F469101

General Info

Members Datasets Scaffolds Average Seq Length
611 299 585 435

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0071418|Ga0501048_0071418_685_2145
Length 486
Sequence MRLPALEGVDGMIQHSRSNGLRPFWSSRKRTDLGRHFIRTRIDIMTSAGPNEMPSDEELGKDLHNFIAELYPICRSITGEGVRQTLRAIRKRIPLEMFEVPSGTKVFDWTVPLEWNVKDAYVMNREGERVVDFKAHNLHLMSYSAPVRKKMSLAELRPHLFTLPNHPEWIPYRTSYYKESWGFCLRHANLEQLSDDEYEVVIDSSFHSGSLTYGEFCVPGEMSDEILVSCHVCHPSMCNDNLSGITVAVKLAETMAARPRRYSYRFLFIPGTIGSITWLAQNEQMVSRIKHGLVLTGVGDAGNVTYKKSRKGNAEIDRAMAHVLKHSGKAYTMIDFFPYGYDERQYCSPGFDLPVGCFMRTPHGQYTEYHSSADNLDFVKAESLVQSYGECLKAFELLEANRMYMNQNPKCEPQLGRRGLYRSVAGQQEKQWTELALFWVLNASDGHHTLLDIAERADLPFGHIQSATNALLEVGLLQECQRPGNC

Samples

Sample ID Description Type Environment
1 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
2 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
3 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
4 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
5 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
6 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
7 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
8 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
9 2841760612 Bosea sp. Tri-49 Isolate Nodule
10 2844104063 Bosea sp. Tri-39 Isolate Nodule
11 2851246043 Bosea sp. Tri-54 Isolate Nodule
12 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
13 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
14 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
15 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
16 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
17 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
18 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
19 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
20 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
21 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
22 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
23 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
24 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
189 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
190 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
299 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 1.15
Rhizoplane 4.58
Rhizosphere 83.96
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011688 3300003203 Bacteria 3839
2 rootH2_10148679 3300003320 Bacteria 2726
3 rootL2_10023383 3300003322 Bacteria 9730
4 rootL2_10049817 3300003322 Bacteria 1711
5 rootH1_10252599 3300003323 Bacteria 3266
6 rootH1_10339880 3300003323 Bacteria 3576
7 JGI25407J50210_10004743 3300003373 Bacteria 3318
8 Ga0065712_10073889 3300005290 Bacteria 4251
9 Ga0065715_10000174 3300005293 Bacteria 48416
10 Ga0065707_10113639 3300005295 Bacteria 2321
11 Ga0070658_10123749 3300005327 Bacteria 2151
12 Ga0070676_10001826 3300005328 Bacteria 10829
13 Ga0070676_10014946 3300005328 Bacteria 4273
14 Ga0070676_10015035 3300005328 Bacteria 4264
15 Ga0070683_100012713 3300005329 Bacteria 7320
16 Ga0070683_100097143 3300005329 Bacteria 2771
17 Ga0070670_100012584 3300005331 Bacteria 7243
18 Ga0070670_100081499 3300005331 Unclassified 2780
19 Ga0068869_100005780 3300005334 Bacteria 7804
20 Ga0070666_10021962 3300005335 Bacteria 4140
21 Ga0070682_100005312 3300005337 Bacteria 7167
22 Ga0070660_100007356 3300005339 Bacteria 7672
23 Ga0070660_100133021 3300005339 Bacteria 1991
24 Ga0070689_100012177 3300005340 Bacteria 6187
25 Ga0070689_100240204 3300005340 Unclassified 1492
26 Ga0070691_10032015 3300005341 Bacteria 2469
27 Ga0070661_100011204 3300005344 Bacteria 6247
28 Ga0070668_100012740 3300005347 Bacteria 6258
29 Ga0070668_100018462 3300005347 Bacteria 5236
30 Ga0070668_100105242 3300005347 Bacteria 2240
31 Ga0070668_100134103 3300005347 Bacteria 1990
32 Ga0070669_100009145 3300005353 Bacteria 7061
33 Ga0070669_100119079 3300005353 Bacteria 2012
34 Ga0070675_100004047 3300005354 Bacteria 11129
35 Ga0070675_100009586 3300005354 Bacteria 7537
36 Ga0070675_100010451 3300005354 Bacteria 7251
37 Ga0070675_100019620 3300005354 Bacteria 5388
38 Ga0070675_100046141 3300005354 Bacteria 3567
39 Ga0070675_100067291 3300005354 Unclassified 2964
40 Ga0070675_100069664 3300005354 Bacteria 2915
41 Ga0070671_100002729 3300005355 Bacteria 13705
42 Ga0070671_100012387 3300005355 Bacteria 6867
43 Ga0070674_100013879 3300005356 Bacteria 4992
44 Ga0070673_100002710 3300005364 Bacteria 10858
45 Ga0070673_100028244 3300005364 Bacteria 4169
46 Ga0070673_100240045 3300005364 Bacteria 1575
47 Ga0070688_100040025 3300005365 Unclassified 2870
48 Ga0070688_100064522 3300005365 Bacteria 2324
49 Ga0070667_100010040 3300005367 Bacteria 7845
50 Ga0070667_100035403 3300005367 Bacteria 4182
51 Ga0070709_10008665 3300005434 Bacteria 5595
52 Ga0070700_100043732 3300005441 Bacteria 2756
53 Ga0070678_100007881 3300005456 Bacteria 6339
54 Ga0070678_100082698 3300005456 Unclassified 2438
55 Ga0070681_10001710 3300005458 Bacteria 19643
56 Ga0070681_10047867 3300005458 Bacteria 4274
57 Ga0070681_10056799 3300005458 Bacteria 3895
58 Ga0070681_10101142 3300005458 Bacteria 2828
59 Ga0068867_100005112 3300005459 Bacteria 9269
60 Ga0068867_100043028 3300005459 Bacteria 3306
61 Ga0070685_10006771 3300005466 Bacteria 5847
62 Ga0070685_10132508 3300005466 Unclassified 1560
63 Ga0070707_100000358 3300005468 Bacteria 44828
64 Ga0070698_100029949 3300005471 Bacteria 5648
65 Ga0070698_100030202 3300005471 Bacteria 5621
66 Ga0070699_100002557 3300005518 Bacteria 16330
67 Ga0070699_100020246 3300005518 Bacteria 5736
68 Ga0070699_100042906 3300005518 Bacteria 3915
69 Ga0070679_100016854 3300005530 Bacteria 7062
70 Ga0070679_100030697 3300005530 Bacteria 5308
71 Ga0070679_100203828 3300005530 Bacteria 1943
72 Ga0070684_100012529 3300005535 Bacteria 6802
73 Ga0070684_100029313 3300005535 Bacteria 4662
74 Ga0070684_100100769 3300005535 Bacteria 2580
75 Ga0068853_100000804 3300005539 Bacteria 21823
76 Ga0068853_100045751 3300005539 Bacteria 3749
77 Ga0070672_100010203 3300005543 Bacteria 6506
78 Ga0070672_100023669 3300005543 Bacteria 4530
79 Ga0070696_100104890 3300005546 Bacteria 2030
80 Ga0070665_100016444 3300005548 Bacteria 7417
81 Ga0070665_100132038 3300005548 Bacteria 2499
82 Ga0068855_100075189 3300005563 Bacteria 3923
83 Ga0068855_100355637 3300005563 Unclassified 1612
84 Ga0070664_100056686 3300005564 Bacteria 3329
85 Ga0070664_100060363 3300005564 Bacteria 3229
86 Ga0070664_100112941 3300005564 Bacteria 2373
87 Ga0070664_100266915 3300005564 Bacteria 1541
88 Ga0068857_100004115 3300005577 Bacteria 12259
89 Ga0068852_100043933 3300005616 Bacteria 3792
90 Ga0068852_100092307 3300005616 Bacteria 2711
91 Ga0068859_100002746 3300005617 Bacteria 17844
92 Ga0068859_100024104 3300005617 Bacteria 6106
93 Ga0068859_100085637 3300005617 Bacteria 3197
94 Ga0068859_100118403 3300005617 Unclassified 2714
95 Ga0068861_100191462 3300005719 Bacteria 1710
96 Ga0068851_10003920 3300005834 Bacteria 6662
97 Ga0068870_10017270 3300005840 Bacteria 3464
98 Ga0068858_100000162 3300005842 Bacteria 71107
99 Ga0068858_100031212 3300005842 Bacteria 4948
100 Ga0068858_100051726 3300005842 Unclassified 3801
101 Ga0068858_100060263 3300005842 Bacteria 3508
102 Ga0068858_100252829 3300005842 Bacteria 1674
103 Ga0068860_100264790 3300005843 Bacteria 1676
104 Ga0068862_100000909 3300005844 Bacteria 28692
105 Ga0081455_10007276 3300005937 Bacteria 11682
106 Ga0081455_10014788 3300005937 Bacteria 7614
107 Ga0081538_10000046 3300005981 Bacteria 114285
108 Ga0081538_10000244 3300005981 Bacteria 61457
109 Ga0081538_10000642 3300005981 Bacteria 38717
110 Ga0081538_10000783 3300005981 Bacteria 34707
111 Ga0081538_10001180 3300005981 Bacteria 27546
112 Ga0081538_10019105 3300005981 Bacteria 5113
113 Ga0081538_10058253 3300005981 Bacteria 2242
114 Ga0081538_10061157 3300005981 Bacteria 2159
115 Ga0081539_10000001 3300005985 Bacteria 808331
116 Ga0081539_10003969 3300005985 Bacteria 17115
117 Ga0081539_10054751 3300005985 Bacteria 2225
118 Ga0070717_10035209 3300006028 Unclassified 4051
119 Ga0075363_100008827 3300006048 Bacteria 4715
120 Ga0075364_10017736 3300006051 Bacteria 4452
121 Ga0075362_10004057 3300006177 Bacteria 5217
122 Ga0075367_10052715 3300006178 Bacteria 2408
123 Ga0075366_10012587 3300006195 Bacteria 4803
124 Ga0097621_100009693 3300006237 Bacteria 7005
125 Ga0097621_100178619 3300006237 Unclassified 1833
126 Ga0068871_100053710 3300006358 Bacteria 3267
127 Ga0068871_100146038 3300006358 Bacteria 2014
128 Ga0075428_100006634 3300006844 Bacteria 12872
129 Ga0075428_100027750 3300006844 Bacteria 6263
130 Ga0075428_100052918 3300006844 Bacteria 4448
131 Ga0075428_100054082 3300006844 Unclassified 4399
132 Ga0075428_100092687 3300006844 Bacteria 3293
133 Ga0075428_100176180 3300006844 Bacteria 2316
134 Ga0075428_100261096 3300006844 Bacteria 1865
135 Ga0075428_100303402 3300006844 Bacteria 1717
136 Ga0075430_100001319 3300006846 Bacteria 20034
137 Ga0075430_100005418 3300006846 Bacteria 10780
138 Ga0075430_100014302 3300006846 Bacteria 6762
139 Ga0075430_100046779 3300006846 Bacteria 3654
140 Ga0075430_100063657 3300006846 Bacteria 3097
141 Ga0075430_100144898 3300006846 Bacteria 1979
142 Ga0075431_100001013 3300006847 Bacteria 25006
143 Ga0075431_100006560 3300006847 Bacteria 11563
144 Ga0075431_100031930 3300006847 Bacteria 5425
145 Ga0075431_100048503 3300006847 Bacteria 4380
146 Ga0075431_100177348 3300006847 Bacteria 2188
147 Ga0075431_100185344 3300006847 Bacteria 2134
148 Ga0075431_100208135 3300006847 Bacteria 1999
149 Ga0075431_100237148 3300006847 Bacteria 1857
150 Ga0075433_10014086 3300006852 Bacteria 6520
151 Ga0075433_10084192 3300006852 Bacteria 2807
152 Ga0075434_100001803 3300006871 Bacteria 18515
153 Ga0075434_100002123 3300006871 Bacteria 17253
154 Ga0075434_100179957 3300006871 Unclassified 2134
155 Ga0075429_100001229 3300006880 Bacteria 20798
156 Ga0075429_100007253 3300006880 Bacteria 9618
157 Ga0075429_100019270 3300006880 Bacteria 5909
158 Ga0075429_100049463 3300006880 Bacteria 3655
159 Ga0075429_100064360 3300006880 Bacteria 3194
160 Ga0075429_100099768 3300006880 Bacteria 2534
161 Ga0075429_100115671 3300006880 Bacteria 2345
162 Ga0097620_100002746 3300006931 Bacteria 17844
163 Ga0097620_100024104 3300006931 Bacteria 6106
164 Ga0097620_100085625 3300006931 Bacteria 3197
165 Ga0097620_100118394 3300006931 Unclassified 2714
166 Ga0075435_100006393 3300007076 Bacteria 8330
167 Ga0075435_100013993 3300007076 Bacteria 5983
168 Ga0105240_10011457 3300009093 Bacteria 12347
169 Ga0105240_10031302 3300009093 Bacteria 6901
170 Ga0111539_10010935 3300009094 Bacteria 11423
171 Ga0111539_10011267 3300009094 Bacteria 11234
172 Ga0111539_10026766 3300009094 Bacteria 7047
173 Ga0111539_10061346 3300009094 Bacteria 4455
174 Ga0111539_10105836 3300009094 Bacteria 3300
175 Ga0111539_10106140 3300009094 Bacteria 3295
176 Ga0111539_10172635 3300009094 Bacteria 2526
177 Ga0111539_10173933 3300009094 Unclassified 2515
178 Ga0111539_10545837 3300009094 Bacteria 1350
179 Ga0105245_10218785 3300009098 Bacteria 1837
180 Ga0105245_10274077 3300009098 Bacteria 1647
181 Ga0105247_10000913 3300009101 Bacteria 22156
182 Ga0105247_10001875 3300009101 Bacteria 14722
183 Ga0114129_10000163 3300009147 Bacteria 71730
184 Ga0114129_10014221 3300009147 Bacteria 11340
185 Ga0114129_10019473 3300009147 Bacteria 9664
186 Ga0114129_10020657 3300009147 Bacteria 9361
187 Ga0114129_10024176 3300009147 Bacteria 8611
188 Ga0114129_10057331 3300009147 Bacteria 5452
189 Ga0114129_10070367 3300009147 Bacteria 4878
190 Ga0114129_10152195 3300009147 Bacteria 3165
191 Ga0114129_10366579 3300009147 Bacteria 1905
192 Ga0105241_10169265 3300009174 Bacteria 1803
193 Ga0105242_10032645 3300009176 Bacteria 4164
194 Ga0105242_10182824 3300009176 Bacteria 1851
195 Ga0105248_10007736 3300009177 Bacteria 11803
196 Ga0105237_10006095 3300009545 Bacteria 13480
197 Ga0105237_10037862 3300009545 Bacteria 4873
198 Ga0105237_10065026 3300009545 Bacteria 3644
199 Ga0105238_10000679 3300009551 Bacteria 35795
200 Ga0105238_10003664 3300009551 Bacteria 15310
201 Ga0105249_10008095 3300009553 Bacteria 9166
202 Ga0105239_10010253 3300010375 Bacteria 10493
203 Ga0105246_10005664 3300011119 Bacteria 7622
204 Ga0105246_10046978 3300011119 Bacteria 2947
205 Ga0157370_10005882 3300013104 Bacteria 13674
206 Ga0157369_10000744 3300013105 Bacteria 42014
207 Ga0157369_10001683 3300013105 Bacteria 26984
208 Ga0157369_10110065 3300013105 Bacteria 2928
209 Ga0157374_10001080 3300013296 Bacteria 23602
210 Ga0157374_10006463 3300013296 Bacteria 9947
211 Ga0157374_10010229 3300013296 Bacteria 8068
212 Ga0157374_10013896 3300013296 Bacteria 7035
213 Ga0157374_10033354 3300013296 Bacteria 4698
214 Ga0157374_10104578 3300013296 Bacteria 2718
215 Ga0157374_10229227 3300013296 Unclassified 1824
216 Ga0157378_10017330 3300013297 Bacteria 6319
217 Ga0157378_10020306 3300013297 Bacteria 5843
218 Ga0157378_10044857 3300013297 Unclassified 3927
219 Ga0157378_10172811 3300013297 Unclassified 2028
220 Ga0163162_10007245 3300013306 Bacteria 10766
221 Ga0163162_10011825 3300013306 Bacteria 8515
222 Ga0163162_10054106 3300013306 Bacteria 4036
223 Ga0157372_10289128 3300013307 Bacteria 1906
224 Ga0157375_10010387 3300013308 Bacteria 8198
225 Ga0157375_10028139 3300013308 Bacteria 5263
226 Ga0157375_10051322 3300013308 Bacteria 4050
227 Ga0163163_10001522 3300014325 Bacteria 19554
228 Ga0163163_10017185 3300014325 Bacteria 6741
229 Ga0157380_10083037 3300014326 Unclassified 2623
230 Ga0157380_10152593 3300014326 Bacteria 1999
231 Ga0157379_10000355 3300014968 Bacteria 36758
232 Ga0157379_10029980 3300014968 Bacteria 4838
233 Ga0157376_10032003 3300014969 Bacteria 4218
234 Ga0157376_10128871 3300014969 Bacteria 2255
235 Ga0209257_1018208 3300025304 Bacteria 2718
236 Ga0207697_10000619 3300025315 Bacteria 20144
237 Ga0207697_10004290 3300025315 Bacteria 6837
238 Ga0207697_10005063 3300025315 Bacteria 6172
239 Ga0207656_10011654 3300025321 Bacteria 3326
240 Ga0207710_10000019 3300025900 Bacteria 339682
241 Ga0207688_10005446 3300025901 Bacteria 6918
242 Ga0207680_10043715 3300025903 Bacteria 2629
243 Ga0207647_10000980 3300025904 Bacteria 22136
244 Ga0207699_10051285 3300025906 Bacteria 2437
245 Ga0207645_10005993 3300025907 Bacteria 8749
246 Ga0207645_10006095 3300025907 Bacteria 8668
247 Ga0207705_10068427 3300025909 Bacteria 2571
248 Ga0207684_10035364 3300025910 Unclassified 4242
249 Ga0207707_10019922 3300025912 Bacteria 5855
250 Ga0207707_10085693 3300025912 Bacteria 2753
251 Ga0207671_10013147 3300025914 Bacteria 6611
252 Ga0207671_10171175 3300025914 Bacteria 1687
253 Ga0207693_10155172 3300025915 Bacteria 1800
254 Ga0207660_10079089 3300025917 Bacteria 2411
255 Ga0207657_10000717 3300025919 Bacteria 35166
256 Ga0207652_10002172 3300025921 Bacteria 16777
257 Ga0207652_10013614 3300025921 Bacteria 6577
258 Ga0207652_10049979 3300025921 Unclassified 3582
259 Ga0207652_10236203 3300025921 Bacteria 1648
260 Ga0207646_10000008 3300025922 Bacteria 457143
261 Ga0207646_10000009 3300025922 Bacteria 453146
262 Ga0207681_10038290 3300025923 Bacteria 3176
263 Ga0207681_10066978 3300025923 Bacteria 2488
264 Ga0207694_10007672 3300025924 Bacteria 8172
265 Ga0207694_10077483 3300025924 Bacteria 2605
266 Ga0207659_10004027 3300025926 Bacteria 8865
267 Ga0207659_10019474 3300025926 Bacteria 4469
268 Ga0207659_10038362 3300025926 Unclassified 3332
269 Ga0207659_10061024 3300025926 Bacteria 2716
270 Ga0207659_10115396 3300025926 Bacteria 2048
271 Ga0207687_10185661 3300025927 Bacteria 1614
272 Ga0207644_10061184 3300025931 Bacteria 2726
273 Ga0207644_10101394 3300025931 Bacteria 2163
274 Ga0207690_10062260 3300025932 Bacteria 2539
275 Ga0207706_10016300 3300025933 Bacteria 6710
276 Ga0207706_10099830 3300025933 Bacteria 2554
277 Ga0207686_10084288 3300025934 Bacteria 2082
278 Ga0207670_10018592 3300025936 Bacteria 4229
279 Ga0207670_10197721 3300025936 Bacteria 1525
280 Ga0207669_10010949 3300025937 Bacteria 4390
281 Ga0207691_10001669 3300025940 Bacteria 21966
282 Ga0207691_10004830 3300025940 Bacteria 13038
283 Ga0207691_10010462 3300025940 Bacteria 8899
284 Ga0207691_10103100 3300025940 Bacteria 2544
285 Ga0207691_10188881 3300025940 Unclassified 1798
286 Ga0207689_10021724 3300025942 Bacteria 5398
287 Ga0207661_10008495 3300025944 Bacteria 7340
288 Ga0207679_10061185 3300025945 Unclassified 2802
289 Ga0207679_10068786 3300025945 Bacteria 2662
290 Ga0207679_10078358 3300025945 Bacteria 2517
291 Ga0207667_10005568 3300025949 Bacteria 15371
292 Ga0207667_10156179 3300025949 Bacteria 2347
293 Ga0207658_10011282 3300025986 Bacteria 6085
294 Ga0207703_10000013 3300026035 Bacteria 305126
295 Ga0207703_10053619 3300026035 Bacteria 3278
296 Ga0207639_10209178 3300026041 Bacteria 1678
297 Ga0207678_10006667 3300026067 Bacteria 10234
298 Ga0207708_10042773 3300026075 Bacteria 3453
299 Ga0207708_10136537 3300026075 Bacteria 1921
300 Ga0207708_10215919 3300026075 Unclassified 1535
301 Ga0207641_10044169 3300026088 Bacteria 3747
302 Ga0207641_10288615 3300026088 Bacteria 1546
303 Ga0207648_10006007 3300026089 Bacteria 12124
304 Ga0207648_10034358 3300026089 Bacteria 4470
305 Ga0207674_10004212 3300026116 Bacteria 17356
306 Ga0207674_10007348 3300026116 Bacteria 12832
307 Ga0207683_10003028 3300026121 Bacteria 14681
308 Ga0207683_10036654 3300026121 Bacteria 4271
309 Ga0207683_10216385 3300026121 Bacteria 1745
310 Ga0207698_10118471 3300026142 Bacteria 2236
311 Ga0209974_10016483 3300027876 Bacteria 2454
312 Ga0207428_10007392 3300027907 Bacteria 10018
313 Ga0207428_10024711 3300027907 Bacteria 5043
314 Ga0207428_10038696 3300027907 Bacteria 3875
315 Ga0207428_10039831 3300027907 Bacteria 3815
316 Ga0207428_10090799 3300027907 Bacteria 2372
317 Ga0268266_10144786 3300028379 Bacteria 2135
318 Ga0268266_10156316 3300028379 Bacteria 2060
319 Ga0268265_10001085 3300028380 Bacteria 24236
320 Ga0268264_10223428 3300028381 Bacteria 1735
321 Ga0265323_10000045 3300028653 Bacteria 67774
322 Ga0265322_10013015 3300028654 Unclassified 2408
323 Ga0307515_10097821 3300028794 Bacteria 3582
324 Ga0307515_10103951 3300028794 Bacteria 3399
325 Ga0307408_100049663 3300031548 Bacteria 3014
326 Ga0265342_10118887 3300031712 Unclassified 1490
327 Ga0307405_10011066 3300031731 Bacteria 4710
328 Ga0307413_10011378 3300031824 Bacteria 4372
329 Ga0307410_10070226 3300031852 Bacteria 2425
330 Ga0307410_10130263 3300031852 Bacteria 1847
331 Ga0307407_10002306 3300031903 Bacteria 7408
332 Ga0307409_100000840 3300031995 Bacteria 14150
333 Ga0307416_100006262 3300032002 Bacteria 7432
334 Ga0307416_100007369 3300032002 Bacteria 6989
335 Ga0307416_100014083 3300032002 Bacteria 5462
336 Ga0307414_10067788 3300032004 Bacteria 2558
337 Ga0307415_100000108 3300032126 Bacteria 35307
338 Ga0307415_100007195 3300032126 Bacteria 6071
339 Ga0307415_100037601 3300032126 Bacteria 3183
340 Ga0307415_100067191 3300032126 Bacteria 2504
341 Ga0373950_0000029 3300034818 Bacteria 165216
342 Ga0373937_0002956 3300036401 Bacteria 14220
343 Ga0395898_0097113 3300037466 Bacteria 2830
344 Ga0395905_0000042 3300037471 Bacteria 247894
345 Ga0395905_0059275 3300037471 Bacteria 3579
346 Ga0395905_0094162 3300037471 Bacteria 2810
347 Ga0436364_1164223 3300037853 Unclassified 1294
348 Ga0395901_0358010 3300038443 Bacteria 1505
349 Ga0400485_12796 3300038735 Bacteria 4470
350 Ga0400488_07402 3300038741 Bacteria 3440
351 Ga0400486_05082 3300038742 Bacteria 1997
352 Ga0400486_13186 3300038742 Bacteria 20320
353 Ga0400483_005012 3300039062 Bacteria 6958
354 Ga0400483_021136 3300039062 Bacteria 11759
355 Ga0400483_153264 3300039062 Bacteria 2050
356 Ga0400483_183966 3300039062 Bacteria 71423
357 Ga0439445_0003229 3300042004 Bacteria 3656
358 Ga0439446_0001990 3300042156 Bacteria 4827
359 Ga0466960_0013517 3300044901 Bacteria 3471
360 Ga0451576_0029194 3300045051 Bacteria 5902
361 Ga0495592_0069064 3300046454 Bacteria 2577
362 Ga0495638_0024876 3300046460 Bacteria 3897
363 Ga0495653_0037170 3300046463 Bacteria 3829
364 Ga0495580_0000530 3300046472 Bacteria 32278
365 Ga0495585_0092069 3300046492 Bacteria 1632
366 Ga0495607_0060078 3300046501 Bacteria 2165
367 Ga0495608_0051764 3300046511 Bacteria 2720
368 Ga0495643_0002144 3300046522 Bacteria 16235
369 Ga0495652_0052111 3300046529 Bacteria 3491
370 Ga0495665_0005197 3300046531 Bacteria 7016
371 Ga0495587_0001604 3300046536 Bacteria 15042
372 Ga0495645_0022101 3300046543 Bacteria 4601
373 Ga0495667_0075665 3300046559 Bacteria 2190
374 Ga0495668_0018990 3300046616 Bacteria 3969
375 Ga0495625_0128730 3300046660 Bacteria 1716
376 Ga0495635_0139838 3300046663 Bacteria 1649
377 Ga0495599_0032848 3300046678 Bacteria 3258
378 Ga0495647_0068438 3300046681 Bacteria 1416
379 Ga0495669_0030750 3300046684 Bacteria 2357
380 Ga0495670_0000927 3300046691 Bacteria 14161
381 Ga0495600_0089097 3300046809 Bacteria 2013
382 Ga0495660_0086710 3300046810 Bacteria 1634
383 Ga0495604_0069440 3300047317 Bacteria 2670
384 Ga0495673_0031878 3300047469 Bacteria 2465
385 Ga0495684_0002032 3300047471 Bacteria 16287
386 Ga0495602_0034366 3300048088 Bacteria 4743
387 Ga0496101_0032367 3300048904 Bacteria 3681
388 Ga0496102_0024503 3300048905 Bacteria 5365
389 Ga0496104_0003817 3300048907 Bacteria 13038
390 Ga0496104_0060490 3300048907 Bacteria 3588
391 Ga0496105_0004224 3300048908 Bacteria 10793
392 Ga0496105_0020723 3300048908 Bacteria 5314
393 Ga0496105_0183002 3300048908 Bacteria 1715
394 Ga0496107_0072565 3300048910 Unclassified 2503
395 Ga0496108_0009656 3300048911 Bacteria 7820
396 Ga0496108_0028909 3300048911 Bacteria 4587
397 Ga0496108_0036793 3300048911 Bacteria 4074
398 Ga0496108_0078282 3300048911 Bacteria 2798
399 Ga0496108_0130930 3300048911 Bacteria 2156
400 Ga0496109_0003247 3300048912 Bacteria 13547
401 Ga0496109_0015248 3300048912 Bacteria 6691
402 Ga0496109_0079484 3300048912 Bacteria 3021
403 Ga0496110_0016329 3300048913 Bacteria 6198
404 Ga0496110_0022515 3300048913 Bacteria 5352
405 Ga0496111_0090603 3300048914 Bacteria 2240
406 Ga0496111_0199279 3300048914 Unclassified 1488
407 Ga0496112_0002430 3300048915 Bacteria 15005
408 Ga0496112_0004187 3300048915 Bacteria 12151
409 Ga0496112_0132048 3300048915 Bacteria 2468
410 Ga0496113_0042020 3300048916 Bacteria 3376
411 Ga0496113_0140266 3300048916 Bacteria 1901
412 Ga0496114_0001640 3300048917 Bacteria 16982
413 Ga0496114_0055147 3300048917 Bacteria 3315
414 Ga0496114_0137114 3300048917 Bacteria 2116
415 Ga0496119_0000930 3300048922 Bacteria 37751
416 Ga0496119_0010914 3300048922 Bacteria 7589
417 Ga0496119_0041721 3300048922 Bacteria 2918
418 Ga0496121_0017549 3300048924 Bacteria 7301
419 Ga0496121_0065494 3300048924 Bacteria 2956
420 Ga0496125_0022711 3300048928 Bacteria 5816
421 Ga0501031_0000761 3300049568 Bacteria 19398
422 Ga0501031_0002603 3300049568 Bacteria 11490
423 Ga0501031_0032414 3300049568 Bacteria 3407
424 Ga0501032_0036179 3300049569 Bacteria 3372
425 Ga0501033_0005927 3300049570 Bacteria 9593
426 Ga0501033_0036977 3300049570 Bacteria 3657
427 Ga0501033_0069970 3300049570 Bacteria 2578
428 Ga0501034_0060947 3300049571 Bacteria 3790
429 Ga0501034_0089138 3300049571 Bacteria 3082
430 Ga0501036_0000024 3300049572 Bacteria 110026
431 Ga0501036_0006465 3300049572 Bacteria 9521
432 Ga0501036_0267128 3300049572 Bacteria 1433
433 Ga0501037_0008123 3300049573 Bacteria 7690
434 Ga0501037_0009848 3300049573 Bacteria 7015
435 Ga0501037_0094433 3300049573 Bacteria 2163
436 Ga0501038_0003033 3300049574 Bacteria 15665
437 Ga0501038_0004862 3300049574 Bacteria 12484
438 Ga0501038_0013425 3300049574 Bacteria 7466
439 Ga0501039_0000676 3300049575 Bacteria 24615
440 Ga0501039_0001763 3300049575 Bacteria 15968
441 Ga0501040_0001477 3300049576 Bacteria 14918
442 Ga0501040_0007699 3300049576 Bacteria 6969
443 Ga0501040_0008548 3300049576 Bacteria 6644
444 Ga0501041_0000229 3300049577 Bacteria 26123
445 Ga0501041_0000920 3300049577 Bacteria 15948
446 Ga0501041_0004336 3300049577 Bacteria 8203
447 Ga0501042_0000661 3300049578 Bacteria 18527
448 Ga0501042_0000814 3300049578 Bacteria 17228
449 Ga0501042_0001626 3300049578 Bacteria 13368
450 Ga0501043_0014454 3300049579 Bacteria 6179
451 Ga0501043_0024895 3300049579 Bacteria 4696
452 Ga0501043_0092599 3300049579 Bacteria 2376
453 Ga0501046_0000495 3300049580 Bacteria 39248
454 Ga0501046_0000525 3300049580 Bacteria 38015
455 Ga0501046_0004429 3300049580 Bacteria 12748
456 Ga0501046_0041164 3300049580 Bacteria 3688
457 Ga0501046_0046310 3300049580 Bacteria 3452
458 Ga0501047_0069688 3300049581 Bacteria 3386
459 Ga0501047_0095941 3300049581 Bacteria 2844
460 Ga0501047_0217425 3300049581 Bacteria 1768
461 Ga0501048_0000192 3300049582 Bacteria 39421
462 Ga0501048_0002770 3300049582 Bacteria 13375
463 Ga0501048_0003386 3300049582 Bacteria 12119
464 Ga0501048_0071418 3300049582 Bacteria 2451
465 Ga0501067_0000296 3300049583 Bacteria 27251
466 Ga0501067_0011861 3300049583 Bacteria 4830
467 Ga0501067_0041189 3300049583 Bacteria 2565
468 Ga0501068_0015517 3300049584 Bacteria 4376
469 Ga0501070_0006304 3300049586 Bacteria 10096
470 Ga0501070_0102977 3300049586 Bacteria 2361
471 Ga0501070_0107894 3300049586 Bacteria 2301
472 Ga0501071_0000269 3300049587 Bacteria 24497
473 Ga0501071_0001060 3300049587 Bacteria 15229
474 Ga0501071_0017459 3300049587 Bacteria 4949
475 Ga0501072_0000756 3300049588 Bacteria 23584
476 Ga0501072_0001510 3300049588 Bacteria 17434
477 Ga0501073_0002717 3300049589 Bacteria 13254
478 Ga0501073_0012269 3300049589 Bacteria 6253
479 Ga0501073_0063622 3300049589 Bacteria 2573
480 Ga0501074_0001129 3300049590 Bacteria 17480
481 Ga0501074_0004833 3300049590 Bacteria 9655
482 Ga0501074_0007128 3300049590 Bacteria 8078
483 Ga0501075_0000100 3300049591 Bacteria 39814
484 Ga0501075_0000132 3300049591 Bacteria 37143
485 Ga0501075_0002038 3300049591 Bacteria 13369
486 Ga0501075_0022828 3300049591 Bacteria 4575
487 Ga0501076_0000403 3300049592 Bacteria 26968
488 Ga0501076_0008195 3300049592 Bacteria 7653
489 Ga0501076_0008372 3300049592 Bacteria 7579
490 Ga0501076_0080398 3300049592 Bacteria 2616
491 Ga0501076_0087304 3300049592 Bacteria 2508
492 Ga0501077_0001549 3300049593 Bacteria 13860
493 Ga0501077_0001718 3300049593 Bacteria 13213
494 Ga0501077_0038423 3300049593 Bacteria 3047
495 Ga0501079_0002470 3300049741 Bacteria 13423
496 Ga0501079_0016489 3300049741 Bacteria 5642
497 Ga0501079_0079574 3300049741 Bacteria 2534
498 Ga0501080_0015687 3300049742 Bacteria 6985
499 Ga0501081_0001722 3300049743 Bacteria 13581
500 Ga0501081_0006838 3300049743 Bacteria 7418
501 Ga0501081_0010245 3300049743 Bacteria 6120
502 Ga0501081_0091392 3300049743 Bacteria 2141
503 Ga0501083_0005709 3300049744 Bacteria 8807
504 Ga0501083_0014169 3300049744 Bacteria 5576
505 Ga0501035_0002557 3300049822 Bacteria 17793
506 Ga0501035_0227698 3300049822 Bacteria 1590
507 Ga0501044_0100470 3300049823 Bacteria 2911
508 Ga0501045_0000216 3300049824 Bacteria 33098
509 Ga0501045_0000694 3300049824 Bacteria 21409
510 Ga0501045_0001055 3300049824 Bacteria 18154
511 Ga0501045_0114124 3300049824 Bacteria 2004
512 nmdc:mga0yw44_14355_c1 3300050492 Bacteria 4205
513 nmdc:mga0k408_9804_c1 3300050493 Bacteria 5173
514 nmdc:mga05p37_10461_c1 3300050507 Bacteria 11010
515 nmdc:mga05p37_11280_c1 3300050507 Bacteria 10628
516 nmdc:mga05p37_169265_c1 3300050507 Unclassified 2665
517 nmdc:mga05p37_17692_c1 3300050507 Bacteria 8599
518 nmdc:mga05p37_2074_c1 3300050507 Bacteria 23388
519 nmdc:mga05p37_230965_c1 3300050507 Bacteria 2229
520 nmdc:mga05p37_32168_c1 3300050507 Bacteria 6414
521 nmdc:mga05p37_42024_c1 3300050507 Bacteria 5615
522 nmdc:mga05p37_9844_c1 3300050507 Bacteria 11346
523 nmdc:mga09592_125932_c1 3300050508 Bacteria 2202
524 nmdc:mga09592_1577_c1 3300050508 Bacteria 18351
525 nmdc:mga09592_2139_c1 3300050508 Bacteria 15947
526 nmdc:mga09592_2931_c1 3300050508 Bacteria 13823
527 nmdc:mga09592_60765_c1 3300050508 Bacteria 3195
528 nmdc:mga0qj67_182981_c1 3300050509 Bacteria 1702
529 nmdc:mga0qj67_27428_c1 3300050509 Bacteria 4415
530 nmdc:mga0qj67_4545_c1 3300050509 Bacteria 10054
531 nmdc:mga0qj67_74824_c1 3300050509 Bacteria 2706
532 nmdc:mga0qj67_8942_c1 3300050509 Bacteria 7428
533 nmdc:mga06r32_102159_c1 3300050510 Bacteria 2814
534 nmdc:mga06r32_117087_c1 3300050510 Bacteria 2626
535 nmdc:mga06r32_1896_c1 3300050510 Bacteria 18625
536 nmdc:mga06r32_43789_c1 3300050510 Bacteria 4259
537 nmdc:mga06r32_63744_c1 3300050510 Bacteria 3553
538 nmdc:mga06r32_64004_c1 3300050510 Bacteria 3546
539 nmdc:mga06r32_95524_c1 3300050510 Unclassified 2909
540 nmdc:mga08y16_19042_c1 3300050511 Bacteria 7230
541 nmdc:mga08y16_26588_c1 3300050511 Bacteria 6100
542 nmdc:mga08y16_30811_c1 3300050511 Bacteria 5642
543 nmdc:mga08y16_62637_c1 3300050511 Bacteria 3885
544 nmdc:mga0n895_177475_c1 3300050512 Unclassified 2161
545 nmdc:mga0n895_32608_c1 3300050512 Bacteria 5001
546 nmdc:mga0n895_6754_c1 3300050512 Bacteria 9786
547 nmdc:mga0n895_81129_c1 3300050512 Bacteria 3232
548 nmdc:mga0rr50_14988_c1 3300050513 Bacteria 5106
549 nmdc:mga0rr50_95112_c1 3300050513 Bacteria 2328
550 nmdc:mga08x19_20866_c1 3300050514 Unclassified 4037
551 nmdc:mga0a205_12454_c1 3300050515 Bacteria 7869
552 nmdc:mga0a205_193064_c1 3300050515 Bacteria 1928
553 nmdc:mga0a205_3083_c1 3300050515 Bacteria 14795
554 nmdc:mga0a205_6351_c1 3300050515 Bacteria 10674
555 Ga0495655_0017469 3300053083 Bacteria 1563
556 Ga0500643_000058 3300053087 Bacteria 130051
557 Ga0500644_0039618 3300053088 Bacteria 1554
558 Ga0500641_0055271 3300053096 Bacteria 1643
559 Ga0500650_0000778 3300053098 Bacteria 8710
560 Ga0500650_0061349 3300053098 Bacteria 1756
561 Ga0500555_005142 3300053103 Bacteria 3711
562 Ga0500556_0000056 3300053104 Bacteria 115367
563 Ga0500562_000439 3300053108 Bacteria 10144
564 Ga0500572_000346 3300053111 Bacteria 16615
565 Ga0500658_0039762 3300053134 Bacteria 1881
566 Ga0500658_0086119 3300053134 Bacteria 1351
567 Ga0500559_0001050 3300053136 Bacteria 16871
568 Ga0500568_0005744 3300053139 Bacteria 6356
569 Ga0500622_0002128 3300053156 Bacteria 14750
570 Ga0500627_0012132 3300053158 Bacteria 3217
571 Ga0500645_007755 3300053730 Bacteria 3713
572 Ga0500645_023819 3300053730 Bacteria 1875
573 Ga0501084_0000458 3300054114 Bacteria 31426
574 Ga0501084_0003009 3300054114 Bacteria 13654
575 Ga0501084_0003198 3300054114 Bacteria 13258
576 Ga0501084_0006984 3300054114 Bacteria 9303
577 Ga0501082_0000751 3300060353 Bacteria 28467
578 Ga0501082_0002116 3300060353 Bacteria 17493
579 Ga0501082_0023609 3300060353 Bacteria 5304
580 Ga0501082_0246235 3300060353 Bacteria 1556
581 Ga0530510_0000013 3300061734 Bacteria 110065
582 Ga0530510_0000157 3300061734 Bacteria 40698
583 Ga0530510_0003857 3300061734 Bacteria 10333
584 Ga0530510_0010374 3300061734 Bacteria 6531
585 Ga0530510_0032471 3300061734 Bacteria 3756

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0358010 Ga0395901_0358010_426_1493 351
2 3300048912 Ga0496109_0015248 Ga0496109_0015248_5447_6556 365
3 3300037853 Ga0436364_1164223 Ga0436364_1164223_140_1279 376
4 3300046501 Ga0495607_0060078 Ga0495607_0060078_1007_2143 378
5 3300053730 Ga0500645_023819 Ga0500645_023819_46_1182 378
6 3300039062 Ga0400483_153264 Ga0400483_153264_23_1165 380
7 3300049824 Ga0501045_0114124 Ga0501045_0114124_91_1263 387
8 3300005617 Ga0068859_100002746 Ga0068859_1000027462 394
9 3300005843 Ga0068860_100264790 Ga0068860_1002647902 394
10 3300006931 Ga0097620_100002746 Ga0097620_1000027462 394
11 3300025936 Ga0207670_10197721 Ga0207670_101977212 394
12 3300028381 Ga0268264_10223428 Ga0268264_102234282 394
13 3300050508 nmdc:mga09592_1577_c1 nmdc:mga09592_1577_c1_14378_15667 399
14 3300050509 nmdc:mga0qj67_4545_c1 nmdc:mga0qj67_4545_c1_1689_2978 399
15 3300006846 Ga0075430_100001319 Ga0075430_1000013193 405
16 3300006880 Ga0075429_100001229 Ga0075429_1000012293 405
17 3300042004 Ga0439445_0003229 Ga0439445_0003229_909_2189 406
18 3300042156 Ga0439446_0001990 Ga0439446_0001990_1353_2633 406
19 3300053083 Ga0495655_0017469 Ga0495655_0017469_258_1508 406
20 3300005617 Ga0068859_100024104 Ga0068859_1000241043 410
21 3300006847 Ga0075431_100006560 Ga0075431_1000065608 410
22 3300006880 Ga0075429_100019270 Ga0075429_1000192705 410
23 3300006931 Ga0097620_100024104 Ga0097620_1000241043 410
24 3300009147 Ga0114129_10000163 Ga0114129_1000016357 410
25 3300050507 nmdc:mga05p37_2074_c1 nmdc:mga05p37_2074_c1_10543_11841 410
26 3300050508 nmdc:mga09592_2931_c1 nmdc:mga09592_2931_c1_3996_5294 410
27 3300050509 nmdc:mga0qj67_27428_c1 nmdc:mga0qj67_27428_c1_1347_2645 410
28 3300050510 nmdc:mga06r32_1896_c1 nmdc:mga06r32_1896_c1_9702_11000 410
29 iso_pu_bacteria 2675903060 2676494946 411
30 3300009147 Ga0114129_10070367 Ga0114129_100703675 413
31 3300014969 Ga0157376_10032003 Ga0157376_100320035 413
32 3300046810 Ga0495660_0086710 Ga0495660_0086710_44_1291 415
33 3300053108 Ga0500562_000439 Ga0500562_000439_29_1276 415
34 3300053134 Ga0500658_0086119 Ga0500658_0086119_15_1262 415
35 3300006847 Ga0075431_100177348 Ga0075431_1001773483 416
36 3300006852 Ga0075433_10084192 Ga0075433_100841923 416
37 3300006871 Ga0075434_100002123 Ga0075434_10000212311 416
38 3300006880 Ga0075429_100007253 Ga0075429_1000072533 416
39 3300007076 Ga0075435_100006393 Ga0075435_1000063935 416
40 3300009147 Ga0114129_10024176 Ga0114129_100241767 416
41 3300025914 Ga0207671_10171175 Ga0207671_101711752 416
42 3300046663 Ga0495635_0139838 Ga0495635_0139838_13_1263 416
43 3300050507 nmdc:mga05p37_9844_c1 nmdc:mga05p37_9844_c1_1136_2419 416
44 3300050508 nmdc:mga09592_2139_c1 nmdc:mga09592_2139_c1_13400_14683 416
45 3300050510 nmdc:mga06r32_102159_c1 nmdc:mga06r32_102159_c1_173_1456 416
46 3300050512 nmdc:mga0n895_32608_c1 nmdc:mga0n895_32608_c1_1584_2867 416
47 3300050513 nmdc:mga0rr50_14988_c1 nmdc:mga0rr50_14988_c1_2792_4075 416
48 3300050515 nmdc:mga0a205_3083_c1 nmdc:mga0a205_3083_c1_4661_5944 416
49 3300053111 Ga0500572_000346 Ga0500572_000346_9950_11209 416
50 3300053136 Ga0500559_0001050 Ga0500559_0001050_1687_2946 416
51 3300049571 Ga0501034_0060947 Ga0501034_0060947_1929_3191 417
52 3300049573 Ga0501037_0008123 Ga0501037_0008123_5836_7089 417
53 3300049580 Ga0501046_0046310 Ga0501046_0046310_528_1781 417
54 3300049581 Ga0501047_0069688 Ga0501047_0069688_359_1612 417
55 3300049581 Ga0501047_0217425 Ga0501047_0217425_32_1294 417
56 3300049583 Ga0501067_0011861 Ga0501067_0011861_1664_2926 417
57 3300049586 Ga0501070_0006304 Ga0501070_0006304_7104_8366 417
58 3300049587 Ga0501071_0017459 Ga0501071_0017459_1919_3181 417
59 3300049589 Ga0501073_0002717 Ga0501073_0002717_3871_5133 417
60 3300049590 Ga0501074_0007128 Ga0501074_0007128_3294_4556 417
61 3300049593 Ga0501077_0038423 Ga0501077_0038423_476_1738 417
62 3300049742 Ga0501080_0015687 Ga0501080_0015687_1433_2695 417
63 3300049744 Ga0501083_0014169 Ga0501083_0014169_2526_3788 417
64 3300049822 Ga0501035_0227698 Ga0501035_0227698_43_1296 417
65 3300049823 Ga0501044_0100470 Ga0501044_0100470_1350_2603 417
66 3300003373 JGI25407J50210_10004743 JGI25407J50210_100047432 418
67 3300005937 Ga0081455_10014788 Ga0081455_100147884 418
68 3300005981 Ga0081538_10061157 Ga0081538_100611573 418
69 3300006844 Ga0075428_100006634 Ga0075428_10000663411 418
70 3300006844 Ga0075428_100176180 Ga0075428_1001761802 418
71 3300006846 Ga0075430_100144898 Ga0075430_1001448982 418
72 3300006847 Ga0075431_100031930 Ga0075431_1000319303 418
73 3300046681 Ga0495647_0068438 Ga0495647_0068438_19_1275 418
74 3300049586 Ga0501070_0107894 Ga0501070_0107894_19_1293 418
75 3300050508 nmdc:mga09592_125932_c1 nmdc:mga09592_125932_c1_311_1567 418
76 3300050509 nmdc:mga0qj67_74824_c1 nmdc:mga0qj67_74824_c1_620_1879 418
77 3300050510 nmdc:mga06r32_64004_c1 nmdc:mga06r32_64004_c1_1834_3093 418
78 iso_pu_bacteria 2895427314 2895432761 418
79 3300005334 Ga0068869_100005780 Ga0068869_1000057805 419
80 3300005355 Ga0070671_100002729 Ga0070671_1000027293 419
81 3300005434 Ga0070709_10008665 Ga0070709_100086654 419
82 3300005539 Ga0068853_100045751 Ga0068853_1000457513 419
83 3300005840 Ga0068870_10017270 Ga0068870_100172703 419
84 3300005844 Ga0068862_100000909 Ga0068862_10000090910 419
85 3300009094 Ga0111539_10026766 Ga0111539_100267663 419
86 3300011119 Ga0105246_10005664 Ga0105246_100056644 419
87 3300014325 Ga0163163_10001522 Ga0163163_100015223 419
88 3300014968 Ga0157379_10029980 Ga0157379_100299803 419
89 3300025315 Ga0207697_10005063 Ga0207697_100050634 419
90 3300025904 Ga0207647_10000980 Ga0207647_1000098016 419
91 3300025942 Ga0207689_10021724 Ga0207689_100217245 419
92 3300026041 Ga0207639_10209178 Ga0207639_102091781 419
93 3300026088 Ga0207641_10288615 Ga0207641_102886151 419
94 3300026142 Ga0207698_10118471 Ga0207698_101184712 419
95 3300028380 Ga0268265_10001085 Ga0268265_1000108519 419
96 3300048905 Ga0496102_0024503 Ga0496102_0024503_801_2162 419
97 3300048907 Ga0496104_0003817 Ga0496104_0003817_2625_3986 419
98 3300048908 Ga0496105_0004224 Ga0496105_0004224_3249_4610 419
99 3300048911 Ga0496108_0009656 Ga0496108_0009656_5927_7288 419
100 3300048915 Ga0496112_0002430 Ga0496112_0002430_10264_11625 419
101 3300048916 Ga0496113_0140266 Ga0496113_0140266_271_1632 419
102 3300048922 Ga0496119_0041721 Ga0496119_0041721_801_2162 419
103 3300049568 Ga0501031_0000761 Ga0501031_0000761_8442_9728 419
104 3300049570 Ga0501033_0036977 Ga0501033_0036977_1353_2639 419
105 3300049572 Ga0501036_0000024 Ga0501036_0000024_104400_105686 419
106 3300049574 Ga0501038_0003033 Ga0501038_0003033_10015_11301 419
107 3300049575 Ga0501039_0001763 Ga0501039_0001763_14002_15288 419
108 3300049576 Ga0501040_0008548 Ga0501040_0008548_1019_2305 419
109 3300049577 Ga0501041_0004336 Ga0501041_0004336_4040_5326 419
110 3300049578 Ga0501042_0000661 Ga0501042_0000661_4394_5680 419
111 3300049579 Ga0501043_0024895 Ga0501043_0024895_933_2219 419
112 3300049580 Ga0501046_0000495 Ga0501046_0000495_33629_34915 419
113 3300049582 Ga0501048_0000192 Ga0501048_0000192_4328_5614 419
114 3300049587 Ga0501071_0000269 Ga0501071_0000269_13905_15191 419
115 3300049588 Ga0501072_0001510 Ga0501072_0001510_4345_5631 419
116 3300049590 Ga0501074_0001129 Ga0501074_0001129_11829_13115 419
117 3300049591 Ga0501075_0000132 Ga0501075_0000132_31576_32862 419
118 3300049592 Ga0501076_0008195 Ga0501076_0008195_4348_5634 419
119 3300049593 Ga0501077_0001549 Ga0501077_0001549_11749_13035 419
120 3300049741 Ga0501079_0079574 Ga0501079_0079574_927_2213 419
121 3300049743 Ga0501081_0006838 Ga0501081_0006838_1747_3033 419
122 3300049822 Ga0501035_0002557 Ga0501035_0002557_12213_13499 419
123 3300049824 Ga0501045_0000216 Ga0501045_0000216_31132_32418 419
124 3300050511 nmdc:mga08y16_26588_c1 nmdc:mga08y16_26588_c1_43_1323 419
125 3300054114 Ga0501084_0003198 Ga0501084_0003198_7591_8877 419
126 3300060353 Ga0501082_0002116 Ga0501082_0002116_11549_12835 419
127 3300061734 Ga0530510_0000013 Ga0530510_0000013_4396_5682 419
128 3300003322 rootL2_10049817 rootL2_100498171 420
129 3300005329 Ga0070683_100097143 Ga0070683_1000971433 420
130 3300005335 Ga0070666_10021962 Ga0070666_100219625 420
131 3300005340 Ga0070689_100012177 Ga0070689_1000121776 420
132 3300005347 Ga0070668_100018462 Ga0070668_1000184622 420
133 3300005354 Ga0070675_100009586 Ga0070675_1000095865 420
134 3300005354 Ga0070675_100046141 Ga0070675_1000461413 420
135 3300005364 Ga0070673_100028244 Ga0070673_1000282442 420
136 3300005365 Ga0070688_100040025 Ga0070688_1000400253 420
137 3300005365 Ga0070688_100064522 Ga0070688_1000645222 420
138 3300005367 Ga0070667_100035403 Ga0070667_1000354034 420
139 3300005456 Ga0070678_100007881 Ga0070678_1000078812 420
140 3300005459 Ga0068867_100005112 Ga0068867_1000051126 420
141 3300005546 Ga0070696_100104890 Ga0070696_1001048902 420
142 3300005548 Ga0070665_100132038 Ga0070665_1001320382 420
143 3300005564 Ga0070664_100060363 Ga0070664_1000603633 420
144 3300005616 Ga0068852_100092307 Ga0068852_1000923072 420
145 3300006237 Ga0097621_100009693 Ga0097621_1000096934 420
146 3300006358 Ga0068871_100053710 Ga0068871_1000537102 420
147 3300006844 Ga0075428_100027750 Ga0075428_1000277503 420
148 3300009094 Ga0111539_10011267 Ga0111539_100112673 420
149 3300013296 Ga0157374_10010229 Ga0157374_100102293 420
150 3300013297 Ga0157378_10017330 Ga0157378_100173303 420
151 3300013306 Ga0163162_10011825 Ga0163162_100118255 420
152 3300013308 Ga0157375_10010387 Ga0157375_1001038710 420
153 3300014326 Ga0157380_10152593 Ga0157380_101525932 420
154 3300025315 Ga0207697_10000619 Ga0207697_100006197 420
155 3300025901 Ga0207688_10005446 Ga0207688_100054462 420
156 3300025907 Ga0207645_10006095 Ga0207645_100060954 420
157 3300025923 Ga0207681_10038290 Ga0207681_100382904 420
158 3300025926 Ga0207659_10004027 Ga0207659_100040275 420
159 3300025936 Ga0207670_10018592 Ga0207670_100185925 420
160 3300025940 Ga0207691_10001669 Ga0207691_100016699 420
161 3300025940 Ga0207691_10103100 Ga0207691_101031001 420
162 3300025945 Ga0207679_10061185 Ga0207679_100611852 420
163 3300026089 Ga0207648_10034358 Ga0207648_100343584 420
164 3300026121 Ga0207683_10003028 Ga0207683_1000302815 420
165 3300027907 Ga0207428_10024711 Ga0207428_100247112 420
166 3300046684 Ga0495669_0030750 Ga0495669_0030750_406_1716 420
167 3300049584 Ga0501068_0015517 Ga0501068_0015517_1057_2349 420
168 3300049589 Ga0501073_0063622 Ga0501073_0063622_1228_2517 420
169 3300050511 nmdc:mga08y16_30811_c1 nmdc:mga08y16_30811_c1_1040_2356 420
170 iso_pu_bacteria 2811994917 2812478234 420
171 iso_pu_bacteria 2891395885 2891399119 420
172 iso_pu_bacteria 8006964411 8006972664 420
173 iso_pu_bacteria 8054160619 8054165280 420
174 3300005981 Ga0081538_10000642 Ga0081538_1000064223 421
175 3300006847 Ga0075431_100001013 Ga0075431_10000101319 421
176 3300028794 Ga0307515_10097821 Ga0307515_100978213 421
177 3300044901 Ga0466960_0013517 Ga0466960_0013517_1492_2757 421
178 3300046460 Ga0495638_0024876 Ga0495638_0024876_1581_2918 421
179 3300046660 Ga0495625_0128730 Ga0495625_0128730_313_1650 421
180 3300046691 Ga0495670_0000927 Ga0495670_0000927_9062_10399 421
181 3300048908 Ga0496105_0020723 Ga0496105_0020723_325_1590 421
182 3300048910 Ga0496107_0072565 Ga0496107_0072565_1015_2280 421
183 3300048911 Ga0496108_0130930 Ga0496108_0130930_711_1976 421
184 3300048914 Ga0496111_0199279 Ga0496111_0199279_180_1445 421
185 3300049581 Ga0501047_0095941 Ga0501047_0095941_774_2054 421
186 3300049744 Ga0501083_0005709 Ga0501083_0005709_5221_6501 421
187 3300053088 Ga0500644_0039618 Ga0500644_0039618_179_1516 421
188 3300053096 Ga0500641_0055271 Ga0500641_0055271_49_1386 421
189 3300053098 Ga0500650_0000778 Ga0500650_0000778_2854_4191 421
190 3300053139 Ga0500568_0005744 Ga0500568_0005744_1089_2426 421
191 3300054114 Ga0501084_0003009 Ga0501084_0003009_1630_2910 421
192 iso_pu_bacteria 2884693830 2884694398 421
193 iso_pu_bacteria 2895442618 2895444292 421
194 iso_pu_bacteria 2919073203 2919077607 421
195 3300005328 Ga0070676_10015035 Ga0070676_100150354 422
196 3300005347 Ga0070668_100134103 Ga0070668_1001341032 422
197 3300005353 Ga0070669_100119079 Ga0070669_1001190792 422
198 3300005354 Ga0070675_100067291 Ga0070675_1000672913 422
199 3300005456 Ga0070678_100082698 Ga0070678_1000826982 422
200 3300005981 Ga0081538_10001180 Ga0081538_1000118014 422
201 3300006237 Ga0097621_100178619 Ga0097621_1001786192 422
202 3300006844 Ga0075428_100054082 Ga0075428_1000540822 422
203 3300006846 Ga0075430_100005418 Ga0075430_1000054184 422
204 3300006847 Ga0075431_100208135 Ga0075431_1002081352 422
205 3300006871 Ga0075434_100179957 Ga0075434_1001799572 422
206 3300006880 Ga0075429_100064360 Ga0075429_1000643603 422
207 3300009094 Ga0111539_10172635 Ga0111539_101726353 422
208 3300009098 Ga0105245_10218785 Ga0105245_102187851 422
209 3300013296 Ga0157374_10229227 Ga0157374_102292272 422
210 3300013297 Ga0157378_10044857 Ga0157378_100448573 422
211 3300025903 Ga0207680_10043715 Ga0207680_100437152 422
212 3300025923 Ga0207681_10066978 Ga0207681_100669783 422
213 3300025926 Ga0207659_10038362 Ga0207659_100383623 422
214 3300026121 Ga0207683_10216385 Ga0207683_102163851 422
215 3300037466 Ga0395898_0097113 Ga0395898_0097113_49_1353 422
216 3300046454 Ga0495592_0069064 Ga0495592_0069064_873_2153 422
217 3300046463 Ga0495653_0037170 Ga0495653_0037170_1251_2531 422
218 3300046511 Ga0495608_0051764 Ga0495608_0051764_1290_2570 422
219 3300046529 Ga0495652_0052111 Ga0495652_0052111_1177_2457 422
220 3300046536 Ga0495587_0001604 Ga0495587_0001604_10041_11321 422
221 3300046543 Ga0495645_0022101 Ga0495645_0022101_554_1834 422
222 3300046559 Ga0495667_0075665 Ga0495667_0075665_133_1413 422
223 3300046678 Ga0495599_0032848 Ga0495599_0032848_316_1596 422
224 3300046809 Ga0495600_0089097 Ga0495600_0089097_83_1363 422
225 3300047317 Ga0495604_0069440 Ga0495604_0069440_1137_2417 422
226 3300047471 Ga0495684_0002032 Ga0495684_0002032_5035_6315 422
227 3300048088 Ga0495602_0034366 Ga0495602_0034366_2896_4176 422
228 3300048911 Ga0496108_0036793 Ga0496108_0036793_99_1391 422
229 3300048911 Ga0496108_0078282 Ga0496108_0078282_966_2240 422
230 3300048915 Ga0496112_0132048 Ga0496112_0132048_858_2150 422
231 3300049573 Ga0501037_0094433 Ga0501037_0094433_57_1361 422
232 3300049580 Ga0501046_0041164 Ga0501046_0041164_2251_3555 422
233 3300050508 nmdc:mga09592_60765_c1 nmdc:mga09592_60765_c1_1493_2797 422
234 3300050509 nmdc:mga0qj67_8942_c1 nmdc:mga0qj67_8942_c1_2961_4265 422
235 3300050510 nmdc:mga06r32_43789_c1 nmdc:mga06r32_43789_c1_2798_4102 422
236 3300050512 nmdc:mga0n895_177475_c1 nmdc:mga0n895_177475_c1_305_1642 422
237 3300005328 Ga0070676_10001826 Ga0070676_1000182611 423
238 3300005458 Ga0070681_10101142 Ga0070681_101011422 423
239 3300005518 Ga0070699_100002557 Ga0070699_1000025572 423
240 3300005530 Ga0070679_100203828 Ga0070679_1002038282 423
241 3300005985 Ga0081539_10000001 Ga0081539_10000001196 423
242 3300006177 Ga0075362_10004057 Ga0075362_100040574 423
243 3300006880 Ga0075429_100115671 Ga0075429_1001156712 423
244 3300009094 Ga0111539_10010935 Ga0111539_100109355 423
245 3300009094 Ga0111539_10105836 Ga0111539_101058363 423
246 3300009147 Ga0114129_10152195 Ga0114129_101521952 423
247 3300009147 Ga0114129_10366579 Ga0114129_103665791 423
248 3300025906 Ga0207699_10051285 Ga0207699_100512852 423
249 3300025912 Ga0207707_10085693 Ga0207707_100856932 423
250 3300027876 Ga0209974_10016483 Ga0209974_100164832 423
251 3300027907 Ga0207428_10038696 Ga0207428_100386965 423
252 3300027907 Ga0207428_10039831 Ga0207428_100398313 423
253 3300038735 Ga0400485_12796 Ga0400485_12796_365_1672 423
254 3300038741 Ga0400488_07402 Ga0400488_07402_72_1379 423
255 3300038742 Ga0400486_05082 Ga0400486_05082_164_1510 423
256 3300038742 Ga0400486_13186 Ga0400486_13186_15518_16825 423
257 3300039062 Ga0400483_005012 Ga0400483_005012_367_1674 423
258 3300039062 Ga0400483_021136 Ga0400483_021136_9593_10936 423
259 3300048922 Ga0496119_0000930 Ga0496119_0000930_7796_9229 423
260 3300049571 Ga0501034_0089138 Ga0501034_0089138_25_1323 423
261 3300049579 Ga0501043_0092599 Ga0501043_0092599_228_1526 423
262 3300050507 nmdc:mga05p37_32168_c1 nmdc:mga05p37_32168_c1_4567_5877 423
263 3300050511 nmdc:mga08y16_62637_c1 nmdc:mga08y16_62637_c1_2029_3342 423
264 3300053104 Ga0500556_0000056 Ga0500556_0000056_105493_106926 423
265 3300053730 Ga0500645_007755 Ga0500645_007755_496_1929 423
266 3300060353 Ga0501082_0246235 Ga0501082_0246235_161_1465 423
267 3300061734 Ga0530510_0010374 Ga0530510_0010374_4841_6175 423
268 iso_pu_bacteria 2841760612 2841762262 423
269 iso_pu_bacteria 2844104063 2844109800 423
270 iso_pu_bacteria 2851246043 2851248275 423
271 3300003320 rootH2_10148679 rootH2_101486792 424
272 3300003323 rootH1_10252599 rootH1_102525992 424
273 3300005290 Ga0065712_10073889 Ga0065712_100738893 424
274 3300005327 Ga0070658_10123749 Ga0070658_101237492 424
275 3300005328 Ga0070676_10014946 Ga0070676_100149463 424
276 3300005329 Ga0070683_100012713 Ga0070683_1000127134 424
277 3300005339 Ga0070660_100007356 Ga0070660_1000073566 424
278 3300005341 Ga0070691_10032015 Ga0070691_100320152 424
279 3300005344 Ga0070661_100011204 Ga0070661_1000112045 424
280 3300005354 Ga0070675_100004047 Ga0070675_1000040479 424
281 3300005355 Ga0070671_100012387 Ga0070671_1000123873 424
282 3300005364 Ga0070673_100002710 Ga0070673_1000027108 424
283 3300005367 Ga0070667_100010040 Ga0070667_1000100405 424
284 3300005530 Ga0070679_100016854 Ga0070679_1000168543 424
285 3300005530 Ga0070679_100030697 Ga0070679_1000306975 424
286 3300005535 Ga0070684_100012529 Ga0070684_1000125295 424
287 3300005539 Ga0068853_100000804 Ga0068853_10000080411 424
288 3300005543 Ga0070672_100023669 Ga0070672_1000236695 424
289 3300005548 Ga0070665_100016444 Ga0070665_1000164445 424
290 3300005563 Ga0068855_100355637 Ga0068855_1003556372 424
291 3300005564 Ga0070664_100266915 Ga0070664_1002669152 424
292 3300005577 Ga0068857_100004115 Ga0068857_10000411510 424
293 3300005616 Ga0068852_100043933 Ga0068852_1000439333 424
294 3300005834 Ga0068851_10003920 Ga0068851_100039202 424
295 3300006358 Ga0068871_100146038 Ga0068871_1001460381 424
296 3300009093 Ga0105240_10011457 Ga0105240_1001145710 424
297 3300009098 Ga0105245_10274077 Ga0105245_102740771 424
298 3300009174 Ga0105241_10169265 Ga0105241_101692652 424
299 3300009545 Ga0105237_10006095 Ga0105237_100060959 424
300 3300009545 Ga0105237_10065026 Ga0105237_100650262 424
301 3300009551 Ga0105238_10000679 Ga0105238_1000067931 424
302 3300009551 Ga0105238_10003664 Ga0105238_100036643 424
303 3300010375 Ga0105239_10010253 Ga0105239_100102533 424
304 3300013104 Ga0157370_10005882 Ga0157370_1000588211 424
305 3300013105 Ga0157369_10000744 Ga0157369_1000074432 424
306 3300013105 Ga0157369_10001683 Ga0157369_1000168310 424
307 3300013296 Ga0157374_10001080 Ga0157374_1000108016 424
308 3300013296 Ga0157374_10006463 Ga0157374_100064634 424
309 3300013306 Ga0163162_10054106 Ga0163162_100541062 424
310 3300013307 Ga0157372_10289128 Ga0157372_102891282 424
311 3300013308 Ga0157375_10028139 Ga0157375_100281392 424
312 3300014325 Ga0163163_10017185 Ga0163163_100171855 424
313 3300025321 Ga0207656_10011654 Ga0207656_100116544 424
314 3300025909 Ga0207705_10068427 Ga0207705_100684272 424
315 3300025912 Ga0207707_10019922 Ga0207707_100199221 424
316 3300025914 Ga0207671_10013147 Ga0207671_100131475 424
317 3300025919 Ga0207657_10000717 Ga0207657_1000071725 424
318 3300025921 Ga0207652_10002172 Ga0207652_100021728 424
319 3300025921 Ga0207652_10049979 Ga0207652_100499791 424
320 3300025924 Ga0207694_10007672 Ga0207694_100076726 424
321 3300025926 Ga0207659_10019474 Ga0207659_100194741 424
322 3300025927 Ga0207687_10185661 Ga0207687_101856611 424
323 3300025931 Ga0207644_10101394 Ga0207644_101013941 424
324 3300025932 Ga0207690_10062260 Ga0207690_100622602 424
325 3300025940 Ga0207691_10004830 Ga0207691_1000483011 424
326 3300025944 Ga0207661_10008495 Ga0207661_100084956 424
327 3300025949 Ga0207667_10005568 Ga0207667_100055686 424
328 3300025986 Ga0207658_10011282 Ga0207658_100112826 424
329 3300026116 Ga0207674_10004212 Ga0207674_1000421210 424
330 3300026121 Ga0207683_10036654 Ga0207683_100366542 424
331 3300028379 Ga0268266_10144786 Ga0268266_101447862 424
332 3300032002 Ga0307416_100014083 Ga0307416_1000140834 424
333 3300032126 Ga0307415_100037601 Ga0307415_1000376012 424
334 3300034818 Ga0373950_0000029 Ga0373950_0000029_75588_76907 424
335 3300037471 Ga0395905_0059275 Ga0395905_0059275_2027_3328 424
336 3300039062 Ga0400483_183966 Ga0400483_183966_24565_25863 424
337 3300048917 Ga0496114_0001640 Ga0496114_0001640_8226_9509 424
338 3300048928 Ga0496125_0022711 Ga0496125_0022711_1776_3095 424
339 3300049568 Ga0501031_0032414 Ga0501031_0032414_753_2066 424
340 3300049569 Ga0501032_0036179 Ga0501032_0036179_1474_2787 424
341 3300049570 Ga0501033_0069970 Ga0501033_0069970_331_1644 424
342 3300049574 Ga0501038_0004862 Ga0501038_0004862_7632_8945 424
343 3300049576 Ga0501040_0007699 Ga0501040_0007699_3805_5118 424
344 3300049577 Ga0501041_0000920 Ga0501041_0000920_13978_15291 424
345 3300049578 Ga0501042_0001626 Ga0501042_0001626_798_2111 424
346 3300049580 Ga0501046_0004429 Ga0501046_0004429_527_1840 424
347 3300049582 Ga0501048_0003386 Ga0501048_0003386_1628_2941 424
348 3300049583 Ga0501067_0000296 Ga0501067_0000296_14069_15388 424
349 3300049583 Ga0501067_0041189 Ga0501067_0041189_710_2095 424
350 3300049586 Ga0501070_0102977 Ga0501070_0102977_793_2106 424
351 3300049588 Ga0501072_0000756 Ga0501072_0000756_8850_10163 424
352 3300049589 Ga0501073_0012269 Ga0501073_0012269_4757_6076 424
353 3300049591 Ga0501075_0000100 Ga0501075_0000100_3721_5034 424
354 3300049592 Ga0501076_0000403 Ga0501076_0000403_25373_26686 424
355 3300049593 Ga0501077_0001718 Ga0501077_0001718_1293_2606 424
356 3300049741 Ga0501079_0016489 Ga0501079_0016489_291_1604 424
357 3300049743 Ga0501081_0010245 Ga0501081_0010245_4268_5581 424
358 3300049824 Ga0501045_0000694 Ga0501045_0000694_10826_12139 424
359 3300053098 Ga0500650_0061349 Ga0500650_0061349_282_1625 424
360 3300054114 Ga0501084_0000458 Ga0501084_0000458_4310_5623 424
361 3300060353 Ga0501082_0023609 Ga0501082_0023609_692_2005 424
362 3300061734 Ga0530510_0000157 Ga0530510_0000157_2113_3426 424
363 iso_pu_bacteria 2881101125 2881105235 424
364 iso_pu_bacteria 2913844669 2913850644 424
365 3300003323 rootH1_10339880 rootH1_103398806 425
366 3300005293 Ga0065715_10000174 Ga0065715_1000017412 425
367 3300005331 Ga0070670_100081499 Ga0070670_1000814992 425
368 3300005347 Ga0070668_100012740 Ga0070668_1000127404 425
369 3300005347 Ga0070668_100105242 Ga0070668_1001052422 425
370 3300005353 Ga0070669_100009145 Ga0070669_1000091455 425
371 3300005354 Ga0070675_100010451 Ga0070675_1000104514 425
372 3300005354 Ga0070675_100069664 Ga0070675_1000696642 425
373 3300005356 Ga0070674_100013879 Ga0070674_1000138795 425
374 3300005364 Ga0070673_100240045 Ga0070673_1002400451 425
375 3300005441 Ga0070700_100043732 Ga0070700_1000437321 425
376 3300005458 Ga0070681_10001710 Ga0070681_100017107 425
377 3300005466 Ga0070685_10006771 Ga0070685_100067712 425
378 3300005543 Ga0070672_100010203 Ga0070672_1000102034 425
379 3300005564 Ga0070664_100056686 Ga0070664_1000566863 425
380 3300005617 Ga0068859_100085637 Ga0068859_1000856372 425
381 3300005617 Ga0068859_100118403 Ga0068859_1001184032 425
382 3300005842 Ga0068858_100031212 Ga0068858_1000312124 425
383 3300005842 Ga0068858_100252829 Ga0068858_1002528292 425
384 3300006048 Ga0075363_100008827 Ga0075363_1000088274 425
385 3300006051 Ga0075364_10017736 Ga0075364_100177363 425
386 3300006178 Ga0075367_10052715 Ga0075367_100527152 425
387 3300006195 Ga0075366_10012587 Ga0075366_100125874 425
388 3300006844 Ga0075428_100261096 Ga0075428_1002610962 425
389 3300006846 Ga0075430_100063657 Ga0075430_1000636573 425
390 3300006847 Ga0075431_100048503 Ga0075431_1000485033 425
391 3300006852 Ga0075433_10014086 Ga0075433_100140866 425
392 3300006871 Ga0075434_100001803 Ga0075434_10000180311 425
393 3300006880 Ga0075429_100099768 Ga0075429_1000997683 425
394 3300006931 Ga0097620_100085625 Ga0097620_1000856252 425
395 3300006931 Ga0097620_100118394 Ga0097620_1001183942 425
396 3300007076 Ga0075435_100013993 Ga0075435_1000139932 425
397 3300009093 Ga0105240_10031302 Ga0105240_100313027 425
398 3300009094 Ga0111539_10106140 Ga0111539_101061402 425
399 3300009101 Ga0105247_10001875 Ga0105247_100018754 425
400 3300009176 Ga0105242_10032645 Ga0105242_100326452 425
401 3300009176 Ga0105242_10182824 Ga0105242_101828242 425
402 3300009177 Ga0105248_10007736 Ga0105248_100077364 425
403 3300009545 Ga0105237_10037862 Ga0105237_100378623 425
404 3300011119 Ga0105246_10046978 Ga0105246_100469782 425
405 3300013296 Ga0157374_10013896 Ga0157374_100138964 425
406 3300013296 Ga0157374_10033354 Ga0157374_100333545 425
407 3300013296 Ga0157374_10104578 Ga0157374_101045782 425
408 3300013297 Ga0157378_10020306 Ga0157378_100203065 425
409 3300013297 Ga0157378_10172811 Ga0157378_101728113 425
410 3300013306 Ga0163162_10007245 Ga0163162_1000724510 425
411 3300013308 Ga0157375_10051322 Ga0157375_100513224 425
412 3300014326 Ga0157380_10083037 Ga0157380_100830372 425
413 3300014969 Ga0157376_10128871 Ga0157376_101288712 425
414 3300025304 Ga0209257_1018208 Ga0209257_10182082 425
415 3300025315 Ga0207697_10004290 Ga0207697_100042904 425
416 3300025907 Ga0207645_10005993 Ga0207645_100059935 425
417 3300025921 Ga0207652_10013614 Ga0207652_100136142 425
418 3300025924 Ga0207694_10077483 Ga0207694_100774831 425
419 3300025926 Ga0207659_10115396 Ga0207659_101153962 425
420 3300025931 Ga0207644_10061184 Ga0207644_100611842 425
421 3300025933 Ga0207706_10016300 Ga0207706_100163004 425
422 3300025933 Ga0207706_10099830 Ga0207706_100998302 425
423 3300025934 Ga0207686_10084288 Ga0207686_100842882 425
424 3300025937 Ga0207669_10010949 Ga0207669_100109492 425
425 3300025940 Ga0207691_10010462 Ga0207691_100104625 425
426 3300025940 Ga0207691_10188881 Ga0207691_101888812 425
427 3300025945 Ga0207679_10078358 Ga0207679_100783582 425
428 3300026067 Ga0207678_10006667 Ga0207678_100066675 425
429 3300026075 Ga0207708_10042773 Ga0207708_100427733 425
430 3300026089 Ga0207648_10006007 Ga0207648_100060075 425
431 3300027907 Ga0207428_10007392 Ga0207428_1000739211 425
432 3300028379 Ga0268266_10156316 Ga0268266_101563162 425
433 3300028653 Ga0265323_10000045 Ga0265323_1000004515 425
434 3300028654 Ga0265322_10013015 Ga0265322_100130152 425
435 3300031712 Ga0265342_10118887 Ga0265342_101188871 425
436 3300036401 Ga0373937_0002956 Ga0373937_0002956_8321_9646 425
437 3300037471 Ga0395905_0000042 Ga0395905_0000042_93909_95234 425
438 3300037471 Ga0395905_0094162 Ga0395905_0094162_46_1371 425
439 3300046492 Ga0495585_0092069 Ga0495585_0092069_38_1399 425
440 3300046522 Ga0495643_0002144 Ga0495643_0002144_9964_11286 425
441 3300046616 Ga0495668_0018990 Ga0495668_0018990_431_1792 425
442 3300047469 Ga0495673_0031878 Ga0495673_0031878_708_2069 425
443 3300048904 Ga0496101_0032367 Ga0496101_0032367_1336_2652 425
444 3300048907 Ga0496104_0060490 Ga0496104_0060490_570_1886 425
445 3300048912 Ga0496109_0003247 Ga0496109_0003247_8395_9711 425
446 3300048913 Ga0496110_0022515 Ga0496110_0022515_3794_5110 425
447 3300048915 Ga0496112_0004187 Ga0496112_0004187_8225_9541 425
448 3300048917 Ga0496114_0137114 Ga0496114_0137114_631_1947 425
449 3300048924 Ga0496121_0065494 Ga0496121_0065494_899_2260 425
450 3300050492 nmdc:mga0yw44_14355_c1 nmdc:mga0yw44_14355_c1_997_2358 425
451 3300050493 nmdc:mga0k408_9804_c1 nmdc:mga0k408_9804_c1_862_2223 425
452 3300050510 nmdc:mga06r32_63744_c1 nmdc:mga06r32_63744_c1_469_1782 425
453 3300050510 nmdc:mga06r32_95524_c1 nmdc:mga06r32_95524_c1_639_1943 425
454 3300050512 nmdc:mga0n895_6754_c1 nmdc:mga0n895_6754_c1_1580_2902 425
455 3300050512 nmdc:mga0n895_81129_c1 nmdc:mga0n895_81129_c1_1062_2375 425
456 3300050513 nmdc:mga0rr50_95112_c1 nmdc:mga0rr50_95112_c1_108_1430 425
457 3300050515 nmdc:mga0a205_193064_c1 nmdc:mga0a205_193064_c1_539_1861 425
458 iso_pu_bacteria 2824617872 2824621793 425
459 iso_pu_bacteria 2824626560 2824631074 425
460 iso_pu_bacteria 2824635225 2824637364 425
461 iso_pu_bacteria 2824644064 2824645664 425
462 iso_pu_bacteria 2824714736 2824716619 425
463 iso_pu_bacteria 2824723954 2824725743 425
464 iso_pu_bacteria 2906626472 2906629462 425
465 iso_pu_bacteria 2932801729 2932807388 425
466 iso_pu_bacteria 2932818245 2932824591 425
467 iso_pu_bacteria 2935883170 2935884405 425
468 iso_pu_bacteria 3005587118 3005591258 425
469 3300003322 rootL2_10023383 rootL2_100233833 426
470 3300005295 Ga0065707_10113639 Ga0065707_101136392 426
471 3300005331 Ga0070670_100012584 Ga0070670_1000125843 426
472 3300005354 Ga0070675_100019620 Ga0070675_1000196203 426
473 3300005458 Ga0070681_10047867 Ga0070681_100478673 426
474 3300005471 Ga0070698_100030202 Ga0070698_1000302023 426
475 3300005518 Ga0070699_100042906 Ga0070699_1000429063 426
476 3300005535 Ga0070684_100029313 Ga0070684_1000293132 426
477 3300005535 Ga0070684_100100769 Ga0070684_1001007693 426
478 3300005563 Ga0068855_100075189 Ga0068855_1000751893 426
479 3300005564 Ga0070664_100112941 Ga0070664_1001129411 426
480 3300005719 Ga0068861_100191462 Ga0068861_1001914622 426
481 3300005842 Ga0068858_100060263 Ga0068858_1000602633 426
482 3300005981 Ga0081538_10000244 Ga0081538_1000024440 426
483 3300006844 Ga0075428_100303402 Ga0075428_1003034022 426
484 3300006846 Ga0075430_100046779 Ga0075430_1000467793 426
485 3300006847 Ga0075431_100237148 Ga0075431_1002371482 426
486 3300009147 Ga0114129_10014221 Ga0114129_100142217 426
487 3300009147 Ga0114129_10020657 Ga0114129_100206575 426
488 3300025926 Ga0207659_10061024 Ga0207659_100610242 426
489 3300025945 Ga0207679_10068786 Ga0207679_100687862 426
490 3300025949 Ga0207667_10156179 Ga0207667_101561792 426
491 3300026088 Ga0207641_10044169 Ga0207641_100441693 426
492 3300026116 Ga0207674_10007348 Ga0207674_100073486 426
493 3300032002 Ga0307416_100006262 Ga0307416_1000062625 426
494 3300032126 Ga0307415_100000108 Ga0307415_10000010823 426
495 3300032126 Ga0307415_100067191 Ga0307415_1000671912 426
496 3300045051 Ga0451576_0029194 Ga0451576_0029194_2603_3934 426
497 3300046472 Ga0495580_0000530 Ga0495580_0000530_7365_8681 426
498 3300046531 Ga0495665_0005197 Ga0495665_0005197_2862_4178 426
499 3300048908 Ga0496105_0183002 Ga0496105_0183002_60_1376 426
500 3300048911 Ga0496108_0028909 Ga0496108_0028909_2541_3857 426
501 3300048912 Ga0496109_0079484 Ga0496109_0079484_1285_2601 426
502 3300048913 Ga0496110_0016329 Ga0496110_0016329_3862_5178 426
503 3300048914 Ga0496111_0090603 Ga0496111_0090603_41_1357 426
504 3300048916 Ga0496113_0042020 Ga0496113_0042020_1323_2639 426
505 3300048917 Ga0496114_0055147 Ga0496114_0055147_1000_2316 426
506 3300049591 Ga0501075_0022828 Ga0501075_0022828_1726_3081 426
507 3300049592 Ga0501076_0080398 Ga0501076_0080398_497_1852 426
508 3300050507 nmdc:mga05p37_10461_c1 nmdc:mga05p37_10461_c1_5317_6675 426
509 3300050507 nmdc:mga05p37_230965_c1 nmdc:mga05p37_230965_c1_113_1504 426
510 3300050507 nmdc:mga05p37_42024_c1 nmdc:mga05p37_42024_c1_3120_4451 426
511 3300050509 nmdc:mga0qj67_182981_c1 nmdc:mga0qj67_182981_c1_189_1481 426
512 3300053087 Ga0500643_000058 Ga0500643_000058_112277_113671 426
513 3300053103 Ga0500555_005142 Ga0500555_005142_1657_3051 426
514 3300053134 Ga0500658_0039762 Ga0500658_0039762_291_1685 426
515 3300053156 Ga0500622_0002128 Ga0500622_0002128_3190_4584 426
516 3300053158 Ga0500627_0012132 Ga0500627_0012132_1546_2940 426
517 iso_pu_bacteria 2857509624 2857512565 426
518 3300005337 Ga0070682_100005312 Ga0070682_1000053127 427
519 3300005339 Ga0070660_100133021 Ga0070660_1001330212 427
520 3300005340 Ga0070689_100240204 Ga0070689_1002402041 427
521 3300005458 Ga0070681_10056799 Ga0070681_100567993 427
522 3300005459 Ga0068867_100043028 Ga0068867_1000430283 427
523 3300005466 Ga0070685_10132508 Ga0070685_101325081 427
524 3300005468 Ga0070707_100000358 Ga0070707_10000035838 427
525 3300005471 Ga0070698_100029949 Ga0070698_1000299492 427
526 3300005518 Ga0070699_100020246 Ga0070699_1000202464 427
527 3300005842 Ga0068858_100000162 Ga0068858_10000016223 427
528 3300005842 Ga0068858_100051726 Ga0068858_1000517263 427
529 3300005937 Ga0081455_10007276 Ga0081455_100072765 427
530 3300005981 Ga0081538_10000046 Ga0081538_1000004664 427
531 3300005981 Ga0081538_10000783 Ga0081538_100007834 427
532 3300005981 Ga0081538_10058253 Ga0081538_100582532 427
533 3300006028 Ga0070717_10035209 Ga0070717_100352093 427
534 3300006844 Ga0075428_100092687 Ga0075428_1000926874 427
535 3300006847 Ga0075431_100185344 Ga0075431_1001853442 427
536 3300009094 Ga0111539_10061346 Ga0111539_100613463 427
537 3300009094 Ga0111539_10173933 Ga0111539_101739332 427
538 3300009101 Ga0105247_10000913 Ga0105247_1000091317 427
539 3300013105 Ga0157369_10110065 Ga0157369_101100653 427
540 3300014968 Ga0157379_10000355 Ga0157379_1000035522 427
541 3300025900 Ga0207710_10000019 Ga0207710_10000019237 427
542 3300025910 Ga0207684_10035364 Ga0207684_100353643 427
543 3300025915 Ga0207693_10155172 Ga0207693_101551722 427
544 3300025917 Ga0207660_10079089 Ga0207660_100790892 427
545 3300025921 Ga0207652_10236203 Ga0207652_102362032 427
546 3300025922 Ga0207646_10000008 Ga0207646_10000008445 427
547 3300025922 Ga0207646_10000009 Ga0207646_1000000911 427
548 3300026035 Ga0207703_10000013 Ga0207703_1000001391 427
549 3300026035 Ga0207703_10053619 Ga0207703_100536191 427
550 3300026075 Ga0207708_10136537 Ga0207708_101365372 427
551 3300026075 Ga0207708_10215919 Ga0207708_102159192 427
552 3300027907 Ga0207428_10090799 Ga0207428_100907991 427
553 3300028794 Ga0307515_10103951 Ga0307515_101039512 427
554 3300031824 Ga0307413_10011378 Ga0307413_100113782 427
555 3300031852 Ga0307410_10130263 Ga0307410_101302632 427
556 3300048922 Ga0496119_0010914 Ga0496119_0010914_4325_5794 427
557 3300048924 Ga0496121_0017549 Ga0496121_0017549_3948_5432 427
558 3300049572 Ga0501036_0267128 Ga0501036_0267128_60_1388 427
559 3300049582 Ga0501048_0071418 Ga0501048_0071418_685_2145 427
560 3300049592 Ga0501076_0087304 Ga0501076_0087304_893_2353 427
561 3300050507 nmdc:mga05p37_169265_c1 nmdc:mga05p37_169265_c1_973_2322 427
562 3300050507 nmdc:mga05p37_17692_c1 nmdc:mga05p37_17692_c1_3834_5147 427
563 3300050511 nmdc:mga08y16_19042_c1 nmdc:mga08y16_19042_c1_5788_7086 427
564 3300050514 nmdc:mga08x19_20866_c1 nmdc:mga08x19_20866_c1_2167_3525 427
565 3300050515 nmdc:mga0a205_12454_c1 nmdc:mga0a205_12454_c1_986_2335 427
566 3300061734 Ga0530510_0032471 Ga0530510_0032471_2059_3369 427
567 3300005981 Ga0081538_10019105 Ga0081538_100191054 428
568 3300006844 Ga0075428_100052918 Ga0075428_1000529183 428
569 3300006846 Ga0075430_100014302 Ga0075430_1000143028 428
570 3300006880 Ga0075429_100049463 Ga0075429_1000494632 428
571 3300009147 Ga0114129_10057331 Ga0114129_100573314 428
572 3300009553 Ga0105249_10008095 Ga0105249_100080958 428
573 3300031548 Ga0307408_100049663 Ga0307408_1000496633 428
574 3300049743 Ga0501081_0091392 Ga0501081_0091392_295_1608 428
575 3300050510 nmdc:mga06r32_117087_c1 nmdc:mga06r32_117087_c1_1066_2379 428
576 3300009094 Ga0111539_10545837 Ga0111539_105458371 429
577 3300009147 Ga0114129_10019473 Ga0114129_1001947314 429
578 3300050507 nmdc:mga05p37_11280_c1 nmdc:mga05p37_11280_c1_7784_9073 429
579 3300050515 nmdc:mga0a205_6351_c1 nmdc:mga0a205_6351_c1_7744_9033 429
580 3300003203 JGI25406J46586_10011688 JGI25406J46586_100116883 430
581 3300005985 Ga0081539_10003969 Ga0081539_100039696 430
582 3300005985 Ga0081539_10054751 Ga0081539_100547512 430
583 3300031731 Ga0307405_10011066 Ga0307405_100110665 430
584 3300031852 Ga0307410_10070226 Ga0307410_100702262 430
585 3300031903 Ga0307407_10002306 Ga0307407_100023061 430
586 3300031995 Ga0307409_100000840 Ga0307409_1000008406 430
587 3300032002 Ga0307416_100007369 Ga0307416_1000073692 430
588 3300032004 Ga0307414_10067788 Ga0307414_100677883 430
589 3300032126 Ga0307415_100007195 Ga0307415_1000071956 430
590 3300049568 Ga0501031_0002603 Ga0501031_0002603_3619_4911 430
591 3300049570 Ga0501033_0005927 Ga0501033_0005927_577_1869 430
592 3300049572 Ga0501036_0006465 Ga0501036_0006465_4335_5627 430
593 3300049573 Ga0501037_0009848 Ga0501037_0009848_800_2092 430
594 3300049574 Ga0501038_0013425 Ga0501038_0013425_1707_2999 430
595 3300049575 Ga0501039_0000676 Ga0501039_0000676_15006_16298 430
596 3300049576 Ga0501040_0001477 Ga0501040_0001477_4405_5697 430
597 3300049577 Ga0501041_0000229 Ga0501041_0000229_7900_9192 430
598 3300049578 Ga0501042_0000814 Ga0501042_0000814_7748_9040 430
599 3300049579 Ga0501043_0014454 Ga0501043_0014454_4372_5664 430
600 3300049580 Ga0501046_0000525 Ga0501046_0000525_11378_12670 430
601 3300049582 Ga0501048_0002770 Ga0501048_0002770_4336_5628 430
602 3300049587 Ga0501071_0001060 Ga0501071_0001060_2962_4254 430
603 3300049590 Ga0501074_0004833 Ga0501074_0004833_4445_5737 430
604 3300049591 Ga0501075_0002038 Ga0501075_0002038_5779_7071 430
605 3300049592 Ga0501076_0008372 Ga0501076_0008372_4414_5706 430
606 3300049741 Ga0501079_0002470 Ga0501079_0002470_4348_5640 430
607 3300049743 Ga0501081_0001722 Ga0501081_0001722_7885_9177 430
608 3300049824 Ga0501045_0001055 Ga0501045_0001055_4449_5741 430
609 3300054114 Ga0501084_0006984 Ga0501084_0006984_3635_4927 430
610 3300060353 Ga0501082_0000751 Ga0501082_0000751_9617_10909 430
611 3300061734 Ga0530510_0003857 Ga0530510_0003857_6020_7312 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09940

DUF2172

Domain of unknown function (DUF2172)

114

205

0.99

PF16254

DUF4910

Domain of unknown function (DUF4910)

64

401

0.99

PF16221

HTH_47

winged helix-turn-helix

402

479

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k9t-assembly1.cif.gz_A crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution 0.9902 4 427
3k9t-assembly1.cif.gz_A crystal structure of putative peptidase (np_348812.1) from clostridium acetobutylicum at 2.37 a resolution 0.953 4 427
6esl-assembly1.cif.gz_A crystal structure of the legionella pneumoppila lapa 0.8223 157 346
6ica-assembly1.cif.gz_A the crystal structure of legionella pneumophila lapa aminopeptidase 0.8079 158 346
6esl-assembly1.cif.gz_B crystal structure of the legionella pneumoppila lapa 0.799 157 346
ID Description Score Start End Superfamily
3k9tA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Domain of unknown function DUF2172 0.9894 58 154 3.50.30.90
3k9tA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9847 4 348 3.40.630.10
3k9tA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Domain of unknown function DUF2172 0.9792 58 154 3.50.30.90
3k9tA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9268 4 348 3.40.630.10
3k9tA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9249 349 427 1.10.10.10
ID Description Score Start End GO Terms
AF-X1J0W6-F1-model_v4 Uncharacterized protein 0.9952 3 151
AF-A0A435XR97-F1-model_v4 DUF4910 domain-containing protein 0.9951 45 241
AF-W4LVE2-F1-model_v4 Peptidase M28 0.994 3 316
AF-W4MG49-F1-model_v4 Peptidase M28 0.994 3 269
AF-A0A519CZQ2-F1-model_v4 Peptidase M28 0.9936 3 346

Feature Viewer

pLDDT pTM Quality
95.26 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map