
| 490 | Ga0501076_0080398 | 3300049592 | Bacteria | 2616 |
| 491 | Ga0501076_0087304 | 3300049592 | Bacteria | 2508 |
| 492 | Ga0501077_0001549 | 3300049593 | Bacteria | 13860 |
| 493 | Ga0501077_0001718 | 3300049593 | Bacteria | 13213 |
| 494 | Ga0501077_0038423 | 3300049593 | Bacteria | 3047 |
| 495 | Ga0501079_0002470 | 3300049741 | Bacteria | 13423 |
| 496 | Ga0501079_0016489 | 3300049741 | Bacteria | 5642 |
| 497 | Ga0501079_0079574 | 3300049741 | Bacteria | 2534 |
| 498 | Ga0501080_0015687 | 3300049742 | Bacteria | 6985 |
| 499 | Ga0501081_0001722 | 3300049743 | Bacteria | 13581 |
| 500 | Ga0501081_0006838 | 3300049743 | Bacteria | 7418 |
| 501 | Ga0501081_0010245 | 3300049743 | Bacteria | 6120 |
| 502 | Ga0501081_0091392 | 3300049743 | Bacteria | 2141 |
| 503 | Ga0501083_0005709 | 3300049744 | Bacteria | 8807 |
| 504 | Ga0501083_0014169 | 3300049744 | Bacteria | 5576 |
| 505 | Ga0501035_0002557 | 3300049822 | Bacteria | 17793 |
| 506 | Ga0501035_0227698 | 3300049822 | Bacteria | 1590 |
| 507 | Ga0501044_0100470 | 3300049823 | Bacteria | 2911 |
| 508 | Ga0501045_0000216 | 3300049824 | Bacteria | 33098 |
| 509 | Ga0501045_0000694 | 3300049824 | Bacteria | 21409 |
| 510 | Ga0501045_0001055 | 3300049824 | Bacteria | 18154 |
| 511 | Ga0501045_0114124 | 3300049824 | Bacteria | 2004 |
| 512 | nmdc:mga0yw44_14355_c1 | 3300050492 | Bacteria | 4205 |
| 513 | nmdc:mga0k408_9804_c1 | 3300050493 | Bacteria | 5173 |
| 514 | nmdc:mga05p37_10461_c1 | 3300050507 | Bacteria | 11010 |
| 515 | nmdc:mga05p37_11280_c1 | 3300050507 | Bacteria | 10628 |
| 516 | nmdc:mga05p37_169265_c1 | 3300050507 | Unclassified | 2665 |
| 517 | nmdc:mga05p37_17692_c1 | 3300050507 | Bacteria | 8599 |
| 518 | nmdc:mga05p37_2074_c1 | 3300050507 | Bacteria | 23388 |
| 519 | nmdc:mga05p37_230965_c1 | 3300050507 | Bacteria | 2229 |
| 520 | nmdc:mga05p37_32168_c1 | 3300050507 | Bacteria | 6414 |
| 521 | nmdc:mga05p37_42024_c1 | 3300050507 | Bacteria | 5615 |
| 522 | nmdc:mga05p37_9844_c1 | 3300050507 | Bacteria | 11346 |
| 523 | nmdc:mga09592_125932_c1 | 3300050508 | Bacteria | 2202 |
| 524 | nmdc:mga09592_1577_c1 | 3300050508 | Bacteria | 18351 |
| 525 | nmdc:mga09592_2139_c1 | 3300050508 | Bacteria | 15947 |
| 526 | nmdc:mga09592_2931_c1 | 3300050508 | Bacteria | 13823 |
| 527 | nmdc:mga09592_60765_c1 | 3300050508 | Bacteria | 3195 |
| 528 | nmdc:mga0qj67_182981_c1 | 3300050509 | Bacteria | 1702 |
| 529 | nmdc:mga0qj67_27428_c1 | 3300050509 | Bacteria | 4415 |
| 530 | nmdc:mga0qj67_4545_c1 | 3300050509 | Bacteria | 10054 |
| 531 | nmdc:mga0qj67_74824_c1 | 3300050509 | Bacteria | 2706 |
| 532 | nmdc:mga0qj67_8942_c1 | 3300050509 | Bacteria | 7428 |
| 533 | nmdc:mga06r32_102159_c1 | 3300050510 | Bacteria | 2814 |
| 534 | nmdc:mga06r32_117087_c1 | 3300050510 | Bacteria | 2626 |
| 535 | nmdc:mga06r32_1896_c1 | 3300050510 | Bacteria | 18625 |
| 536 | nmdc:mga06r32_43789_c1 | 3300050510 | Bacteria | 4259 |
| 537 | nmdc:mga06r32_63744_c1 | 3300050510 | Bacteria | 3553 |
| 538 | nmdc:mga06r32_64004_c1 | 3300050510 | Bacteria | 3546 |
| 539 | nmdc:mga06r32_95524_c1 | 3300050510 | Unclassified | 2909 |
| 540 | nmdc:mga08y16_19042_c1 | 3300050511 | Bacteria | 7230 |
| 541 | nmdc:mga08y16_26588_c1 | 3300050511 | Bacteria | 6100 |
| 542 | nmdc:mga08y16_30811_c1 | 3300050511 | Bacteria | 5642 |
| 543 | nmdc:mga08y16_62637_c1 | 3300050511 | Bacteria | 3885 |
| 544 | nmdc:mga0n895_177475_c1 | 3300050512 | Unclassified | 2161 |
| 545 | nmdc:mga0n895_32608_c1 | 3300050512 | Bacteria | 5001 |
| 546 | nmdc:mga0n895_6754_c1 | 3300050512 | Bacteria | 9786 |
| 547 | nmdc:mga0n895_81129_c1 | 3300050512 | Bacteria | 3232 |
| 548 | nmdc:mga0rr50_14988_c1 | 3300050513 | Bacteria | 5106 |
| 549 | nmdc:mga0rr50_95112_c1 | 3300050513 | Bacteria | 2328 |
| 550 | nmdc:mga08x19_20866_c1 | 3300050514 | Unclassified | 4037 |
| 551 | nmdc:mga0a205_12454_c1 | 3300050515 | Bacteria | 7869 |
| 552 | nmdc:mga0a205_193064_c1 | 3300050515 | Bacteria | 1928 |
| 553 | nmdc:mga0a205_3083_c1 | 3300050515 | Bacteria | 14795 |
| 554 | nmdc:mga0a205_6351_c1 | 3300050515 | Bacteria | 10674 |
| 555 | Ga0495655_0017469 | 3300053083 | Bacteria | 1563 |
| 556 | Ga0500643_000058 | 3300053087 | Bacteria | 130051 |
| 557 | Ga0500644_0039618 | 3300053088 | Bacteria | 1554 |
| 558 | Ga0500641_0055271 | 3300053096 | Bacteria | 1643 |
| 559 | Ga0500650_0000778 | 3300053098 | Bacteria | 8710 |
| 560 | Ga0500650_0061349 | 3300053098 | Bacteria | 1756 |
| 561 | Ga0500555_005142 | 3300053103 | Bacteria | 3711 |
| 562 | Ga0500556_0000056 | 3300053104 | Bacteria | 115367 |
| 563 | Ga0500562_000439 | 3300053108 | Bacteria | 10144 |
| 564 | Ga0500572_000346 | 3300053111 | Bacteria | 16615 |
| 565 | Ga0500658_0039762 | 3300053134 | Bacteria | 1881 |
| 566 | Ga0500658_0086119 | 3300053134 | Bacteria | 1351 |
| 567 | Ga0500559_0001050 | 3300053136 | Bacteria | 16871 |
| 568 | Ga0500568_0005744 | 3300053139 | Bacteria | 6356 |
| 569 | Ga0500622_0002128 | 3300053156 | Bacteria | 14750 |
| 570 | Ga0500627_0012132 | 3300053158 | Bacteria | 3217 |
| 571 | Ga0500645_007755 | 3300053730 | Bacteria | 3713 |
| 572 | Ga0500645_023819 | 3300053730 | Bacteria | 1875 |
| 573 | Ga0501084_0000458 | 3300054114 | Bacteria | 31426 |
| 574 | Ga0501084_0003009 | 3300054114 | Bacteria | 13654 |
| 575 | Ga0501084_0003198 | 3300054114 | Bacteria | 13258 |
| 576 | Ga0501084_0006984 | 3300054114 | Bacteria | 9303 |
| 577 | Ga0501082_0000751 | 3300060353 | Bacteria | 28467 |
| 578 | Ga0501082_0002116 | 3300060353 | Bacteria | 17493 |
| 579 | Ga0501082_0023609 | 3300060353 | Bacteria | 5304 |
| 580 | Ga0501082_0246235 | 3300060353 | Bacteria | 1556 |
| 581 | Ga0530510_0000013 | 3300061734 | Bacteria | 110065 |
| 582 | Ga0530510_0000157 | 3300061734 | Bacteria | 40698 |
| 583 | Ga0530510_0003857 | 3300061734 | Bacteria | 10333 |
| 584 | Ga0530510_0010374 | 3300061734 | Bacteria | 6531 |
| 585 | Ga0530510_0032471 | 3300061734 | Bacteria | 3756 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0358010 | Ga0395901_0358010_426_1493 | 351 |
| 2 | 3300048912 | Ga0496109_0015248 | Ga0496109_0015248_5447_6556 | 365 |
| 3 | 3300037853 | Ga0436364_1164223 | Ga0436364_1164223_140_1279 | 376 |
| 4 | 3300046501 | Ga0495607_0060078 | Ga0495607_0060078_1007_2143 | 378 |
| 5 | 3300053730 | Ga0500645_023819 | Ga0500645_023819_46_1182 | 378 |
| 6 | 3300039062 | Ga0400483_153264 | Ga0400483_153264_23_1165 | 380 |
| 7 | 3300049824 | Ga0501045_0114124 | Ga0501045_0114124_91_1263 | 387 |
| 8 | 3300005617 | Ga0068859_100002746 | Ga0068859_1000027462 | 394 |
| 9 | 3300005843 | Ga0068860_100264790 | Ga0068860_1002647902 | 394 |
| 10 | 3300006931 | Ga0097620_100002746 | Ga0097620_1000027462 | 394 |
| 11 | 3300025936 | Ga0207670_10197721 | Ga0207670_101977212 | 394 |
| 12 | 3300028381 | Ga0268264_10223428 | Ga0268264_102234282 | 394 |
| 13 | 3300050508 | nmdc:mga09592_1577_c1 | nmdc:mga09592_1577_c1_14378_15667 | 399 |
| 14 | 3300050509 | nmdc:mga0qj67_4545_c1 | nmdc:mga0qj67_4545_c1_1689_2978 | 399 |
| 15 | 3300006846 | Ga0075430_100001319 | Ga0075430_1000013193 | 405 |
| 16 | 3300006880 | Ga0075429_100001229 | Ga0075429_1000012293 | 405 |
| 17 | 3300042004 | Ga0439445_0003229 | Ga0439445_0003229_909_2189 | 406 |
| 18 | 3300042156 | Ga0439446_0001990 | Ga0439446_0001990_1353_2633 | 406 |
| 19 | 3300053083 | Ga0495655_0017469 | Ga0495655_0017469_258_1508 | 406 |
| 20 | 3300005617 | Ga0068859_100024104 | Ga0068859_1000241043 | 410 |
| 21 | 3300006847 | Ga0075431_100006560 | Ga0075431_1000065608 | 410 |
| 22 | 3300006880 | Ga0075429_100019270 | Ga0075429_1000192705 | 410 |
| 23 | 3300006931 | Ga0097620_100024104 | Ga0097620_1000241043 | 410 |
| 24 | 3300009147 | Ga0114129_10000163 | Ga0114129_1000016357 | 410 |
| 25 | 3300050507 | nmdc:mga05p37_2074_c1 | nmdc:mga05p37_2074_c1_10543_11841 | 410 |
| 26 | 3300050508 | nmdc:mga09592_2931_c1 | nmdc:mga09592_2931_c1_3996_5294 | 410 |
| 27 | 3300050509 | nmdc:mga0qj67_27428_c1 | nmdc:mga0qj67_27428_c1_1347_2645 | 410 |
| 28 | 3300050510 | nmdc:mga06r32_1896_c1 | nmdc:mga06r32_1896_c1_9702_11000 | 410 |
| 29 | iso_pu_bacteria | 2675903060 | 2676494946 | 411 |
| 30 | 3300009147 | Ga0114129_10070367 | Ga0114129_100703675 | 413 |
| 31 | 3300014969 | Ga0157376_10032003 | Ga0157376_100320035 | 413 |
| 32 | 3300046810 | Ga0495660_0086710 | Ga0495660_0086710_44_1291 | 415 |
| 33 | 3300053108 | Ga0500562_000439 | Ga0500562_000439_29_1276 | 415 |
| 34 | 3300053134 | Ga0500658_0086119 | Ga0500658_0086119_15_1262 | 415 |
| 35 | 3300006847 | Ga0075431_100177348 | Ga0075431_1001773483 | 416 |
| 36 | 3300006852 | Ga0075433_10084192 | Ga0075433_100841923 | 416 |
| 37 | 3300006871 | Ga0075434_100002123 | Ga0075434_10000212311 | 416 |
| 38 | 3300006880 | Ga0075429_100007253 | Ga0075429_1000072533 | 416 |
| 39 | 3300007076 | Ga0075435_100006393 | Ga0075435_1000063935 | 416 |
| 40 | 3300009147 | Ga0114129_10024176 | Ga0114129_100241767 | 416 |
| 41 | 3300025914 | Ga0207671_10171175 | Ga0207671_101711752 | 416 |
| 42 | 3300046663 | Ga0495635_0139838 | Ga0495635_0139838_13_1263 | 416 |
| 43 | 3300050507 | nmdc:mga05p37_9844_c1 | nmdc:mga05p37_9844_c1_1136_2419 | 416 |
| 44 | 3300050508 | nmdc:mga09592_2139_c1 | nmdc:mga09592_2139_c1_13400_14683 | 416 |
| 45 | 3300050510 | nmdc:mga06r32_102159_c1 | nmdc:mga06r32_102159_c1_173_1456 | 416 |
| 46 | 3300050512 | nmdc:mga0n895_32608_c1 | nmdc:mga0n895_32608_c1_1584_2867 | 416 |
| 47 | 3300050513 | nmdc:mga0rr50_14988_c1 | nmdc:mga0rr50_14988_c1_2792_4075 | 416 |
| 48 | 3300050515 | nmdc:mga0a205_3083_c1 | nmdc:mga0a205_3083_c1_4661_5944 | 416 |
| 49 | 3300053111 | Ga0500572_000346 | Ga0500572_000346_9950_11209 | 416 |
| 50 | 3300053136 | Ga0500559_0001050 | Ga0500559_0001050_1687_2946 | 416 |
| 51 | 3300049571 | Ga0501034_0060947 | Ga0501034_0060947_1929_3191 | 417 |
| 52 | 3300049573 | Ga0501037_0008123 | Ga0501037_0008123_5836_7089 | 417 |
| 53 | 3300049580 | Ga0501046_0046310 | Ga0501046_0046310_528_1781 | 417 |
| 54 | 3300049581 | Ga0501047_0069688 | Ga0501047_0069688_359_1612 | 417 |
| 55 | 3300049581 | Ga0501047_0217425 | Ga0501047_0217425_32_1294 | 417 |
| 56 | 3300049583 | Ga0501067_0011861 | Ga0501067_0011861_1664_2926 | 417 |
| 57 | 3300049586 | Ga0501070_0006304 | Ga0501070_0006304_7104_8366 | 417 |
| 58 | 3300049587 | Ga0501071_0017459 | Ga0501071_0017459_1919_3181 | 417 |
| 59 | 3300049589 | Ga0501073_0002717 | Ga0501073_0002717_3871_5133 | 417 |
| 60 | 3300049590 | Ga0501074_0007128 | Ga0501074_0007128_3294_4556 | 417 |
| 61 | 3300049593 | Ga0501077_0038423 | Ga0501077_0038423_476_1738 | 417 |
| 62 | 3300049742 | Ga0501080_0015687 | Ga0501080_0015687_1433_2695 | 417 |
| 63 | 3300049744 | Ga0501083_0014169 | Ga0501083_0014169_2526_3788 | 417 |
| 64 | 3300049822 | Ga0501035_0227698 | Ga0501035_0227698_43_1296 | 417 |
| 65 | 3300049823 | Ga0501044_0100470 | Ga0501044_0100470_1350_2603 | 417 |
| 66 | 3300003373 | JGI25407J50210_10004743 | JGI25407J50210_100047432 | 418 |
| 67 | 3300005937 | Ga0081455_10014788 | Ga0081455_100147884 | 418 |
| 68 | 3300005981 | Ga0081538_10061157 | Ga0081538_100611573 | 418 |
| 69 | 3300006844 | Ga0075428_100006634 | Ga0075428_10000663411 | 418 |
| 70 | 3300006844 | Ga0075428_100176180 | Ga0075428_1001761802 | 418 |
| 71 | 3300006846 | Ga0075430_100144898 | Ga0075430_1001448982 | 418 |
| 72 | 3300006847 | Ga0075431_100031930 | Ga0075431_1000319303 | 418 |
| 73 | 3300046681 | Ga0495647_0068438 | Ga0495647_0068438_19_1275 | 418 |
| 74 | 3300049586 | Ga0501070_0107894 | Ga0501070_0107894_19_1293 | 418 |
| 75 | 3300050508 | nmdc:mga09592_125932_c1 | nmdc:mga09592_125932_c1_311_1567 | 418 |
| 76 | 3300050509 | nmdc:mga0qj67_74824_c1 | nmdc:mga0qj67_74824_c1_620_1879 | 418 |
| 77 | 3300050510 | nmdc:mga06r32_64004_c1 | nmdc:mga06r32_64004_c1_1834_3093 | 418 |
| 78 | iso_pu_bacteria | 2895427314 | 2895432761 | 418 |
| 79 | 3300005334 | Ga0068869_100005780 | Ga0068869_1000057805 | 419 |
| 80 | 3300005355 | Ga0070671_100002729 | Ga0070671_1000027293 | 419 |
| 81 | 3300005434 | Ga0070709_10008665 | Ga0070709_100086654 | 419 |
| 82 | 3300005539 | Ga0068853_100045751 | Ga0068853_1000457513 | 419 |
| 83 | 3300005840 | Ga0068870_10017270 | Ga0068870_100172703 | 419 |
| 84 | 3300005844 | Ga0068862_100000909 | Ga0068862_10000090910 | 419 |
| 85 | 3300009094 | Ga0111539_10026766 | Ga0111539_100267663 | 419 |
| 86 | 3300011119 | Ga0105246_10005664 | Ga0105246_100056644 | 419 |
| 87 | 3300014325 | Ga0163163_10001522 | Ga0163163_100015223 | 419 |
| 88 | 3300014968 | Ga0157379_10029980 | Ga0157379_100299803 | 419 |
| 89 | 3300025315 | Ga0207697_10005063 | Ga0207697_100050634 | 419 |
| 90 | 3300025904 | Ga0207647_10000980 | Ga0207647_1000098016 | 419 |
| 91 | 3300025942 | Ga0207689_10021724 | Ga0207689_100217245 | 419 |
| 92 | 3300026041 | Ga0207639_10209178 | Ga0207639_102091781 | 419 |
| 93 | 3300026088 | Ga0207641_10288615 | Ga0207641_102886151 | 419 |
| 94 | 3300026142 | Ga0207698_10118471 | Ga0207698_101184712 | 419 |
| 95 | 3300028380 | Ga0268265_10001085 | Ga0268265_1000108519 | 419 |
| 96 | 3300048905 | Ga0496102_0024503 | Ga0496102_0024503_801_2162 | 419 |
| 97 | 3300048907 | Ga0496104_0003817 | Ga0496104_0003817_2625_3986 | 419 |
| 98 | 3300048908 | Ga0496105_0004224 | Ga0496105_0004224_3249_4610 | 419 |
| 99 | 3300048911 | Ga0496108_0009656 | Ga0496108_0009656_5927_7288 | 419 |
| 100 | 3300048915 | Ga0496112_0002430 | Ga0496112_0002430_10264_11625 | 419 |
| 101 | 3300048916 | Ga0496113_0140266 | Ga0496113_0140266_271_1632 | 419 |
| 102 | 3300048922 | Ga0496119_0041721 | Ga0496119_0041721_801_2162 | 419 |
| 103 | 3300049568 | Ga0501031_0000761 | Ga0501031_0000761_8442_9728 | 419 |
| 104 | 3300049570 | Ga0501033_0036977 | Ga0501033_0036977_1353_2639 | 419 |
| 105 | 3300049572 | Ga0501036_0000024 | Ga0501036_0000024_104400_105686 | 419 |
| 106 | 3300049574 | Ga0501038_0003033 | Ga0501038_0003033_10015_11301 | 419 |
| 107 | 3300049575 | Ga0501039_0001763 | Ga0501039_0001763_14002_15288 | 419 |
| 108 | 3300049576 | Ga0501040_0008548 | Ga0501040_0008548_1019_2305 | 419 |
| 109 | 3300049577 | Ga0501041_0004336 | Ga0501041_0004336_4040_5326 | 419 |
| 110 | 3300049578 | Ga0501042_0000661 | Ga0501042_0000661_4394_5680 | 419 |
| 111 | 3300049579 | Ga0501043_0024895 | Ga0501043_0024895_933_2219 | 419 |
| 112 | 3300049580 | Ga0501046_0000495 | Ga0501046_0000495_33629_34915 | 419 |
| 113 | 3300049582 | Ga0501048_0000192 | Ga0501048_0000192_4328_5614 | 419 |
| 114 | 3300049587 | Ga0501071_0000269 | Ga0501071_0000269_13905_15191 | 419 |
| 115 | 3300049588 | Ga0501072_0001510 | Ga0501072_0001510_4345_5631 | 419 |
| 116 | 3300049590 | Ga0501074_0001129 | Ga0501074_0001129_11829_13115 | 419 |
| 117 | 3300049591 | Ga0501075_0000132 | Ga0501075_0000132_31576_32862 | 419 |
| 118 | 3300049592 | Ga0501076_0008195 | Ga0501076_0008195_4348_5634 | 419 |
| 119 | 3300049593 | Ga0501077_0001549 | Ga0501077_0001549_11749_13035 | 419 |
| 120 | 3300049741 | Ga0501079_0079574 | Ga0501079_0079574_927_2213 | 419 |
| 121 | 3300049743 | Ga0501081_0006838 | Ga0501081_0006838_1747_3033 | 419 |
| 122 | 3300049822 | Ga0501035_0002557 | Ga0501035_0002557_12213_13499 | 419 |
| 123 | 3300049824 | Ga0501045_0000216 | Ga0501045_0000216_31132_32418 | 419 |
| 124 | 3300050511 | nmdc:mga08y16_26588_c1 | nmdc:mga08y16_26588_c1_43_1323 | 419 |
| 125 | 3300054114 | Ga0501084_0003198 | Ga0501084_0003198_7591_8877 | 419 |
| 126 | 3300060353 | Ga0501082_0002116 | Ga0501082_0002116_11549_12835 | 419 |
| 127 | 3300061734 | Ga0530510_0000013 | Ga0530510_0000013_4396_5682 | 419 |
| 128 | 3300003322 | rootL2_10049817 | rootL2_100498171 | 420 |
| 129 | 3300005329 | Ga0070683_100097143 | Ga0070683_1000971433 | 420 |
| 130 | 3300005335 | Ga0070666_10021962 | Ga0070666_100219625 | 420 |
| 131 | 3300005340 | Ga0070689_100012177 | Ga0070689_1000121776 | 420 |
| 132 | 3300005347 | Ga0070668_100018462 | Ga0070668_1000184622 | 420 |
| 133 | 3300005354 | Ga0070675_100009586 | Ga0070675_1000095865 | 420 |
| 134 | 3300005354 | Ga0070675_100046141 | Ga0070675_1000461413 | 420 |
| 135 | 3300005364 | Ga0070673_100028244 | Ga0070673_1000282442 | 420 |
| 136 | 3300005365 | Ga0070688_100040025 | Ga0070688_1000400253 | 420 |
| 137 | 3300005365 | Ga0070688_100064522 | Ga0070688_1000645222 | 420 |
| 138 | 3300005367 | Ga0070667_100035403 | Ga0070667_1000354034 | 420 |
| 139 | 3300005456 | Ga0070678_100007881 | Ga0070678_1000078812 | 420 |
| 140 | 3300005459 | Ga0068867_100005112 | Ga0068867_1000051126 | 420 |
| 141 | 3300005546 | Ga0070696_100104890 | Ga0070696_1001048902 | 420 |
| 142 | 3300005548 | Ga0070665_100132038 | Ga0070665_1001320382 | 420 |
| 143 | 3300005564 | Ga0070664_100060363 | Ga0070664_1000603633 | 420 |
| 144 | 3300005616 | Ga0068852_100092307 | Ga0068852_1000923072 | 420 |
| 145 | 3300006237 | Ga0097621_100009693 | Ga0097621_1000096934 | 420 |
| 146 | 3300006358 | Ga0068871_100053710 | Ga0068871_1000537102 | 420 |
| 147 | 3300006844 | Ga0075428_100027750 | Ga0075428_1000277503 | 420 |
| 148 | 3300009094 | Ga0111539_10011267 | Ga0111539_100112673 | 420 |
| 149 | 3300013296 | Ga0157374_10010229 | Ga0157374_100102293 | 420 |
| 150 | 3300013297 | Ga0157378_10017330 | Ga0157378_100173303 | 420 |
| 151 | 3300013306 | Ga0163162_10011825 | Ga0163162_100118255 | 420 |
| 152 | 3300013308 | Ga0157375_10010387 | Ga0157375_1001038710 | 420 |
| 153 | 3300014326 | Ga0157380_10152593 | Ga0157380_101525932 | 420 |
| 154 | 3300025315 | Ga0207697_10000619 | Ga0207697_100006197 | 420 |
| 155 | 3300025901 | Ga0207688_10005446 | Ga0207688_100054462 | 420 |
| 156 | 3300025907 | Ga0207645_10006095 | Ga0207645_100060954 | 420 |
| 157 | 3300025923 | Ga0207681_10038290 | Ga0207681_100382904 | 420 |
| 158 | 3300025926 | Ga0207659_10004027 | Ga0207659_100040275 | 420 |
| 159 | 3300025936 | Ga0207670_10018592 | Ga0207670_100185925 | 420 |
| 160 | 3300025940 | Ga0207691_10001669 | Ga0207691_100016699 | 420 |
| 161 | 3300025940 | Ga0207691_10103100 | Ga0207691_101031001 | 420 |
| 162 | 3300025945 | Ga0207679_10061185 | Ga0207679_100611852 | 420 |
| 163 | 3300026089 | Ga0207648_10034358 | Ga0207648_100343584 | 420 |
| 164 | 3300026121 | Ga0207683_10003028 | Ga0207683_1000302815 | 420 |
| 165 | 3300027907 | Ga0207428_10024711 | Ga0207428_100247112 | 420 |
| 166 | 3300046684 | Ga0495669_0030750 | Ga0495669_0030750_406_1716 | 420 |
| 167 | 3300049584 | Ga0501068_0015517 | Ga0501068_0015517_1057_2349 | 420 |
| 168 | 3300049589 | Ga0501073_0063622 | Ga0501073_0063622_1228_2517 | 420 |
| 169 | 3300050511 | nmdc:mga08y16_30811_c1 | nmdc:mga08y16_30811_c1_1040_2356 | 420 |
| 170 | iso_pu_bacteria | 2811994917 | 2812478234 | 420 |
| 171 | iso_pu_bacteria | 2891395885 | 2891399119 | 420 |
| 172 | iso_pu_bacteria | 8006964411 | 8006972664 | 420 |
| 173 | iso_pu_bacteria | 8054160619 | 8054165280 | 420 |
| 174 | 3300005981 | Ga0081538_10000642 | Ga0081538_1000064223 | 421 |
| 175 | 3300006847 | Ga0075431_100001013 | Ga0075431_10000101319 | 421 |
| 176 | 3300028794 | Ga0307515_10097821 | Ga0307515_100978213 | 421 |
| 177 | 3300044901 | Ga0466960_0013517 | Ga0466960_0013517_1492_2757 | 421 |
| 178 | 3300046460 | Ga0495638_0024876 | Ga0495638_0024876_1581_2918 | 421 |
| 179 | 3300046660 | Ga0495625_0128730 | Ga0495625_0128730_313_1650 | 421 |
| 180 | 3300046691 | Ga0495670_0000927 | Ga0495670_0000927_9062_10399 | 421 |
| 181 | 3300048908 | Ga0496105_0020723 | Ga0496105_0020723_325_1590 | 421 |
| 182 | 3300048910 | Ga0496107_0072565 | Ga0496107_0072565_1015_2280 | 421 |
| 183 | 3300048911 | Ga0496108_0130930 | Ga0496108_0130930_711_1976 | 421 |
| 184 | 3300048914 | Ga0496111_0199279 | Ga0496111_0199279_180_1445 | 421 |
| 185 | 3300049581 | Ga0501047_0095941 | Ga0501047_0095941_774_2054 | 421 |
| 186 | 3300049744 | Ga0501083_0005709 | Ga0501083_0005709_5221_6501 | 421 |
| 187 | 3300053088 | Ga0500644_0039618 | Ga0500644_0039618_179_1516 | 421 |
| 188 | 3300053096 | Ga0500641_0055271 | Ga0500641_0055271_49_1386 | 421 |
| 189 | 3300053098 | Ga0500650_0000778 | Ga0500650_0000778_2854_4191 | 421 |
| 190 | 3300053139 | Ga0500568_0005744 | Ga0500568_0005744_1089_2426 | 421 |
| 191 | 3300054114 | Ga0501084_0003009 | Ga0501084_0003009_1630_2910 | 421 |
| 192 | iso_pu_bacteria | 2884693830 | 2884694398 | 421 |
| 193 | iso_pu_bacteria | 2895442618 | 2895444292 | 421 |
| 194 | iso_pu_bacteria | 2919073203 | 2919077607 | 421 |
| 195 | 3300005328 | Ga0070676_10015035 | Ga0070676_100150354 | 422 |
| 196 | 3300005347 | Ga0070668_100134103 | Ga0070668_1001341032 | 422 |
| 197 | 3300005353 | Ga0070669_100119079 | Ga0070669_1001190792 | 422 |
| 198 | 3300005354 | Ga0070675_100067291 | Ga0070675_1000672913 | 422 |
| 199 | 3300005456 | Ga0070678_100082698 | Ga0070678_1000826982 | 422 |
| 200 | 3300005981 | Ga0081538_10001180 | Ga0081538_1000118014 | 422 |
| 201 | 3300006237 | Ga0097621_100178619 | Ga0097621_1001786192 | 422 |
| 202 | 3300006844 | Ga0075428_100054082 | Ga0075428_1000540822 | 422 |
| 203 | 3300006846 | Ga0075430_100005418 | Ga0075430_1000054184 | 422 |
| 204 | 3300006847 | Ga0075431_100208135 | Ga0075431_1002081352 | 422 |
| 205 | 3300006871 | Ga0075434_100179957 | Ga0075434_1001799572 | 422 |
| 206 | 3300006880 | Ga0075429_100064360 | Ga0075429_1000643603 | 422 |
| 207 | 3300009094 | Ga0111539_10172635 | Ga0111539_101726353 | 422 |
| 208 | 3300009098 | Ga0105245_10218785 | Ga0105245_102187851 | 422 |
| 209 | 3300013296 | Ga0157374_10229227 | Ga0157374_102292272 | 422 |
| 210 | 3300013297 | Ga0157378_10044857 | Ga0157378_100448573 | 422 |
| 211 | 3300025903 | Ga0207680_10043715 | Ga0207680_100437152 | 422 |
| 212 | 3300025923 | Ga0207681_10066978 | Ga0207681_100669783 | 422 |
| 213 | 3300025926 | Ga0207659_10038362 | Ga0207659_100383623 | 422 |
| 214 | 3300026121 | Ga0207683_10216385 | Ga0207683_102163851 | 422 |
| 215 | 3300037466 | Ga0395898_0097113 | Ga0395898_0097113_49_1353 | 422 |
| 216 | 3300046454 | Ga0495592_0069064 | Ga0495592_0069064_873_2153 | 422 |
| 217 | 3300046463 | Ga0495653_0037170 | Ga0495653_0037170_1251_2531 | 422 |
| 218 | 3300046511 | Ga0495608_0051764 | Ga0495608_0051764_1290_2570 | 422 |
| 219 | 3300046529 | Ga0495652_0052111 | Ga0495652_0052111_1177_2457 | 422 |
| 220 | 3300046536 | Ga0495587_0001604 | Ga0495587_0001604_10041_11321 | 422 |
| 221 | 3300046543 | Ga0495645_0022101 | Ga0495645_0022101_554_1834 | 422 |
| 222 | 3300046559 | Ga0495667_0075665 | Ga0495667_0075665_133_1413 | 422 |
| 223 | 3300046678 | Ga0495599_0032848 | Ga0495599_0032848_316_1596 | 422 |
| 224 | 3300046809 | Ga0495600_0089097 | Ga0495600_0089097_83_1363 | 422 |
| 225 | 3300047317 | Ga0495604_0069440 | Ga0495604_0069440_1137_2417 | 422 |
| 226 | 3300047471 | Ga0495684_0002032 | Ga0495684_0002032_5035_6315 | 422 |
| 227 | 3300048088 | Ga0495602_0034366 | Ga0495602_0034366_2896_4176 | 422 |
| 228 | 3300048911 | Ga0496108_0036793 | Ga0496108_0036793_99_1391 | 422 |
| 229 | 3300048911 | Ga0496108_0078282 | Ga0496108_0078282_966_2240 | 422 |
| 230 | 3300048915 | Ga0496112_0132048 | Ga0496112_0132048_858_2150 | 422 |
| 231 | 3300049573 | Ga0501037_0094433 | Ga0501037_0094433_57_1361 | 422 |
| 232 | 3300049580 | Ga0501046_0041164 | Ga0501046_0041164_2251_3555 | 422 |
| 233 | 3300050508 | nmdc:mga09592_60765_c1 | nmdc:mga09592_60765_c1_1493_2797 | 422 |
| 234 | 3300050509 | nmdc:mga0qj67_8942_c1 | nmdc:mga0qj67_8942_c1_2961_4265 | 422 |
| 235 | 3300050510 | nmdc:mga06r32_43789_c1 | nmdc:mga06r32_43789_c1_2798_4102 | 422 |
| 236 | 3300050512 | nmdc:mga0n895_177475_c1 | nmdc:mga0n895_177475_c1_305_1642 | 422 |
| 237 | 3300005328 | Ga0070676_10001826 | Ga0070676_1000182611 | 423 |
| 238 | 3300005458 | Ga0070681_10101142 | Ga0070681_101011422 | 423 |
| 239 | 3300005518 | Ga0070699_100002557 | Ga0070699_1000025572 | 423 |
| 240 | 3300005530 | Ga0070679_100203828 | Ga0070679_1002038282 | 423 |
| 241 | 3300005985 | Ga0081539_10000001 | Ga0081539_10000001196 | 423 |
| 242 | 3300006177 | Ga0075362_10004057 | Ga0075362_100040574 | 423 |
| 243 | 3300006880 | Ga0075429_100115671 | Ga0075429_1001156712 | 423 |
| 244 | 3300009094 | Ga0111539_10010935 | Ga0111539_100109355 | 423 |
| 245 | 3300009094 | Ga0111539_10105836 | Ga0111539_101058363 | 423 |
| 246 | 3300009147 | Ga0114129_10152195 | Ga0114129_101521952 | 423 |
| 247 | 3300009147 | Ga0114129_10366579 | Ga0114129_103665791 | 423 |
| 248 | 3300025906 | Ga0207699_10051285 | Ga0207699_100512852 | 423 |
| 249 | 3300025912 | Ga0207707_10085693 | Ga0207707_100856932 | 423 |
| 250 | 3300027876 | Ga0209974_10016483 | Ga0209974_100164832 | 423 |
| 251 | 3300027907 | Ga0207428_10038696 | Ga0207428_100386965 | 423 |
| 252 | 3300027907 | Ga0207428_10039831 | Ga0207428_100398313 | 423 |
| 253 | 3300038735 | Ga0400485_12796 | Ga0400485_12796_365_1672 | 423 |
| 254 | 3300038741 | Ga0400488_07402 | Ga0400488_07402_72_1379 | 423 |
| 255 | 3300038742 | Ga0400486_05082 | Ga0400486_05082_164_1510 | 423 |
| 256 | 3300038742 | Ga0400486_13186 | Ga0400486_13186_15518_16825 | 423 |
| 257 | 3300039062 | Ga0400483_005012 | Ga0400483_005012_367_1674 | 423 |
| 258 | 3300039062 | Ga0400483_021136 | Ga0400483_021136_9593_10936 | 423 |
| 259 | 3300048922 | Ga0496119_0000930 | Ga0496119_0000930_7796_9229 | 423 |
| 260 | 3300049571 | Ga0501034_0089138 | Ga0501034_0089138_25_1323 | 423 |
| 261 | 3300049579 | Ga0501043_0092599 | Ga0501043_0092599_228_1526 | 423 |
| 262 | 3300050507 | nmdc:mga05p37_32168_c1 | nmdc:mga05p37_32168_c1_4567_5877 | 423 |
| 263 | 3300050511 | nmdc:mga08y16_62637_c1 | nmdc:mga08y16_62637_c1_2029_3342 | 423 |
| 264 | 3300053104 | Ga0500556_0000056 | Ga0500556_0000056_105493_106926 | 423 |
| 265 | 3300053730 | Ga0500645_007755 | Ga0500645_007755_496_1929 | 423 |
| 266 | 3300060353 | Ga0501082_0246235 | Ga0501082_0246235_161_1465 | 423 |
| 267 | 3300061734 | Ga0530510_0010374 | Ga0530510_0010374_4841_6175 | 423 |
| 268 | iso_pu_bacteria | 2841760612 | 2841762262 | 423 |
| 269 | iso_pu_bacteria | 2844104063 | 2844109800 | 423 |
| 270 | iso_pu_bacteria | 2851246043 | 2851248275 | 423 |
| 271 | 3300003320 | rootH2_10148679 | rootH2_101486792 | 424 |
| 272 | 3300003323 | rootH1_10252599 | rootH1_102525992 | 424 |
| 273 | 3300005290 | Ga0065712_10073889 | Ga0065712_100738893 | 424 |
| 274 | 3300005327 | Ga0070658_10123749 | Ga0070658_101237492 | 424 |
| 275 | 3300005328 | Ga0070676_10014946 | Ga0070676_100149463 | 424 |
| 276 | 3300005329 | Ga0070683_100012713 | Ga0070683_1000127134 | 424 |
| 277 | 3300005339 | Ga0070660_100007356 | Ga0070660_1000073566 | 424 |
| 278 | 3300005341 | Ga0070691_10032015 | Ga0070691_100320152 | 424 |
| 279 | 3300005344 | Ga0070661_100011204 | Ga0070661_1000112045 | 424 |
| 280 | 3300005354 | Ga0070675_100004047 | Ga0070675_1000040479 | 424 |
| 281 | 3300005355 | Ga0070671_100012387 | Ga0070671_1000123873 | 424 |
| 282 | 3300005364 | Ga0070673_100002710 | Ga0070673_1000027108 | 424 |
| 283 | 3300005367 | Ga0070667_100010040 | Ga0070667_1000100405 | 424 |
| 284 | 3300005530 | Ga0070679_100016854 | Ga0070679_1000168543 | 424 |
| 285 | 3300005530 | Ga0070679_100030697 | Ga0070679_1000306975 | 424 |
| 286 | 3300005535 | Ga0070684_100012529 | Ga0070684_1000125295 | 424 |
| 287 | 3300005539 | Ga0068853_100000804 | Ga0068853_10000080411 | 424 |
| 288 | 3300005543 | Ga0070672_100023669 | Ga0070672_1000236695 | 424 |
| 289 | 3300005548 | Ga0070665_100016444 | Ga0070665_1000164445 | 424 |
| 290 | 3300005563 | Ga0068855_100355637 | Ga0068855_1003556372 | 424 |
| 291 | 3300005564 | Ga0070664_100266915 | Ga0070664_1002669152 | 424 |
| 292 | 3300005577 | Ga0068857_100004115 | Ga0068857_10000411510 | 424 |
| 293 | 3300005616 | Ga0068852_100043933 | Ga0068852_1000439333 | 424 |
| 294 | 3300005834 | Ga0068851_10003920 | Ga0068851_100039202 | 424 |
| 295 | 3300006358 | Ga0068871_100146038 | Ga0068871_1001460381 | 424 |
| 296 | 3300009093 | Ga0105240_10011457 | Ga0105240_1001145710 | 424 |
| 297 | 3300009098 | Ga0105245_10274077 | Ga0105245_102740771 | 424 |
| 298 | 3300009174 | Ga0105241_10169265 | Ga0105241_101692652 | 424 |
| 299 | 3300009545 | Ga0105237_10006095 | Ga0105237_100060959 | 424 |
| 300 | 3300009545 | Ga0105237_10065026 | Ga0105237_100650262 | 424 |
| 301 | 3300009551 | Ga0105238_10000679 | Ga0105238_1000067931 | 424 |
| 302 | 3300009551 | Ga0105238_10003664 | Ga0105238_100036643 | 424 |
| 303 | 3300010375 | Ga0105239_10010253 | Ga0105239_100102533 | 424 |
| 304 | 3300013104 | Ga0157370_10005882 | Ga0157370_1000588211 | 424 |
| 305 | 3300013105 | Ga0157369_10000744 | Ga0157369_1000074432 | 424 |
| 306 | 3300013105 | Ga0157369_10001683 | Ga0157369_1000168310 | 424 |
| 307 | 3300013296 | Ga0157374_10001080 | Ga0157374_1000108016 | 424 |
| 308 | 3300013296 | Ga0157374_10006463 | Ga0157374_100064634 | 424 |
| 309 | 3300013306 | Ga0163162_10054106 | Ga0163162_100541062 | 424 |
| 310 | 3300013307 | Ga0157372_10289128 | Ga0157372_102891282 | 424 |
| 311 | 3300013308 | Ga0157375_10028139 | Ga0157375_100281392 | 424 |
| 312 | 3300014325 | Ga0163163_10017185 | Ga0163163_100171855 | 424 |
| 313 | 3300025321 | Ga0207656_10011654 | Ga0207656_100116544 | 424 |
| 314 | 3300025909 | Ga0207705_10068427 | Ga0207705_100684272 | 424 |
| 315 | 3300025912 | Ga0207707_10019922 | Ga0207707_100199221 | 424 |
| 316 | 3300025914 | Ga0207671_10013147 | Ga0207671_100131475 | 424 |
| 317 | 3300025919 | Ga0207657_10000717 | Ga0207657_1000071725 | 424 |
| 318 | 3300025921 | Ga0207652_10002172 | Ga0207652_100021728 | 424 |
| 319 | 3300025921 | Ga0207652_10049979 | Ga0207652_100499791 | 424 |
| 320 | 3300025924 | Ga0207694_10007672 | Ga0207694_100076726 | 424 |
| 321 | 3300025926 | Ga0207659_10019474 | Ga0207659_100194741 | 424 |
| 322 | 3300025927 | Ga0207687_10185661 | Ga0207687_101856611 | 424 |
| 323 | 3300025931 | Ga0207644_10101394 | Ga0207644_101013941 | 424 |
| 324 | 3300025932 | Ga0207690_10062260 | Ga0207690_100622602 | 424 |
| 325 | 3300025940 | Ga0207691_10004830 | Ga0207691_1000483011 | 424 |
| 326 | 3300025944 | Ga0207661_10008495 | Ga0207661_100084956 | 424 |
| 327 | 3300025949 | Ga0207667_10005568 | Ga0207667_100055686 | 424 |
| 328 | 3300025986 | Ga0207658_10011282 | Ga0207658_100112826 | 424 |
| 329 | 3300026116 | Ga0207674_10004212 | Ga0207674_1000421210 | 424 |
| 330 | 3300026121 | Ga0207683_10036654 | Ga0207683_100366542 | 424 |
| 331 | 3300028379 | Ga0268266_10144786 | Ga0268266_101447862 | 424 |
| 332 | 3300032002 | Ga0307416_100014083 | Ga0307416_1000140834 | 424 |
| 333 | 3300032126 | Ga0307415_100037601 | Ga0307415_1000376012 | 424 |
| 334 | 3300034818 | Ga0373950_0000029 | Ga0373950_0000029_75588_76907 | 424 |
| 335 | 3300037471 | Ga0395905_0059275 | Ga0395905_0059275_2027_3328 | 424 |
| 336 | 3300039062 | Ga0400483_183966 | Ga0400483_183966_24565_25863 | 424 |
| 337 | 3300048917 | Ga0496114_0001640 | Ga0496114_0001640_8226_9509 | 424 |
| 338 | 3300048928 | Ga0496125_0022711 | Ga0496125_0022711_1776_3095 | 424 |
| 339 | 3300049568 | Ga0501031_0032414 | Ga0501031_0032414_753_2066 | 424 |
| 340 | 3300049569 | Ga0501032_0036179 | Ga0501032_0036179_1474_2787 | 424 |
| 341 | 3300049570 | Ga0501033_0069970 | Ga0501033_0069970_331_1644 | 424 |
| 342 | 3300049574 | Ga0501038_0004862 | Ga0501038_0004862_7632_8945 | 424 |
| 343 | 3300049576 | Ga0501040_0007699 | Ga0501040_0007699_3805_5118 | 424 |
| 344 | 3300049577 | Ga0501041_0000920 | Ga0501041_0000920_13978_15291 | 424 |
| 345 | 3300049578 | Ga0501042_0001626 | Ga0501042_0001626_798_2111 | 424 |
| 346 | 3300049580 | Ga0501046_0004429 | Ga0501046_0004429_527_1840 | 424 |
| 347 | 3300049582 | Ga0501048_0003386 | Ga0501048_0003386_1628_2941 | 424 |
| 348 | 3300049583 | Ga0501067_0000296 | Ga0501067_0000296_14069_15388 | 424 |
| 349 | 3300049583 | Ga0501067_0041189 | Ga0501067_0041189_710_2095 | 424 |
| 350 | 3300049586 | Ga0501070_0102977 | Ga0501070_0102977_793_2106 | 424 |
| 351 | 3300049588 | Ga0501072_0000756 | Ga0501072_0000756_8850_10163 | 424 |
| 352 | 3300049589 | Ga0501073_0012269 | Ga0501073_0012269_4757_6076 | 424 |
| 353 | 3300049591 | Ga0501075_0000100 | Ga0501075_0000100_3721_5034 | 424 |
| 354 | 3300049592 | Ga0501076_0000403 | Ga0501076_0000403_25373_26686 | 424 |
| 355 | 3300049593 | Ga0501077_0001718 | Ga0501077_0001718_1293_2606 | 424 |
| 356 | 3300049741 | Ga0501079_0016489 | Ga0501079_0016489_291_1604 | 424 |
| 357 | 3300049743 | Ga0501081_0010245 | Ga0501081_0010245_4268_5581 | 424 |
| 358 | 3300049824 | Ga0501045_0000694 | Ga0501045_0000694_10826_12139 | 424 |
| 359 | 3300053098 | Ga0500650_0061349 | Ga0500650_0061349_282_1625 | 424 |
| 360 | 3300054114 | Ga0501084_0000458 | Ga0501084_0000458_4310_5623 | 424 |
| 361 | 3300060353 | Ga0501082_0023609 | Ga0501082_0023609_692_2005 | 424 |
| 362 | 3300061734 | Ga0530510_0000157 | Ga0530510_0000157_2113_3426 | 424 |
| 363 | iso_pu_bacteria | 2881101125 | 2881105235 | 424 |
| 364 | iso_pu_bacteria | 2913844669 | 2913850644 | 424 |
| 365 | 3300003323 | rootH1_10339880 | rootH1_103398806 | 425 |
| 366 | 3300005293 | Ga0065715_10000174 | Ga0065715_1000017412 | 425 |
| 367 | 3300005331 | Ga0070670_100081499 | Ga0070670_1000814992 | 425 |
| 368 | 3300005347 | Ga0070668_100012740 | Ga0070668_1000127404 | 425 |
| 369 | 3300005347 | Ga0070668_100105242 | Ga0070668_1001052422 | 425 |
| 370 | 3300005353 | Ga0070669_100009145 | Ga0070669_1000091455 | 425 |
| 371 | 3300005354 | Ga0070675_100010451 | Ga0070675_1000104514 | 425 |
| 372 | 3300005354 | Ga0070675_100069664 | Ga0070675_1000696642 | 425 |
| 373 | 3300005356 | Ga0070674_100013879 | Ga0070674_1000138795 | 425 |
| 374 | 3300005364 | Ga0070673_100240045 | Ga0070673_1002400451 | 425 |
| 375 | 3300005441 | Ga0070700_100043732 | Ga0070700_1000437321 | 425 |
| 376 | 3300005458 | Ga0070681_10001710 | Ga0070681_100017107 | 425 |
| 377 | 3300005466 | Ga0070685_10006771 | Ga0070685_100067712 | 425 |
| 378 | 3300005543 | Ga0070672_100010203 | Ga0070672_1000102034 | 425 |
| 379 | 3300005564 | Ga0070664_100056686 | Ga0070664_1000566863 | 425 |
| 380 | 3300005617 | Ga0068859_100085637 | Ga0068859_1000856372 | 425 |
| 381 | 3300005617 | Ga0068859_100118403 | Ga0068859_1001184032 | 425 |
| 382 | 3300005842 | Ga0068858_100031212 | Ga0068858_1000312124 | 425 |
| 383 | 3300005842 | Ga0068858_100252829 | Ga0068858_1002528292 | 425 |
| 384 | 3300006048 | Ga0075363_100008827 | Ga0075363_1000088274 | 425 |
| 385 | 3300006051 | Ga0075364_10017736 | Ga0075364_100177363 | 425 |
| 386 | 3300006178 | Ga0075367_10052715 | Ga0075367_100527152 | 425 |
| 387 | 3300006195 | Ga0075366_10012587 | Ga0075366_100125874 | 425 |
| 388 | 3300006844 | Ga0075428_100261096 | Ga0075428_1002610962 | 425 |
| 389 | 3300006846 | Ga0075430_100063657 | Ga0075430_1000636573 | 425 |
| 390 | 3300006847 | Ga0075431_100048503 | Ga0075431_1000485033 | 425 |
| 391 | 3300006852 | Ga0075433_10014086 | Ga0075433_100140866 | 425 |
| 392 | 3300006871 | Ga0075434_100001803 | Ga0075434_10000180311 | 425 |
| 393 | 3300006880 | Ga0075429_100099768 | Ga0075429_1000997683 | 425 |
| 394 | 3300006931 | Ga0097620_100085625 | Ga0097620_1000856252 | 425 |
| 395 | 3300006931 | Ga0097620_100118394 | Ga0097620_1001183942 | 425 |
| 396 | 3300007076 | Ga0075435_100013993 | Ga0075435_1000139932 | 425 |
| 397 | 3300009093 | Ga0105240_10031302 | Ga0105240_100313027 | 425 |
| 398 | 3300009094 | Ga0111539_10106140 | Ga0111539_101061402 | 425 |
| 399 | 3300009101 | Ga0105247_10001875 | Ga0105247_100018754 | 425 |
| 400 | 3300009176 | Ga0105242_10032645 | Ga0105242_100326452 | 425 |
| 401 | 3300009176 | Ga0105242_10182824 | Ga0105242_101828242 | 425 |
| 402 | 3300009177 | Ga0105248_10007736 | Ga0105248_100077364 | 425 |
| 403 | 3300009545 | Ga0105237_10037862 | Ga0105237_100378623 | 425 |
| 404 | 3300011119 | Ga0105246_10046978 | Ga0105246_100469782 | 425 |
| 405 | 3300013296 | Ga0157374_10013896 | Ga0157374_100138964 | 425 |
| 406 | 3300013296 | Ga0157374_10033354 | Ga0157374_100333545 | 425 |
| 407 | 3300013296 | Ga0157374_10104578 | Ga0157374_101045782 | 425 |
| 408 | 3300013297 | Ga0157378_10020306 | Ga0157378_100203065 | 425 |
| 409 | 3300013297 | Ga0157378_10172811 | Ga0157378_101728113 | 425 |
| 410 | 3300013306 | Ga0163162_10007245 | Ga0163162_1000724510 | 425 |
| 411 | 3300013308 | Ga0157375_10051322 | Ga0157375_100513224 | 425 |
| 412 | 3300014326 | Ga0157380_10083037 | Ga0157380_100830372 | 425 |
| 413 | 3300014969 | Ga0157376_10128871 | Ga0157376_101288712 | 425 |
| 414 | 3300025304 | Ga0209257_1018208 | Ga0209257_10182082 | 425 |
| 415 | 3300025315 | Ga0207697_10004290 | Ga0207697_100042904 | 425 |
| 416 | 3300025907 | Ga0207645_10005993 | Ga0207645_100059935 | 425 |
| 417 | 3300025921 | Ga0207652_10013614 | Ga0207652_100136142 | 425 |
| 418 | 3300025924 | Ga0207694_10077483 | Ga0207694_100774831 | 425 |
| 419 | 3300025926 | Ga0207659_10115396 | Ga0207659_101153962 | 425 |
| 420 | 3300025931 | Ga0207644_10061184 | Ga0207644_100611842 | 425 |
| 421 | 3300025933 | Ga0207706_10016300 | Ga0207706_100163004 | 425 |
| 422 | 3300025933 | Ga0207706_10099830 | Ga0207706_100998302 | 425 |
| 423 | 3300025934 | Ga0207686_10084288 | Ga0207686_100842882 | 425 |
| 424 | 3300025937 | Ga0207669_10010949 | Ga0207669_100109492 | 425 |
| 425 | 3300025940 | Ga0207691_10010462 | Ga0207691_100104625 | 425 |
| 426 | 3300025940 | Ga0207691_10188881 | Ga0207691_101888812 | 425 |
| 427 | 3300025945 | Ga0207679_10078358 | Ga0207679_100783582 | 425 |
| 428 | 3300026067 | Ga0207678_10006667 | Ga0207678_100066675 | 425 |
| 429 | 3300026075 | Ga0207708_10042773 | Ga0207708_100427733 | 425 |
| 430 | 3300026089 | Ga0207648_10006007 | Ga0207648_100060075 | 425 |
| 431 | 3300027907 | Ga0207428_10007392 | Ga0207428_1000739211 | 425 |
| 432 | 3300028379 | Ga0268266_10156316 | Ga0268266_101563162 | 425 |
| 433 | 3300028653 | Ga0265323_10000045 | Ga0265323_1000004515 | 425 |
| 434 | 3300028654 | Ga0265322_10013015 | Ga0265322_100130152 | 425 |
| 435 | 3300031712 | Ga0265342_10118887 | Ga0265342_101188871 | 425 |
| 436 | 3300036401 | Ga0373937_0002956 | Ga0373937_0002956_8321_9646 | 425 |
| 437 | 3300037471 | Ga0395905_0000042 | Ga0395905_0000042_93909_95234 | 425 |
| 438 | 3300037471 | Ga0395905_0094162 | Ga0395905_0094162_46_1371 | 425 |
| 439 | 3300046492 | Ga0495585_0092069 | Ga0495585_0092069_38_1399 | 425 |
| 440 | 3300046522 | Ga0495643_0002144 | Ga0495643_0002144_9964_11286 | 425 |
| 441 | 3300046616 | Ga0495668_0018990 | Ga0495668_0018990_431_1792 | 425 |
| 442 | 3300047469 | Ga0495673_0031878 | Ga0495673_0031878_708_2069 | 425 |
| 443 | 3300048904 | Ga0496101_0032367 | Ga0496101_0032367_1336_2652 | 425 |
| 444 | 3300048907 | Ga0496104_0060490 | Ga0496104_0060490_570_1886 | 425 |
| 445 | 3300048912 | Ga0496109_0003247 | Ga0496109_0003247_8395_9711 | 425 |
| 446 | 3300048913 | Ga0496110_0022515 | Ga0496110_0022515_3794_5110 | 425 |
| 447 | 3300048915 | Ga0496112_0004187 | Ga0496112_0004187_8225_9541 | 425 |
| 448 | 3300048917 | Ga0496114_0137114 | Ga0496114_0137114_631_1947 | 425 |
| 449 | 3300048924 | Ga0496121_0065494 | Ga0496121_0065494_899_2260 | 425 |
| 450 | 3300050492 | nmdc:mga0yw44_14355_c1 | nmdc:mga0yw44_14355_c1_997_2358 | 425 |
| 451 | 3300050493 | nmdc:mga0k408_9804_c1 | nmdc:mga0k408_9804_c1_862_2223 | 425 |
| 452 | 3300050510 | nmdc:mga06r32_63744_c1 | nmdc:mga06r32_63744_c1_469_1782 | 425 |
| 453 | 3300050510 | nmdc:mga06r32_95524_c1 | nmdc:mga06r32_95524_c1_639_1943 | 425 |
| 454 | 3300050512 | nmdc:mga0n895_6754_c1 | nmdc:mga0n895_6754_c1_1580_2902 | 425 |
| 455 | 3300050512 | nmdc:mga0n895_81129_c1 | nmdc:mga0n895_81129_c1_1062_2375 | 425 |
| 456 | 3300050513 | nmdc:mga0rr50_95112_c1 | nmdc:mga0rr50_95112_c1_108_1430 | 425 |
| 457 | 3300050515 | nmdc:mga0a205_193064_c1 | nmdc:mga0a205_193064_c1_539_1861 | 425 |
| 458 | iso_pu_bacteria | 2824617872 | 2824621793 | 425 |
| 459 | iso_pu_bacteria | 2824626560 | 2824631074 | 425 |
| 460 | iso_pu_bacteria | 2824635225 | 2824637364 | 425 |
| 461 | iso_pu_bacteria | 2824644064 | 2824645664 | 425 |
| 462 | iso_pu_bacteria | 2824714736 | 2824716619 | 425 |
| 463 | iso_pu_bacteria | 2824723954 | 2824725743 | 425 |
| 464 | iso_pu_bacteria | 2906626472 | 2906629462 | 425 |
| 465 | iso_pu_bacteria | 2932801729 | 2932807388 | 425 |
| 466 | iso_pu_bacteria | 2932818245 | 2932824591 | 425 |
| 467 | iso_pu_bacteria | 2935883170 | 2935884405 | 425 |
| 468 | iso_pu_bacteria | 3005587118 | 3005591258 | 425 |
| 469 | 3300003322 | rootL2_10023383 | rootL2_100233833 | 426 |
| 470 | 3300005295 | Ga0065707_10113639 | Ga0065707_101136392 | 426 |
| 471 | 3300005331 | Ga0070670_100012584 | Ga0070670_1000125843 | 426 |
| 472 | 3300005354 | Ga0070675_100019620 | Ga0070675_1000196203 | 426 |
| 473 | 3300005458 | Ga0070681_10047867 | Ga0070681_100478673 | 426 |
| 474 | 3300005471 | Ga0070698_100030202 | Ga0070698_1000302023 | 426 |
| 475 | 3300005518 | Ga0070699_100042906 | Ga0070699_1000429063 | 426 |
| 476 | 3300005535 | Ga0070684_100029313 | Ga0070684_1000293132 | 426 |
| 477 | 3300005535 | Ga0070684_100100769 | Ga0070684_1001007693 | 426 |
| 478 | 3300005563 | Ga0068855_100075189 | Ga0068855_1000751893 | 426 |
| 479 | 3300005564 | Ga0070664_100112941 | Ga0070664_1001129411 | 426 |
| 480 | 3300005719 | Ga0068861_100191462 | Ga0068861_1001914622 | 426 |
| 481 | 3300005842 | Ga0068858_100060263 | Ga0068858_1000602633 | 426 |
| 482 | 3300005981 | Ga0081538_10000244 | Ga0081538_1000024440 | 426 |
| 483 | 3300006844 | Ga0075428_100303402 | Ga0075428_1003034022 | 426 |
| 484 | 3300006846 | Ga0075430_100046779 | Ga0075430_1000467793 | 426 |
| 485 | 3300006847 | Ga0075431_100237148 | Ga0075431_1002371482 | 426 |
| 486 | 3300009147 | Ga0114129_10014221 | Ga0114129_100142217 | 426 |
| 487 | 3300009147 | Ga0114129_10020657 | Ga0114129_100206575 | 426 |
| 488 | 3300025926 | Ga0207659_10061024 | Ga0207659_100610242 | 426 |
| 489 | 3300025945 | Ga0207679_10068786 | Ga0207679_100687862 | 426 |
| 490 | 3300025949 | Ga0207667_10156179 | Ga0207667_101561792 | 426 |
| 491 | 3300026088 | Ga0207641_10044169 | Ga0207641_100441693 | 426 |
| 492 | 3300026116 | Ga0207674_10007348 | Ga0207674_100073486 | 426 |
| 493 | 3300032002 | Ga0307416_100006262 | Ga0307416_1000062625 | 426 |
| 494 | 3300032126 | Ga0307415_100000108 | Ga0307415_10000010823 | 426 |
| 495 | 3300032126 | Ga0307415_100067191 | Ga0307415_1000671912 | 426 |
| 496 | 3300045051 | Ga0451576_0029194 | Ga0451576_0029194_2603_3934 | 426 |
| 497 | 3300046472 | Ga0495580_0000530 | Ga0495580_0000530_7365_8681 | 426 |
| 498 | 3300046531 | Ga0495665_0005197 | Ga0495665_0005197_2862_4178 | 426 |
| 499 | 3300048908 | Ga0496105_0183002 | Ga0496105_0183002_60_1376 | 426 |
| 500 | 3300048911 | Ga0496108_0028909 | Ga0496108_0028909_2541_3857 | 426 |
| 501 | 3300048912 | Ga0496109_0079484 | Ga0496109_0079484_1285_2601 | 426 |
| 502 | 3300048913 | Ga0496110_0016329 | Ga0496110_0016329_3862_5178 | 426 |
| 503 | 3300048914 | Ga0496111_0090603 | Ga0496111_0090603_41_1357 | 426 |
| 504 | 3300048916 | Ga0496113_0042020 | Ga0496113_0042020_1323_2639 | 426 |
| 505 | 3300048917 | Ga0496114_0055147 | Ga0496114_0055147_1000_2316 | 426 |
| 506 | 3300049591 | Ga0501075_0022828 | Ga0501075_0022828_1726_3081 | 426 |
| 507 | 3300049592 | Ga0501076_0080398 | Ga0501076_0080398_497_1852 | 426 |
| 508 | 3300050507 | nmdc:mga05p37_10461_c1 | nmdc:mga05p37_10461_c1_5317_6675 | 426 |
| 509 | 3300050507 | nmdc:mga05p37_230965_c1 | nmdc:mga05p37_230965_c1_113_1504 | 426 |
| 510 | 3300050507 | nmdc:mga05p37_42024_c1 | nmdc:mga05p37_42024_c1_3120_4451 | 426 |
| 511 | 3300050509 | nmdc:mga0qj67_182981_c1 | nmdc:mga0qj67_182981_c1_189_1481 | 426 |
| 512 | 3300053087 | Ga0500643_000058 | Ga0500643_000058_112277_113671 | 426 |
| 513 | 3300053103 | Ga0500555_005142 | Ga0500555_005142_1657_3051 | 426 |
| 514 | 3300053134 | Ga0500658_0039762 | Ga0500658_0039762_291_1685 | 426 |
| 515 | 3300053156 | Ga0500622_0002128 | Ga0500622_0002128_3190_4584 | 426 |
| 516 | 3300053158 | Ga0500627_0012132 | Ga0500627_0012132_1546_2940 | 426 |
| 517 | iso_pu_bacteria | 2857509624 | 2857512565 | 426 |
| 518 | 3300005337 | Ga0070682_100005312 | Ga0070682_1000053127 | 427 |
| 519 | 3300005339 | Ga0070660_100133021 | Ga0070660_1001330212 | 427 |
| 520 | 3300005340 | Ga0070689_100240204 | Ga0070689_1002402041 | 427 |
| 521 | 3300005458 | Ga0070681_10056799 | Ga0070681_100567993 | 427 |
| 522 | 3300005459 | Ga0068867_100043028 | Ga0068867_1000430283 | 427 |
| 523 | 3300005466 | Ga0070685_10132508 | Ga0070685_101325081 | 427 |
| 524 | 3300005468 | Ga0070707_100000358 | Ga0070707_10000035838 | 427 |
| 525 | 3300005471 | Ga0070698_100029949 | Ga0070698_1000299492 | 427 |
| 526 | 3300005518 | Ga0070699_100020246 | Ga0070699_1000202464 | 427 |
| 527 | 3300005842 | Ga0068858_100000162 | Ga0068858_10000016223 | 427 |
| 528 | 3300005842 | Ga0068858_100051726 | Ga0068858_1000517263 | 427 |
| 529 | 3300005937 | Ga0081455_10007276 | Ga0081455_100072765 | 427 |
| 530 | 3300005981 | Ga0081538_10000046 | Ga0081538_1000004664 | 427 |
| 531 | 3300005981 | Ga0081538_10000783 | Ga0081538_100007834 | 427 |
| 532 | 3300005981 | Ga0081538_10058253 | Ga0081538_100582532 | 427 |
| 533 | 3300006028 | Ga0070717_10035209 | Ga0070717_100352093 | 427 |
| 534 | 3300006844 | Ga0075428_100092687 | Ga0075428_1000926874 | 427 |
| 535 | 3300006847 | Ga0075431_100185344 | Ga0075431_1001853442 | 427 |
| 536 | 3300009094 | Ga0111539_10061346 | Ga0111539_100613463 | 427 |
| 537 | 3300009094 | Ga0111539_10173933 | Ga0111539_101739332 | 427 |
| 538 | 3300009101 | Ga0105247_10000913 | Ga0105247_1000091317 | 427 |
| 539 | 3300013105 | Ga0157369_10110065 | Ga0157369_101100653 | 427 |
| 540 | 3300014968 | Ga0157379_10000355 | Ga0157379_1000035522 | 427 |
| 541 | 3300025900 | Ga0207710_10000019 | Ga0207710_10000019237 | 427 |
| 542 | 3300025910 | Ga0207684_10035364 | Ga0207684_100353643 | 427 |
| 543 | 3300025915 | Ga0207693_10155172 | Ga0207693_101551722 | 427 |
| 544 | 3300025917 | Ga0207660_10079089 | Ga0207660_100790892 | 427 |
| 545 | 3300025921 | Ga0207652_10236203 | Ga0207652_102362032 | 427 |
| 546 | 3300025922 | Ga0207646_10000008 | Ga0207646_10000008445 | 427 |
| 547 | 3300025922 | Ga0207646_10000009 | Ga0207646_1000000911 | 427 |
| 548 | 3300026035 | Ga0207703_10000013 | Ga0207703_1000001391 | 427 |
| 549 | 3300026035 | Ga0207703_10053619 | Ga0207703_100536191 | 427 |
| 550 | 3300026075 | Ga0207708_10136537 | Ga0207708_101365372 | 427 |
| 551 | 3300026075 | Ga0207708_10215919 | Ga0207708_102159192 | 427 |
| 552 | 3300027907 | Ga0207428_10090799 | Ga0207428_100907991 | 427 |
| 553 | 3300028794 | Ga0307515_10103951 | Ga0307515_101039512 | 427 |
| 554 | 3300031824 | Ga0307413_10011378 | Ga0307413_100113782 | 427 |
| 555 | 3300031852 | Ga0307410_10130263 | Ga0307410_101302632 | 427 |
| 556 | 3300048922 | Ga0496119_0010914 | Ga0496119_0010914_4325_5794 | 427 |
| 557 | 3300048924 | Ga0496121_0017549 | Ga0496121_0017549_3948_5432 | 427 |
| 558 | 3300049572 | Ga0501036_0267128 | Ga0501036_0267128_60_1388 | 427 |
| 559 | 3300049582 | Ga0501048_0071418 | Ga0501048_0071418_685_2145 | 427 |
| 560 | 3300049592 | Ga0501076_0087304 | Ga0501076_0087304_893_2353 | 427 |
| 561 | 3300050507 | nmdc:mga05p37_169265_c1 | nmdc:mga05p37_169265_c1_973_2322 | 427 |
| 562 | 3300050507 | nmdc:mga05p37_17692_c1 | nmdc:mga05p37_17692_c1_3834_5147 | 427 |
| 563 | 3300050511 | nmdc:mga08y16_19042_c1 | nmdc:mga08y16_19042_c1_5788_7086 | 427 |
| 564 | 3300050514 | nmdc:mga08x19_20866_c1 | nmdc:mga08x19_20866_c1_2167_3525 | 427 |
| 565 | 3300050515 | nmdc:mga0a205_12454_c1 | nmdc:mga0a205_12454_c1_986_2335 | 427 |
| 566 | 3300061734 | Ga0530510_0032471 | Ga0530510_0032471_2059_3369 | 427 |
| 567 | 3300005981 | Ga0081538_10019105 | Ga0081538_100191054 | 428 |
| 568 | 3300006844 | Ga0075428_100052918 | Ga0075428_1000529183 | 428 |
| 569 | 3300006846 | Ga0075430_100014302 | Ga0075430_1000143028 | 428 |
| 570 | 3300006880 | Ga0075429_100049463 | Ga0075429_1000494632 | 428 |
| 571 | 3300009147 | Ga0114129_10057331 | Ga0114129_100573314 | 428 |
| 572 | 3300009553 | Ga0105249_10008095 | Ga0105249_100080958 | 428 |
| 573 | 3300031548 | Ga0307408_100049663 | Ga0307408_1000496633 | 428 |
| 574 | 3300049743 | Ga0501081_0091392 | Ga0501081_0091392_295_1608 | 428 |
| 575 | 3300050510 | nmdc:mga06r32_117087_c1 | nmdc:mga06r32_117087_c1_1066_2379 | 428 |
| 576 | 3300009094 | Ga0111539_10545837 | Ga0111539_105458371 | 429 |
| 577 | 3300009147 | Ga0114129_10019473 | Ga0114129_1001947314 | 429 |
| 578 | 3300050507 | nmdc:mga05p37_11280_c1 | nmdc:mga05p37_11280_c1_7784_9073 | 429 |
| 579 | 3300050515 | nmdc:mga0a205_6351_c1 | nmdc:mga0a205_6351_c1_7744_9033 | 429 |
| 580 | 3300003203 | JGI25406J46586_10011688 | JGI25406J46586_100116883 | 430 |
| 581 | 3300005985 | Ga0081539_10003969 | Ga0081539_100039696 | 430 |
| 582 | 3300005985 | Ga0081539_10054751 | Ga0081539_100547512 | 430 |
| 583 | 3300031731 | Ga0307405_10011066 | Ga0307405_100110665 | 430 |
| 584 | 3300031852 | Ga0307410_10070226 | Ga0307410_100702262 | 430 |
| 585 | 3300031903 | Ga0307407_10002306 | Ga0307407_100023061 | 430 |
| 586 | 3300031995 | Ga0307409_100000840 | Ga0307409_1000008406 | 430 |
| 587 | 3300032002 | Ga0307416_100007369 | Ga0307416_1000073692 | 430 |
| 588 | 3300032004 | Ga0307414_10067788 | Ga0307414_100677883 | 430 |
| 589 | 3300032126 | Ga0307415_100007195 | Ga0307415_1000071956 | 430 |
| 590 | 3300049568 | Ga0501031_0002603 | Ga0501031_0002603_3619_4911 | 430 |
| 591 | 3300049570 | Ga0501033_0005927 | Ga0501033_0005927_577_1869 | 430 |
| 592 | 3300049572 | Ga0501036_0006465 | Ga0501036_0006465_4335_5627 | 430 |
| 593 | 3300049573 | Ga0501037_0009848 | Ga0501037_0009848_800_2092 | 430 |
| 594 | 3300049574 | Ga0501038_0013425 | Ga0501038_0013425_1707_2999 | 430 |
| 595 | 3300049575 | Ga0501039_0000676 | Ga0501039_0000676_15006_16298 | 430 |
| 596 | 3300049576 | Ga0501040_0001477 | Ga0501040_0001477_4405_5697 | 430 |
| 597 | 3300049577 | Ga0501041_0000229 | Ga0501041_0000229_7900_9192 | 430 |
| 598 | 3300049578 | Ga0501042_0000814 | Ga0501042_0000814_7748_9040 | 430 |
| 599 | 3300049579 | Ga0501043_0014454 | Ga0501043_0014454_4372_5664 | 430 |
| 600 | 3300049580 | Ga0501046_0000525 | Ga0501046_0000525_11378_12670 | 430 |
| 601 | 3300049582 | Ga0501048_0002770 | Ga0501048_0002770_4336_5628 | 430 |
| 602 | 3300049587 | Ga0501071_0001060 | Ga0501071_0001060_2962_4254 | 430 |
| 603 | 3300049590 | Ga0501074_0004833 | Ga0501074_0004833_4445_5737 | 430 |
| 604 | 3300049591 | Ga0501075_0002038 | Ga0501075_0002038_5779_7071 | 430 |
| 605 | 3300049592 | Ga0501076_0008372 | Ga0501076_0008372_4414_5706 | 430 |
| 606 | 3300049741 | Ga0501079_0002470 | Ga0501079_0002470_4348_5640 | 430 |
| 607 | 3300049743 | Ga0501081_0001722 | Ga0501081_0001722_7885_9177 | 430 |
| 608 | 3300049824 | Ga0501045_0001055 | Ga0501045_0001055_4449_5741 | 430 |
| 609 | 3300054114 | Ga0501084_0006984 | Ga0501084_0006984_3635_4927 | 430 |
| 610 | 3300060353 | Ga0501082_0000751 | Ga0501082_0000751_9617_10909 | 430 |
| 611 | 3300061734 | Ga0530510_0003857 | Ga0530510_0003857_6020_7312 | 430 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k9t-assembly1.cif.gz_A | crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution | 0.9902 | 4 | 427 |
| 3k9t-assembly1.cif.gz_A | crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution | 0.953 | 4 | 427 |
| 6esl-assembly1.cif.gz_A | crystal structure of the legionella pneumoppila lapa | 0.8223 | 157 | 346 |
| 6ica-assembly1.cif.gz_A | the crystal structure of legionella pneumophila lapa aminopeptidase | 0.8079 | 158 | 346 |
| 6esl-assembly1.cif.gz_B | crystal structure of the legionella pneumoppila lapa | 0.799 | 157 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k9tA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Domain of unknown function DUF2172 | 0.9894 | 58 | 154 | 3.50.30.90 |
| 3k9tA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9847 | 4 | 348 | 3.40.630.10 |
| 3k9tA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Domain of unknown function DUF2172 | 0.9792 | 58 | 154 | 3.50.30.90 |
| 3k9tA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9268 | 4 | 348 | 3.40.630.10 |
| 3k9tA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9249 | 349 | 427 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1J0W6-F1-model_v4 | Uncharacterized protein | 0.9952 | 3 | 151 |
|
| AF-A0A435XR97-F1-model_v4 | DUF4910 domain-containing protein | 0.9951 | 45 | 241 |
|
| AF-W4LVE2-F1-model_v4 | Peptidase M28 | 0.994 | 3 | 316 |
|
| AF-W4MG49-F1-model_v4 | Peptidase M28 | 0.994 | 3 | 269 |
|
| AF-A0A519CZQ2-F1-model_v4 | Peptidase M28 | 0.9936 | 3 | 346 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar