F469041

General Info

Members Datasets Scaffolds Average Seq Length
611 282 1222 158

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100000125|Ga0070668_10000012519
Length 157
Sequence MDWAGWALFGLLATAVLTAVLIGAQMAGLTRLDLPLVLGTVVTADPDRARVAGFFLHVAAGQVFALGYAATFALLGASWWLGGLLGALHVAVTLTVVLPLLPGVHPRMASHRAGPASTAVLEPPGLFALNYGVQTPAVAVVAHVIYGVVLGLLLQAR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
190 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
196 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
197 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
202 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
279 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
280 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
281 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
282 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.33
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.78
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100000125 3300005347 Bacteria 47483
2 JGI24740J21852_10112938 3300001979 Bacteria 684
3 JGI24751J29686_10007173 3300002459 Bacteria 2277
4 rootL2_10091805 3300003322 Bacteria 1807
5 JGI25407J50210_10000493 3300003373 Bacteria 7880
6 Ga0070658_10014756 3300005327 Bacteria 6264
7 Ga0070676_10227713 3300005328 Bacteria 1234
8 Ga0070676_10450252 3300005328 Bacteria 905
9 Ga0070683_100130291 3300005329 Bacteria 2380
10 Ga0070683_100349457 3300005329 Bacteria 1408
11 Ga0070683_101405319 3300005329 Bacteria 671
12 Ga0070683_101414327 3300005329 Bacteria 668
13 Ga0070690_100170558 3300005330 Bacteria 1497
14 Ga0070670_100005681 3300005331 Bacteria 10533
15 Ga0070670_100099743 3300005331 Bacteria 2499
16 Ga0070670_101020136 3300005331 Unclassified 753
17 Ga0068869_100002459 3300005334 Bacteria 11171
18 Ga0070680_100040400 3300005336 Bacteria 3777
19 Ga0070682_100000885 3300005337 Bacteria 17472
20 Ga0068868_100000610 3300005338 Bacteria 24011
21 Ga0070660_100219853 3300005339 Bacteria 1544
22 Ga0070660_101229048 3300005339 Bacteria 635
23 Ga0070689_100158003 3300005340 Bacteria 1831
24 Ga0070689_100193195 3300005340 Bacteria 1658
25 Ga0070691_10056952 3300005341 Bacteria 1875
26 Ga0070687_100333484 3300005343 Bacteria 973
27 Ga0070661_100262908 3300005344 Bacteria 1334
28 Ga0070661_100459875 3300005344 Bacteria 1013
29 Ga0070692_10006614 3300005345 Bacteria 5043
30 Ga0070692_10275601 3300005345 Bacteria 1017
31 Ga0070668_100117035 3300005347 Bacteria 2126
32 Ga0070669_100088014 3300005353 Bacteria 2324
33 Ga0070675_100001184 3300005354 Bacteria 18944
34 Ga0070675_100033244 3300005354 Bacteria 4180
35 Ga0070671_100000432 3300005355 Bacteria 29125
36 Ga0070671_100040776 3300005355 Bacteria 3857
37 Ga0070673_100375392 3300005364 Bacteria 1267
38 Ga0070688_100109167 3300005365 Bacteria 1837
39 Ga0070659_100008465 3300005366 Bacteria 7518
40 Ga0070659_100139073 3300005366 Bacteria 1976
41 Ga0070709_10014804 3300005434 Bacteria 4421
42 Ga0070714_100030732 3300005435 Bacteria 4474
43 Ga0070714_100064808 3300005435 Bacteria 3146
44 Ga0070713_100794086 3300005436 Bacteria 907
45 Ga0070710_10363356 3300005437 Unclassified 961
46 Ga0070701_10100969 3300005438 Bacteria 1598
47 Ga0070701_10556546 3300005438 Bacteria 753
48 Ga0070705_100131525 3300005440 Bacteria 1633
49 Ga0070700_100022532 3300005441 Bacteria 3674
50 Ga0070708_100769874 3300005445 Unclassified 905
51 Ga0070663_100000453 3300005455 Bacteria 21722
52 Ga0070663_100004852 3300005455 Bacteria 7933
53 Ga0070678_100060635 3300005456 Bacteria 2785
54 Ga0070662_100005693 3300005457 Bacteria 7973
55 Ga0070662_100110333 3300005457 Bacteria 2095
56 Ga0070681_10037339 3300005458 Bacteria 4875
57 Ga0070681_10493095 3300005458 Bacteria 1138
58 Ga0070706_100005700 3300005467 Bacteria 11843
59 Ga0070707_100051976 3300005468 Bacteria 3927
60 Ga0070699_100006855 3300005518 Bacteria 9914
61 Ga0070679_100008021 3300005530 Bacteria 9918
62 Ga0070679_100211607 3300005530 Bacteria 1903
63 Ga0070679_101203528 3300005530 Bacteria 703
64 Ga0070684_100088841 3300005535 Bacteria 2746
65 Ga0070684_100544015 3300005535 Bacteria 1077
66 Ga0070697_100001060 3300005536 Bacteria 20802
67 Ga0068853_100142878 3300005539 Bacteria 2149
68 Ga0070672_100037879 3300005543 Bacteria 3681
69 Ga0070672_100281124 3300005543 Bacteria 1407
70 Ga0070696_100004530 3300005546 Bacteria 9275
71 Ga0070693_100000289 3300005547 Bacteria 23569
72 Ga0070693_100278596 3300005547 Bacteria 1119
73 Ga0070665_100310655 3300005548 Bacteria 1580
74 Ga0070704_100625660 3300005549 Bacteria 948
75 Ga0068855_100340520 3300005563 Bacteria 1654
76 Ga0070664_100013212 3300005564 Bacteria 6723
77 Ga0068857_100252705 3300005577 Bacteria 1616
78 Ga0068857_100287149 3300005577 Bacteria 1514
79 Ga0068857_100453233 3300005577 Bacteria 1199
80 Ga0068854_100356651 3300005578 Bacteria 1198
81 Ga0068856_100213856 3300005614 Bacteria 1943
82 Ga0070702_100000839 3300005615 Bacteria 11831
83 Ga0070702_100121615 3300005615 Bacteria 1635
84 Ga0068852_100001426 3300005616 Bacteria 16123
85 Ga0068852_100017509 3300005616 Bacteria 5624
86 Ga0068859_100068133 3300005617 Bacteria 3594
87 Ga0068859_100650418 3300005617 Bacteria 1146
88 Ga0068864_100002859 3300005618 Bacteria 14265
89 Ga0068864_100043731 3300005618 Bacteria 3836
90 Ga0068861_100094378 3300005719 Bacteria 2367
91 Ga0068861_100363918 3300005719 Bacteria 1273
92 Ga0068861_101229630 3300005719 Bacteria 725
93 Ga0068870_10004009 3300005840 Bacteria 6287
94 Ga0068863_100000499 3300005841 Bacteria 39845
95 Ga0068858_100025273 3300005842 Bacteria 5527
96 Ga0068860_100040523 3300005843 Bacteria 4451
97 Ga0068860_100078882 3300005843 Bacteria 3131
98 Ga0068862_100019619 3300005844 Bacteria 5645
99 Ga0068862_100055209 3300005844 Bacteria 3402
100 Ga0081455_10004949 3300005937 Bacteria 14732
101 Ga0081455_10058865 3300005937 Bacteria 3248
102 Ga0081455_10101813 3300005937 Bacteria 2304
103 Ga0081538_10000567 3300005981 Bacteria 40928
104 Ga0081538_10001303 3300005981 Bacteria 25819
105 Ga0081538_10022550 3300005981 Bacteria 4560
106 Ga0081538_10026404 3300005981 Bacteria 4062
107 Ga0081538_10036602 3300005981 Bacteria 3199
108 Ga0081538_10082137 3300005981 Bacteria 1711
109 Ga0081538_10084991 3300005981 Bacteria 1665
110 Ga0081538_10142704 3300005981 Bacteria 1101
111 Ga0070717_10003965 3300006028 Bacteria 10651
112 Ga0070717_10211509 3300006028 Bacteria 1702
113 Ga0075432_10006184 3300006058 Bacteria 4073
114 Ga0075432_10018103 3300006058 Bacteria 2403
115 Ga0070712_100296699 3300006175 Bacteria 1307
116 Ga0075367_10443679 3300006178 Bacteria 822
117 Ga0068871_100203050 3300006358 Bacteria 1712
118 Ga0075428_100022491 3300006844 Bacteria 6981
119 Ga0075430_100107045 3300006846 Bacteria 2332
120 Ga0075430_101228423 3300006846 Bacteria 617
121 Ga0075431_100158958 3300006847 Bacteria 2324
122 Ga0075431_100173699 3300006847 Bacteria 2214
123 Ga0075433_10001376 3300006852 Bacteria 17868
124 Ga0075433_10829199 3300006852 Bacteria 808
125 Ga0075434_100018174 3300006871 Bacteria 6787
126 Ga0075434_100557450 3300006871 Bacteria 1165
127 Ga0075434_101124122 3300006871 Bacteria 799
128 Ga0075429_100328666 3300006880 Unclassified 1338
129 Ga0075429_100829484 3300006880 Bacteria 809
130 Ga0075436_100000739 3300006914 Bacteria 21667
131 Ga0097620_100068134 3300006931 Bacteria 3594
132 Ga0097620_100650309 3300006931 Bacteria 1146
133 Ga0075435_100004026 3300007076 Bacteria 10047
134 Ga0105251_10021122 3300009011 Bacteria 3405
135 Ga0105240_10748422 3300009093 Bacteria 1063
136 Ga0111539_10002818 3300009094 Bacteria 23102
137 Ga0111539_10157099 3300009094 Bacteria 2661
138 Ga0111539_10618061 3300009094 Bacteria 1262
139 Ga0105245_10005541 3300009098 Bacteria 11090
140 Ga0105247_10002123 3300009101 Bacteria 13710
141 Ga0114129_10211570 3300009147 Unclassified 2621
142 Ga0114129_10241703 3300009147 Bacteria 2427
143 Ga0114129_10257766 3300009147 Unclassified 2339
144 Ga0114129_10512684 3300009147 Bacteria 1565
145 Ga0114129_12530546 3300009147 Unclassified 613
146 Ga0105243_10523180 3300009148 Bacteria 1128
147 Ga0105241_10001124 3300009174 Bacteria 20351
148 Ga0105248_11117501 3300009177 Unclassified 891
149 Ga0105248_11202171 3300009177 Bacteria 857
150 Ga0105237_10356603 3300009545 Bacteria 1467
151 Ga0105237_10520686 3300009545 Bacteria 1196
152 Ga0105238_10100578 3300009551 Bacteria 2874
153 Ga0105249_10018152 3300009553 Bacteria 6254
154 Ga0105239_10035835 3300010375 Bacteria 5448
155 Ga0105246_10000789 3300011119 Bacteria 17983
156 Ga0157324_1005278 3300012506 Bacteria 929
157 Ga0157373_10093490 3300013100 Bacteria 2118
158 Ga0157371_10003394 3300013102 Bacteria 14470
159 Ga0157370_10008294 3300013104 Bacteria 11214
160 Ga0157369_10166053 3300013105 Bacteria 2328
161 Ga0157374_10003533 3300013296 Bacteria 13151
162 Ga0157378_10794136 3300013297 Bacteria 972
163 Ga0157378_11890311 3300013297 Bacteria 646
164 Ga0163162_10313115 3300013306 Bacteria 1702
165 Ga0163162_10539736 3300013306 Bacteria 1295
166 Ga0157372_10042207 3300013307 Bacteria 5044
167 Ga0157372_10885753 3300013307 Unclassified 1036
168 Ga0157372_11996323 3300013307 Bacteria 667
169 Ga0157372_12033978 3300013307 Bacteria 660
170 Ga0157375_10053381 3300013308 Bacteria 3977
171 Ga0157375_12603159 3300013308 Bacteria 604
172 Ga0163163_10885030 3300014325 Bacteria 956
173 Ga0163163_11456048 3300014325 Bacteria 746
174 Ga0182008_10521037 3300014497 Bacteria 656
175 Ga0157377_10045248 3300014745 Bacteria 2458
176 Ga0157377_10097109 3300014745 Bacteria 1749
177 Ga0157376_10580365 3300014969 Bacteria 1113
178 Ga0206354_10107579 3300020081 Bacteria 1694
179 Ga0206353_12024362 3300020082 Bacteria 1737
180 Ga0207656_10163835 3300025321 Bacteria 1059
181 Ga0207692_10450448 3300025898 Unclassified 810
182 Ga0207710_10111201 3300025900 Bacteria 1301
183 Ga0207688_10017391 3300025901 Bacteria 3906
184 Ga0207647_10119469 3300025904 Bacteria 1554
185 Ga0207647_10179625 3300025904 Bacteria 1230
186 Ga0207699_10022491 3300025906 Bacteria 3417
187 Ga0207645_10086360 3300025907 Bacteria 2016
188 Ga0207645_10420227 3300025907 Bacteria 901
189 Ga0207643_10000254 3300025908 Bacteria 37305
190 Ga0207643_10426764 3300025908 Unclassified 841
191 Ga0207705_10003667 3300025909 Bacteria 11688
192 Ga0207684_10066391 3300025910 Bacteria 3064
193 Ga0207707_10005812 3300025912 Bacteria 10780
194 Ga0207707_10859446 3300025912 Bacteria 752
195 Ga0207671_10099440 3300025914 Bacteria 2201
196 Ga0207671_10578847 3300025914 Bacteria 895
197 Ga0207693_10241462 3300025915 Bacteria 1418
198 Ga0207662_10113616 3300025918 Bacteria 1691
199 Ga0207657_10023633 3300025919 Bacteria 5718
200 Ga0207657_10155493 3300025919 Bacteria 1860
201 Ga0207649_10010978 3300025920 Bacteria 4982
202 Ga0207652_10008464 3300025921 Bacteria 8276
203 Ga0207652_10144416 3300025921 Bacteria 2129
204 Ga0207652_10305846 3300025921 Bacteria 1435
205 Ga0207646_10005230 3300025922 Bacteria 13697
206 Ga0207646_10005842 3300025922 Bacteria 12867
207 Ga0207681_10081359 3300025923 Bacteria 2287
208 Ga0207650_10002139 3300025925 Bacteria 13821
209 Ga0207659_10022109 3300025926 Bacteria 4231
210 Ga0207687_10006231 3300025927 Bacteria 7896
211 Ga0207700_10021174 3300025928 Bacteria 4433
212 Ga0207664_10383801 3300025929 Unclassified 1247
213 Ga0207664_10609351 3300025929 Bacteria 981
214 Ga0207644_10125671 3300025931 Bacteria 1957
215 Ga0207644_10154103 3300025931 Bacteria 1780
216 Ga0207690_10041436 3300025932 Bacteria 3018
217 Ga0207690_10186352 3300025932 Bacteria 1566
218 Ga0207706_10003950 3300025933 Bacteria 14048
219 Ga0207706_10139031 3300025933 Bacteria 2136
220 Ga0207706_10622240 3300025933 Unclassified 926
221 Ga0207670_10039204 3300025936 Bacteria 3101
222 Ga0207670_10179196 3300025936 Bacteria 1595
223 Ga0207711_10302040 3300025941 Bacteria 1476
224 Ga0207689_10026866 3300025942 Bacteria 4818
225 Ga0207661_10000413 3300025944 Bacteria 27612
226 Ga0207661_10062291 3300025944 Bacteria 3017
227 Ga0207661_10112656 3300025944 Bacteria 2303
228 Ga0207661_10537547 3300025944 Bacteria 1070
229 Ga0207679_10000294 3300025945 Bacteria 37716
230 Ga0207679_10931528 3300025945 Bacteria 795
231 Ga0207651_10140258 3300025960 Bacteria 1866
232 Ga0207712_10019296 3300025961 Bacteria 4451
233 Ga0207712_10127023 3300025961 Bacteria 1937
234 Ga0207668_10000623 3300025972 Bacteria 21971
235 Ga0207668_10101967 3300025972 Bacteria 2134
236 Ga0207668_10236084 3300025972 Bacteria 1477
237 Ga0207640_10185572 3300025981 Bacteria 1563
238 Ga0207677_10011334 3300026023 Bacteria 5078
239 Ga0207703_10083228 3300026035 Bacteria 2673
240 Ga0207639_10166140 3300026041 Bacteria 1864
241 Ga0207678_10000285 3300026067 Bacteria 45836
242 Ga0207678_10006744 3300026067 Bacteria 10182
243 Ga0207708_10408338 3300026075 Bacteria 1124
244 Ga0207702_10001074 3300026078 Bacteria 27985
245 Ga0207702_10174502 3300026078 Bacteria 1974
246 Ga0207648_10889141 3300026089 Bacteria 832
247 Ga0207676_10000381 3300026095 Bacteria 37806
248 Ga0207676_10151136 3300026095 Bacteria 2000
249 Ga0207674_10005811 3300026116 Bacteria 14636
250 Ga0207675_100016027 3300026118 Bacteria 6997
251 Ga0207675_100099309 3300026118 Bacteria 2742
252 Ga0207675_101204379 3300026118 Bacteria 778
253 Ga0207683_10002170 3300026121 Bacteria 17232
254 Ga0207698_10009380 3300026142 Bacteria 6238
255 Ga0207698_10114837 3300026142 Bacteria 2266
256 Ga0207428_10000764 3300027907 Bacteria 36651
257 Ga0207428_10615422 3300027907 Bacteria 782
258 Ga0268265_10053811 3300028380 Bacteria 3051
259 Ga0268265_11265461 3300028380 Bacteria 737
260 Ga0268264_10062128 3300028381 Bacteria 3136
261 Ga0268264_10299135 3300028381 Bacteria 1514
262 Ga0316181_1023579 3300030744 Bacteria 595
263 Ga0316181_1146878 3300030744 Unclassified 1141
264 Ga0316182_1087789 3300030745 Unclassified 680
265 Ga0307408_100056610 3300031548 Bacteria 2844
266 Ga0307408_100351774 3300031548 Bacteria 1250
267 Ga0307408_100561667 3300031548 Bacteria 1008
268 Ga0307405_10008636 3300031731 Bacteria 5177
269 Ga0307405_10013707 3300031731 Bacteria 4331
270 Ga0307405_10016804 3300031731 Bacteria 3999
271 Ga0307405_10049019 3300031731 Bacteria 2608
272 Ga0307405_10296976 3300031731 Unclassified 1223
273 Ga0307405_10305713 3300031731 Bacteria 1208
274 Ga0307405_10505154 3300031731 Bacteria 970
275 Ga0307405_10902569 3300031731 Bacteria 747
276 Ga0307405_11403069 3300031731 Unclassified 611
277 Ga0307413_10026564 3300031824 Bacteria 3193
278 Ga0307413_10053891 3300031824 Bacteria 2437
279 Ga0307413_10075123 3300031824 Bacteria 2144
280 Ga0307413_10075529 3300031824 Bacteria 2139
281 Ga0307413_10123778 3300031824 Bacteria 1756
282 Ga0307413_10226916 3300031824 Bacteria 1368
283 Ga0307410_10034245 3300031852 Bacteria 3287
284 Ga0307410_10066820 3300031852 Bacteria 2478
285 Ga0307410_10129403 3300031852 Bacteria 1852
286 Ga0307410_10157002 3300031852 Bacteria 1700
287 Ga0307410_10208013 3300031852 Bacteria 1498
288 Ga0307410_10211970 3300031852 Bacteria 1485
289 Ga0307410_10255551 3300031852 Bacteria 1364
290 Ga0307410_10374227 3300031852 Bacteria 1144
291 Ga0307410_10511630 3300031852 Bacteria 989
292 Ga0307410_10613677 3300031852 Bacteria 908
293 Ga0307410_10866162 3300031852 Bacteria 772
294 Ga0326468_10000195 3300031889 Bacteria 6219
295 Ga0307406_10047876 3300031901 Bacteria 2697
296 Ga0307406_10051872 3300031901 Bacteria 2606
297 Ga0307406_10151389 3300031901 Bacteria 1655
298 Ga0307406_10617271 3300031901 Bacteria 896
299 Ga0307406_10632406 3300031901 Unclassified 886
300 Ga0307407_10010514 3300031903 Bacteria 4370
301 Ga0307407_10036225 3300031903 Bacteria 2718
302 Ga0307407_10192492 3300031903 Bacteria 1361
303 Ga0307407_10228299 3300031903 Bacteria 1263
304 Ga0307407_10277948 3300031903 Bacteria 1158
305 Ga0307407_10547127 3300031903 Bacteria 855
306 Ga0307407_10773382 3300031903 Bacteria 728
307 Ga0307407_10803976 3300031903 Bacteria 715
308 Ga0307412_10027659 3300031911 Bacteria 3538
309 Ga0307412_10127038 3300031911 Bacteria 1846
310 Ga0307412_10153626 3300031911 Bacteria 1701
311 Ga0307412_10224597 3300031911 Bacteria 1442
312 Ga0307412_10372454 3300031911 Unclassified 1153
313 Ga0307412_10537095 3300031911 Bacteria 980
314 Ga0307412_10865066 3300031911 Bacteria 790
315 Ga0307412_10969660 3300031911 Bacteria 749
316 Ga0307412_11025505 3300031911 Bacteria 730
317 Ga0307409_100007136 3300031995 Bacteria 6655
318 Ga0307409_100007789 3300031995 Bacteria 6442
319 Ga0307409_100010798 3300031995 Bacteria 5708
320 Ga0307409_100037142 3300031995 Bacteria 3588
321 Ga0307409_100109632 3300031995 Bacteria 2311
322 Ga0307409_100110629 3300031995 Bacteria 2303
323 Ga0307409_100123884 3300031995 Bacteria 2194
324 Ga0307409_101837462 3300031995 Bacteria 635
325 Ga0307409_102030904 3300031995 Unclassified 604
326 Ga0307409_102499142 3300031995 Unclassified 545
327 Ga0307416_100022620 3300032002 Bacteria 4541
328 Ga0307416_100036042 3300032002 Bacteria 3788
329 Ga0307416_100037780 3300032002 Bacteria 3719
330 Ga0307416_100158471 3300032002 Bacteria 2088
331 Ga0307416_100186039 3300032002 Bacteria 1952
332 Ga0307416_100217958 3300032002 Bacteria 1827
333 Ga0307416_100323876 3300032002 Bacteria 1545
334 Ga0307416_100349395 3300032002 Bacteria 1496
335 Ga0307416_100422647 3300032002 Bacteria 1377
336 Ga0307416_100533267 3300032002 Unclassified 1244
337 Ga0307416_100560788 3300032002 Bacteria 1217
338 Ga0307416_101018433 3300032002 Bacteria 931
339 Ga0307416_102727592 3300032002 Bacteria 590
340 Ga0307414_10124519 3300032004 Bacteria 1989
341 Ga0307414_10278303 3300032004 Bacteria 1405
342 Ga0307414_10321908 3300032004 Bacteria 1316
343 Ga0307414_10442561 3300032004 Bacteria 1138
344 Ga0307414_11837076 3300032004 Bacteria 565
345 Ga0307411_10022642 3300032005 Bacteria 3704
346 Ga0307411_10077253 3300032005 Bacteria 2279
347 Ga0307411_10085719 3300032005 Bacteria 2183
348 Ga0307411_10111255 3300032005 Bacteria 1960
349 Ga0307411_10138282 3300032005 Bacteria 1792
350 Ga0307411_10410313 3300032005 Bacteria 1122
351 Ga0307411_10534482 3300032005 Bacteria 997
352 Ga0307411_10629211 3300032005 Bacteria 926
353 Ga0307411_10971799 3300032005 Bacteria 759
354 Ga0307415_100017430 3300032126 Bacteria 4306
355 Ga0307415_100017800 3300032126 Bacteria 4270
356 Ga0307415_100062052 3300032126 Bacteria 2590
357 Ga0307415_100159041 3300032126 Bacteria 1749
358 Ga0307415_100159631 3300032126 Bacteria 1746
359 Ga0307415_100191567 3300032126 Bacteria 1614
360 Ga0307415_100236209 3300032126 Bacteria 1475
361 Ga0307415_100256824 3300032126 Bacteria 1423
362 Ga0307415_100485817 3300032126 Bacteria 1076
363 Ga0307415_100780997 3300032126 Bacteria 870
364 Ga0373959_0093659 3300034820 Bacteria 707
365 Ga0395900_0021472 3300037418 Bacteria 6601
366 Ga0395900_0143751 3300037418 Bacteria 2441
367 Ga0395900_0186853 3300037418 Bacteria 2103
368 Ga0395900_0272943 3300037418 Bacteria 1685
369 Ga0395900_0664039 3300037418 Bacteria 978
370 Ga0395900_1478394 3300037418 Bacteria 592
371 Ga0395898_0028129 3300037466 Bacteria 5637
372 Ga0395898_0053997 3300037466 Bacteria 3922
373 Ga0395898_0135572 3300037466 Bacteria 2357
374 Ga0395898_0734113 3300037466 Unclassified 929
375 Ga0395898_1084747 3300037466 Bacteria 734
376 Ga0395905_0328996 3300037471 Unclassified 1418
377 Ga0395905_0560019 3300037471 Bacteria 1044
378 Ga0395901_0109340 3300038443 Bacteria 2902
379 Ga0395901_0218765 3300038443 Bacteria 1991
380 Ga0395901_0247666 3300038443 Bacteria 1857
381 Ga0395901_0382448 3300038443 Bacteria 1448
382 Ga0395901_0963538 3300038443 Bacteria 831
383 Ga0395901_1244830 3300038443 Bacteria 708
384 Ga0439436_0098490 3300041404 Bacteria 815
385 Ga0439461_0023685 3300041410 Bacteria 1237
386 Ga0439442_000102 3300042002 Bacteria 20955
387 Ga0439442_000918 3300042002 Bacteria 6020
388 Ga0439443_002468 3300042003 Bacteria 2216
389 Ga0439448_0001518 3300042005 Bacteria 6053
390 Ga0439448_0008248 3300042005 Bacteria 3044
391 Ga0439448_0027317 3300042005 Bacteria 1798
392 Ga0439448_0073956 3300042005 Bacteria 1137
393 Ga0439448_0370452 3300042005 Bacteria 511
394 Ga0439450_012109 3300042008 Bacteria 1705
395 Ga0439450_070302 3300042008 Bacteria 858
396 Ga0439451_023834 3300042009 Bacteria 1233
397 Ga0439454_002556 3300042011 Bacteria 1934
398 Ga0439455_0041827 3300042012 Bacteria 1176
399 Ga0439455_0065015 3300042012 Bacteria 972
400 Ga0439456_014675 3300042013 Bacteria 1634
401 Ga0439457_011670 3300042014 Bacteria 1993
402 Ga0439463_000761 3300042016 Bacteria 8922
403 Ga0439463_006763 3300042016 Bacteria 2836
404 Ga0439463_011425 3300042016 Bacteria 2181
405 Ga0439463_017723 3300042016 Bacteria 1768
406 Ga0450920_000836 3300042122 Bacteria 4987
407 Ga0450888_001370 3300042126 Bacteria 2326
408 Ga0450903_024053 3300042138 Bacteria 935
409 Ga0439458_0072794 3300042157 Bacteria 869
410 Ga0439444_0003400 3300042437 Bacteria 2248
411 Ga0439444_0005826 3300042437 Bacteria 1840
412 Ga0439464_0037808 3300042439 Unclassified 1370
413 Ga0450893_0024264 3300042532 Bacteria 1058
414 Ga0450901_012570 3300042533 Bacteria 885
415 Ga0439440_0022352 3300042993 Bacteria 1432
416 Ga0439440_0026105 3300042993 Bacteria 1349
417 Ga0495584_0089668 3300046491 Bacteria 1550
418 Ga0495616_0169848 3300046513 Unclassified 976
419 Ga0495644_0134096 3300046523 Bacteria 944
420 Ga0495642_0140661 3300046528 Bacteria 1042
421 Ga0495609_0134404 3300046538 Bacteria 1058
422 Ga0495656_0175394 3300046615 Bacteria 1050
423 Ga0495611_0470381 3300046648 Bacteria 572
424 Ga0495659_0450114 3300046664 Bacteria 560
425 Ga0495661_0135269 3300046665 Bacteria 1346
426 Ga0495661_0158758 3300046665 Bacteria 1216
427 Ga0495670_0038677 3300046691 Bacteria 2379
428 Ga0495670_0457133 3300046691 Bacteria 692
429 Ga0495589_0523117 3300046794 Bacteria 541
430 Ga0495636_0339060 3300047318 Bacteria 708
431 Ga0495685_147720 3300047447 Bacteria 764
432 Ga0495615_0004108 3300048090 Bacteria 2509
433 Ga0496100_0015129 3300048903 Bacteria 4501
434 Ga0496101_0086838 3300048904 Bacteria 2321
435 Ga0496101_0123830 3300048904 Bacteria 1957
436 Ga0496102_0049337 3300048905 Bacteria 3829
437 Ga0496102_0136530 3300048905 Bacteria 2298
438 Ga0496104_0081313 3300048907 Bacteria 3089
439 Ga0496105_0001429 3300048908 Bacteria 16800
440 Ga0496106_0006825 3300048909 Bacteria 8450
441 Ga0496107_0480234 3300048910 Bacteria 922
442 Ga0496107_0890806 3300048910 Bacteria 649
443 Ga0496108_0181163 3300048911 Bacteria 1824
444 Ga0496109_0034920 3300048912 Bacteria 4532
445 Ga0496110_0999933 3300048913 Bacteria 744
446 Ga0496110_1640034 3300048913 Bacteria 553
447 Ga0496111_0016188 3300048914 Bacteria 5136
448 Ga0496112_0188762 3300048915 Bacteria 2023
449 Ga0496113_0072118 3300048916 Bacteria 2627
450 Ga0501031_0006902 3300049568 Bacteria 7410
451 Ga0501031_0041999 3300049568 Bacteria 2985
452 Ga0501031_0106931 3300049568 Bacteria 1826
453 Ga0501032_0051400 3300049569 Bacteria 2779
454 Ga0501032_0074301 3300049569 Bacteria 2265
455 Ga0501032_0074857 3300049569 Bacteria 2256
456 Ga0501032_0183003 3300049569 Bacteria 1371
457 Ga0501032_0571524 3300049569 Bacteria 720
458 Ga0501034_0188125 3300049571 Bacteria 2027
459 Ga0501036_0017845 3300049572 Bacteria 5940
460 Ga0501036_0021341 3300049572 Bacteria 5443
461 Ga0501036_0033427 3300049572 Bacteria 4350
462 Ga0501036_0054861 3300049572 Bacteria 3376
463 Ga0501036_0147586 3300049572 Bacteria 1984
464 Ga0501036_0305392 3300049572 Unclassified 1331
465 Ga0501036_0628660 3300049572 Bacteria 890
466 Ga0501037_0029496 3300049573 Bacteria 4053
467 Ga0501037_0054069 3300049573 Bacteria 2937
468 Ga0501037_0086892 3300049573 Bacteria 2263
469 Ga0501037_0090283 3300049573 Bacteria 2216
470 Ga0501037_0129182 3300049573 Bacteria 1813
471 Ga0501037_0503608 3300049573 Bacteria 821
472 Ga0501038_0014303 3300049574 Bacteria 7231
473 Ga0501038_0034739 3300049574 Bacteria 4431
474 Ga0501038_0041327 3300049574 Bacteria 4021
475 Ga0501038_0109196 3300049574 Bacteria 2293
476 Ga0501038_0123520 3300049574 Bacteria 2132
477 Ga0501038_0197867 3300049574 Bacteria 1614
478 Ga0501039_0016092 3300049575 Bacteria 5728
479 Ga0501039_0063840 3300049575 Bacteria 2853
480 Ga0501039_0069965 3300049575 Bacteria 2726
481 Ga0501039_0075593 3300049575 Bacteria 2618
482 Ga0501040_0024534 3300049576 Bacteria 4047
483 Ga0501040_0025946 3300049576 Bacteria 3942
484 Ga0501040_0101663 3300049576 Bacteria 2005
485 Ga0501040_0213066 3300049576 Bacteria 1373
486 Ga0501040_0471817 3300049576 Unclassified 904
487 Ga0501040_1135104 3300049576 Bacteria 567
488 Ga0501041_0000385 3300049577 Bacteria 22161
489 Ga0501041_0009427 3300049577 Bacteria 5755
490 Ga0501041_0016784 3300049577 Bacteria 4357
491 Ga0501041_0112322 3300049577 Bacteria 1690
492 Ga0501042_0001515 3300049578 Bacteria 13741
493 Ga0501042_0019232 3300049578 Bacteria 4740
494 Ga0501042_0096767 3300049578 Bacteria 2121
495 Ga0501043_0031893 3300049579 Bacteria 4142
496 Ga0501043_0076458 3300049579 Bacteria 2630
497 Ga0501043_0143412 3300049579 Bacteria 1870
498 Ga0501043_0171773 3300049579 Bacteria 1691
499 Ga0501043_0272948 3300049579 Unclassified 1298
500 Ga0501043_0404954 3300049579 Bacteria 1030
501 Ga0501046_0016261 3300049580 Bacteria 6237
502 Ga0501046_0060878 3300049580 Bacteria 2953
503 Ga0501046_0093488 3300049580 Bacteria 2311
504 Ga0501046_0436441 3300049580 Unclassified 943
505 Ga0501047_0311817 3300049581 Unclassified 1414
506 Ga0501048_0013660 3300049582 Bacteria 6024
507 Ga0501048_0054968 3300049582 Bacteria 2827
508 Ga0501048_0118514 3300049582 Bacteria 1870
509 Ga0501068_0009632 3300049584 Bacteria 5409
510 Ga0501068_0083712 3300049584 Bacteria 1961
511 Ga0501068_0149191 3300049584 Bacteria 1469
512 Ga0501068_0204455 3300049584 Bacteria 1253
513 Ga0501068_0813495 3300049584 Bacteria 613
514 Ga0501069_0060412 3300049585 Bacteria 2116
515 Ga0501070_0290102 3300049586 Unclassified 1333
516 Ga0501070_0898173 3300049586 Unclassified 691
517 Ga0501071_0006914 3300049587 Bacteria 7401
518 Ga0501071_0009100 3300049587 Bacteria 6594
519 Ga0501071_0031833 3300049587 Bacteria 3742
520 Ga0501071_0136808 3300049587 Bacteria 1823
521 Ga0501071_0311599 3300049587 Unclassified 1194
522 Ga0501071_0487997 3300049587 Bacteria 944
523 Ga0501072_0004999 3300049588 Bacteria 10087
524 Ga0501072_0017138 3300049588 Bacteria 5566
525 Ga0501072_0208202 3300049588 Bacteria 1559
526 Ga0501072_0585497 3300049588 Unclassified 880
527 Ga0501073_0082927 3300049589 Bacteria 2231
528 Ga0501073_0313524 3300049589 Unclassified 1082
529 Ga0501073_0338817 3300049589 Bacteria 1038
530 Ga0501074_0001599 3300049590 Bacteria 15367
531 Ga0501074_0022717 3300049590 Bacteria 4560
532 Ga0501074_0050510 3300049590 Bacteria 3002
533 Ga0501074_0096130 3300049590 Bacteria 2121
534 Ga0501075_0002774 3300049591 Bacteria 11737
535 Ga0501075_0022484 3300049591 Bacteria 4606
536 Ga0501075_0236708 3300049591 Unclassified 1392
537 Ga0501076_0000282 3300049592 Bacteria 31669
538 Ga0501076_0022226 3300049592 Bacteria 4873
539 Ga0501076_0064885 3300049592 Bacteria 2911
540 Ga0501076_0067868 3300049592 Bacteria 2848
541 Ga0501076_0306348 3300049592 Bacteria 1302
542 Ga0501076_0456344 3300049592 Unclassified 1052
543 Ga0501076_0484690 3300049592 Bacteria 1019
544 Ga0501077_0006245 3300049593 Bacteria 7286
545 Ga0501077_0041903 3300049593 Bacteria 2913
546 Ga0501077_0210120 3300049593 Bacteria 1237
547 Ga0501077_0376758 3300049593 Bacteria 906
548 Ga0501214_077274 3300049659 Bacteria 554
549 Ga0501079_0012980 3300049741 Bacteria 6355
550 Ga0501079_0043332 3300049741 Bacteria 3473
551 Ga0501079_0102575 3300049741 Bacteria 2218
552 Ga0501079_0392864 3300049741 Bacteria 1088
553 Ga0501080_0024174 3300049742 Bacteria 5633
554 Ga0501080_0191120 3300049742 Bacteria 1881
555 Ga0501081_0004689 3300049743 Bacteria 8789
556 Ga0501081_0019470 3300049743 Bacteria 4519
557 Ga0501081_0023657 3300049743 Bacteria 4119
558 Ga0501081_0101622 3300049743 Bacteria 2033
559 Ga0501083_0034324 3300049744 Bacteria 3469
560 Ga0501083_0361144 3300049744 Bacteria 944
561 Ga0501035_0060799 3300049822 Bacteria 3363
562 Ga0501035_0089826 3300049822 Bacteria 2705
563 Ga0501035_0133097 3300049822 Bacteria 2166
564 Ga0501035_0417094 3300049822 Bacteria 1115
565 Ga0501035_0559425 3300049822 Unclassified 936
566 Ga0501044_0007289 3300049823 Bacteria 12153
567 Ga0501044_0240379 3300049823 Bacteria 1755
568 Ga0501044_0637445 3300049823 Bacteria 956
569 Ga0501045_0007477 3300049824 Bacteria 7586
570 Ga0501045_0014152 3300049824 Bacteria 5650
571 Ga0501045_0071792 3300049824 Bacteria 2548
572 Ga0501045_0615884 3300049824 Bacteria 803
573 nmdc:mga05p37_170337_c1 3300050507 Bacteria 2656
574 nmdc:mga05p37_589795_c1 3300050507 Bacteria 1257
575 nmdc:mga05p37_69786_c1 3300050507 Bacteria 4322
576 nmdc:mga09592_235740_c1 3300050508 Bacteria 1585
577 nmdc:mga0qj67_280447_c1 3300050509 Bacteria 1351
578 nmdc:mga0qj67_514232_c1 3300050509 Bacteria 962
579 nmdc:mga06r32_1701999_c1 3300050510 Bacteria 568
580 nmdc:mga06r32_229224_c1 3300050510 Bacteria 1846
581 nmdc:mga06r32_452344_c1 3300050510 Bacteria 1264
582 nmdc:mga08y16_10618_c1 3300050511 Bacteria 9663
583 nmdc:mga08y16_1250_c1 3300050511 Bacteria 25196
584 nmdc:mga08y16_6515_c1 3300050511 Bacteria 12244
585 nmdc:mga0n895_44834_c1 3300050512 Bacteria 4313
586 nmdc:mga0n895_665877_c1 3300050512 Bacteria 1039
587 nmdc:mga08x19_112816_c1 3300050514 Bacteria 1815
588 nmdc:mga0a205_14155_c1 3300050515 Bacteria 7443
589 nmdc:mga0a205_86957_c1 3300050515 Bacteria 1805
590 nmdc:mga0a205_87065_c1 3300050515 Bacteria 3018
591 Ga0501084_0031665 3300054114 Bacteria 4421
592 Ga0501084_0034270 3300054114 Bacteria 4245
593 Ga0501084_0090388 3300054114 Bacteria 2570
594 Ga0501084_0117183 3300054114 Bacteria 2239
595 Ga0501084_0295253 3300054114 Bacteria 1369
596 Ga0501084_0497837 3300054114 Bacteria 1030
597 Ga0590071_012838 3300059421 Bacteria 1963
598 Ga0590074_057323 3300059423 Bacteria 720
599 Ga0590075_002449 3300059424 Bacteria 4446
600 Ga0590077_005996 3300059426 Bacteria 2489
601 Ga0501082_0002729 3300060353 Bacteria 15428
602 Ga0501082_0080238 3300060353 Bacteria 2815
603 Ga0530510_0002402 3300061734 Bacteria 12891
604 Ga0530510_0025370 3300061734 Bacteria 4238
605 Ga0530510_0030100 3300061734 Bacteria 3897
606 Ga0530510_0092728 3300061734 Bacteria 2204
607 2808892924 2808606370 Bacteria 4942454
608 2945922406 2945920336 Bacteria 4501603
609 2945941841 2945941187 Bacteria 4682474
610 2953998570 2953998280 Bacteria 4812144
611 8054107390 8054107350 Bacteria 5022511
612 Ga0070668_100000125
613 JGI24740J21852_10112938
614 JGI24751J29686_10007173
615 rootL2_10091805
616 JGI25407J50210_10000493
617 Ga0070658_10014756
618 Ga0070676_10227713
619 Ga0070676_10450252
620 Ga0070683_100130291
621 Ga0070683_100349457
622 Ga0070683_101405319
623 Ga0070683_101414327
624 Ga0070690_100170558
625 Ga0070670_100005681
626 Ga0070670_100099743
627 Ga0070670_101020136
628 Ga0068869_100002459
629 Ga0070680_100040400
630 Ga0070682_100000885
631 Ga0068868_100000610
632 Ga0070660_100219853
633 Ga0070660_101229048
634 Ga0070689_100158003
635 Ga0070689_100193195
636 Ga0070691_10056952
637 Ga0070687_100333484
638 Ga0070661_100262908
639 Ga0070661_100459875
640 Ga0070692_10006614
641 Ga0070692_10275601
642 Ga0070668_100117035
643 Ga0070669_100088014
644 Ga0070675_100001184
645 Ga0070675_100033244
646 Ga0070671_100000432
647 Ga0070671_100040776
648 Ga0070673_100375392
649 Ga0070688_100109167
650 Ga0070659_100008465
651 Ga0070659_100139073
652 Ga0070709_10014804
653 Ga0070714_100030732
654 Ga0070714_100064808
655 Ga0070713_100794086
656 Ga0070710_10363356
657 Ga0070701_10100969
658 Ga0070701_10556546
659 Ga0070705_100131525
660 Ga0070700_100022532
661 Ga0070708_100769874
662 Ga0070663_100000453
663 Ga0070663_100004852
664 Ga0070678_100060635
665 Ga0070662_100005693
666 Ga0070662_100110333
667 Ga0070681_10037339
668 Ga0070681_10493095
669 Ga0070706_100005700
670 Ga0070707_100051976
671 Ga0070699_100006855
672 Ga0070679_100008021
673 Ga0070679_100211607
674 Ga0070679_101203528
675 Ga0070684_100088841
676 Ga0070684_100544015
677 Ga0070697_100001060
678 Ga0068853_100142878
679 Ga0070672_100037879
680 Ga0070672_100281124
681 Ga0070696_100004530
682 Ga0070693_100000289
683 Ga0070693_100278596
684 Ga0070665_100310655
685 Ga0070704_100625660
686 Ga0068855_100340520
687 Ga0070664_100013212
688 Ga0068857_100252705
689 Ga0068857_100287149
690 Ga0068857_100453233
691 Ga0068854_100356651
692 Ga0068856_100213856
693 Ga0070702_100000839
694 Ga0070702_100121615
695 Ga0068852_100001426
696 Ga0068852_100017509
697 Ga0068859_100068133
698 Ga0068859_100650418
699 Ga0068864_100002859
700 Ga0068864_100043731
701 Ga0068861_100094378
702 Ga0068861_100363918
703 Ga0068861_101229630
704 Ga0068870_10004009
705 Ga0068863_100000499
706 Ga0068858_100025273
707 Ga0068860_100040523
708 Ga0068860_100078882
709 Ga0068862_100019619
710 Ga0068862_100055209
711 Ga0081455_10004949
712 Ga0081455_10058865
713 Ga0081455_10101813
714 Ga0081538_10000567
715 Ga0081538_10001303
716 Ga0081538_10022550
717 Ga0081538_10026404
718 Ga0081538_10036602
719 Ga0081538_10082137
720 Ga0081538_10084991
721 Ga0081538_10142704
722 Ga0070717_10003965
723 Ga0070717_10211509
724 Ga0075432_10006184
725 Ga0075432_10018103
726 Ga0070712_100296699
727 Ga0075367_10443679
728 Ga0068871_100203050
729 Ga0075428_100022491
730 Ga0075430_100107045
731 Ga0075430_101228423
732 Ga0075431_100158958
733 Ga0075431_100173699
734 Ga0075433_10001376
735 Ga0075433_10829199
736 Ga0075434_100018174
737 Ga0075434_100557450
738 Ga0075434_101124122
739 Ga0075429_100328666
740 Ga0075429_100829484
741 Ga0075436_100000739
742 Ga0097620_100068134
743 Ga0097620_100650309
744 Ga0075435_100004026
745 Ga0105251_10021122
746 Ga0105240_10748422
747 Ga0111539_10002818
748 Ga0111539_10157099
749 Ga0111539_10618061
750 Ga0105245_10005541
751 Ga0105247_10002123
752 Ga0114129_10211570
753 Ga0114129_10241703
754 Ga0114129_10257766
755 Ga0114129_10512684
756 Ga0114129_12530546
757 Ga0105243_10523180
758 Ga0105241_10001124
759 Ga0105248_11117501
760 Ga0105248_11202171
761 Ga0105237_10356603
762 Ga0105237_10520686
763 Ga0105238_10100578
764 Ga0105249_10018152
765 Ga0105239_10035835
766 Ga0105246_10000789
767 Ga0157324_1005278
768 Ga0157373_10093490
769 Ga0157371_10003394
770 Ga0157370_10008294
771 Ga0157369_10166053
772 Ga0157374_10003533
773 Ga0157378_10794136
774 Ga0157378_11890311
775 Ga0163162_10313115
776 Ga0163162_10539736
777 Ga0157372_10042207
778 Ga0157372_10885753
779 Ga0157372_11996323
780 Ga0157372_12033978
781 Ga0157375_10053381
782 Ga0157375_12603159
783 Ga0163163_10885030
784 Ga0163163_11456048
785 Ga0182008_10521037
786 Ga0157377_10045248
787 Ga0157377_10097109
788 Ga0157376_10580365
789 Ga0206354_10107579
790 Ga0206353_12024362
791 Ga0207656_10163835
792 Ga0207692_10450448
793 Ga0207710_10111201
794 Ga0207688_10017391
795 Ga0207647_10119469
796 Ga0207647_10179625
797 Ga0207699_10022491
798 Ga0207645_10086360
799 Ga0207645_10420227
800 Ga0207643_10000254
801 Ga0207643_10426764
802 Ga0207705_10003667
803 Ga0207684_10066391
804 Ga0207707_10005812
805 Ga0207707_10859446
806 Ga0207671_10099440
807 Ga0207671_10578847
808 Ga0207693_10241462
809 Ga0207662_10113616
810 Ga0207657_10023633
811 Ga0207657_10155493
812 Ga0207649_10010978
813 Ga0207652_10008464
814 Ga0207652_10144416
815 Ga0207652_10305846
816 Ga0207646_10005230
817 Ga0207646_10005842
818 Ga0207681_10081359
819 Ga0207650_10002139
820 Ga0207659_10022109
821 Ga0207687_10006231
822 Ga0207700_10021174
823 Ga0207664_10383801
824 Ga0207664_10609351
825 Ga0207644_10125671
826 Ga0207644_10154103
827 Ga0207690_10041436
828 Ga0207690_10186352
829 Ga0207706_10003950
830 Ga0207706_10139031
831 Ga0207706_10622240
832 Ga0207670_10039204
833 Ga0207670_10179196
834 Ga0207711_10302040
835 Ga0207689_10026866
836 Ga0207661_10000413
837 Ga0207661_10062291
838 Ga0207661_10112656
839 Ga0207661_10537547
840 Ga0207679_10000294
841 Ga0207679_10931528
842 Ga0207651_10140258
843 Ga0207712_10019296
844 Ga0207712_10127023
845 Ga0207668_10000623
846 Ga0207668_10101967
847 Ga0207668_10236084
848 Ga0207640_10185572
849 Ga0207677_10011334
850 Ga0207703_10083228
851 Ga0207639_10166140
852 Ga0207678_10000285
853 Ga0207678_10006744
854 Ga0207708_10408338
855 Ga0207702_10001074
856 Ga0207702_10174502
857 Ga0207648_10889141
858 Ga0207676_10000381
859 Ga0207676_10151136
860 Ga0207674_10005811
861 Ga0207675_100016027
862 Ga0207675_100099309
863 Ga0207675_101204379
864 Ga0207683_10002170
865 Ga0207698_10009380
866 Ga0207698_10114837
867 Ga0207428_10000764
868 Ga0207428_10615422
869 Ga0268265_10053811
870 Ga0268265_11265461
871 Ga0268264_10062128
872 Ga0268264_10299135
873 Ga0316181_1023579
874 Ga0316181_1146878
875 Ga0316182_1087789
876 Ga0307408_100056610
877 Ga0307408_100351774
878 Ga0307408_100561667
879 Ga0307405_10008636
880 Ga0307405_10013707
881 Ga0307405_10016804
882 Ga0307405_10049019
883 Ga0307405_10296976
884 Ga0307405_10305713
885 Ga0307405_10505154
886 Ga0307405_10902569
887 Ga0307405_11403069
888 Ga0307413_10026564
889 Ga0307413_10053891
890 Ga0307413_10075123
891 Ga0307413_10075529
892 Ga0307413_10123778
893 Ga0307413_10226916
894 Ga0307410_10034245
895 Ga0307410_10066820
896 Ga0307410_10129403
897 Ga0307410_10157002
898 Ga0307410_10208013
899 Ga0307410_10211970
900 Ga0307410_10255551
901 Ga0307410_10374227
902 Ga0307410_10511630
903 Ga0307410_10613677
904 Ga0307410_10866162
905 Ga0326468_10000195
906 Ga0307406_10047876
907 Ga0307406_10051872
908 Ga0307406_10151389
909 Ga0307406_10617271
910 Ga0307406_10632406
911 Ga0307407_10010514
912 Ga0307407_10036225
913 Ga0307407_10192492
914 Ga0307407_10228299
915 Ga0307407_10277948
916 Ga0307407_10547127
917 Ga0307407_10773382
918 Ga0307407_10803976
919 Ga0307412_10027659
920 Ga0307412_10127038
921 Ga0307412_10153626
922 Ga0307412_10224597
923 Ga0307412_10372454
924 Ga0307412_10537095
925 Ga0307412_10865066
926 Ga0307412_10969660
927 Ga0307412_11025505
928 Ga0307409_100007136
929 Ga0307409_100007789
930 Ga0307409_100010798
931 Ga0307409_100037142
932 Ga0307409_100109632
933 Ga0307409_100110629
934 Ga0307409_100123884
935 Ga0307409_101837462
936 Ga0307409_102030904
937 Ga0307409_102499142
938 Ga0307416_100022620
939 Ga0307416_100036042
940 Ga0307416_100037780
941 Ga0307416_100158471
942 Ga0307416_100186039
943 Ga0307416_100217958
944 Ga0307416_100323876
945 Ga0307416_100349395
946 Ga0307416_100422647
947 Ga0307416_100533267
948 Ga0307416_100560788
949 Ga0307416_101018433
950 Ga0307416_102727592
951 Ga0307414_10124519
952 Ga0307414_10278303
953 Ga0307414_10321908
954 Ga0307414_10442561
955 Ga0307414_11837076
956 Ga0307411_10022642
957 Ga0307411_10077253
958 Ga0307411_10085719
959 Ga0307411_10111255
960 Ga0307411_10138282
961 Ga0307411_10410313
962 Ga0307411_10534482
963 Ga0307411_10629211
964 Ga0307411_10971799
965 Ga0307415_100017430
966 Ga0307415_100017800
967 Ga0307415_100062052
968 Ga0307415_100159041
969 Ga0307415_100159631
970 Ga0307415_100191567
971 Ga0307415_100236209
972 Ga0307415_100256824
973 Ga0307415_100485817
974 Ga0307415_100780997
975 Ga0373959_0093659
976 Ga0395900_0021472
977 Ga0395900_0143751
978 Ga0395900_0186853
979 Ga0395900_0272943
980 Ga0395900_0664039
981 Ga0395900_1478394
982 Ga0395898_0028129
983 Ga0395898_0053997
984 Ga0395898_0135572
985 Ga0395898_0734113
986 Ga0395898_1084747
987 Ga0395905_0328996
988 Ga0395905_0560019
989 Ga0395901_0109340
990 Ga0395901_0218765
991 Ga0395901_0247666
992 Ga0395901_0382448
993 Ga0395901_0963538
994 Ga0395901_1244830
995 Ga0439436_0098490
996 Ga0439461_0023685
997 Ga0439442_000102
998 Ga0439442_000918
999 Ga0439443_002468
1000 Ga0439448_0001518
1001 Ga0439448_0008248
1002 Ga0439448_0027317
1003 Ga0439448_0073956
1004 Ga0439448_0370452
1005 Ga0439450_012109
1006 Ga0439450_070302
1007 Ga0439451_023834
1008 Ga0439454_002556
1009 Ga0439455_0041827
1010 Ga0439455_0065015
1011 Ga0439456_014675
1012 Ga0439457_011670
1013 Ga0439463_000761
1014 Ga0439463_006763
1015 Ga0439463_011425
1016 Ga0439463_017723
1017 Ga0450920_000836
1018 Ga0450888_001370
1019 Ga0450903_024053
1020 Ga0439458_0072794
1021 Ga0439444_0003400
1022 Ga0439444_0005826
1023 Ga0439464_0037808
1024 Ga0450893_0024264
1025 Ga0450901_012570
1026 Ga0439440_0022352
1027 Ga0439440_0026105
1028 Ga0495584_0089668
1029 Ga0495616_0169848
1030 Ga0495644_0134096
1031 Ga0495642_0140661
1032 Ga0495609_0134404
1033 Ga0495656_0175394
1034 Ga0495611_0470381
1035 Ga0495659_0450114
1036 Ga0495661_0135269
1037 Ga0495661_0158758
1038 Ga0495670_0038677
1039 Ga0495670_0457133
1040 Ga0495589_0523117
1041 Ga0495636_0339060
1042 Ga0495685_147720
1043 Ga0495615_0004108
1044 Ga0496100_0015129
1045 Ga0496101_0086838
1046 Ga0496101_0123830
1047 Ga0496102_0049337
1048 Ga0496102_0136530
1049 Ga0496104_0081313
1050 Ga0496105_0001429
1051 Ga0496106_0006825
1052 Ga0496107_0480234
1053 Ga0496107_0890806
1054 Ga0496108_0181163
1055 Ga0496109_0034920
1056 Ga0496110_0999933
1057 Ga0496110_1640034
1058 Ga0496111_0016188
1059 Ga0496112_0188762
1060 Ga0496113_0072118
1061 Ga0501031_0006902
1062 Ga0501031_0041999
1063 Ga0501031_0106931
1064 Ga0501032_0051400
1065 Ga0501032_0074301
1066 Ga0501032_0074857
1067 Ga0501032_0183003
1068 Ga0501032_0571524
1069 Ga0501034_0188125
1070 Ga0501036_0017845
1071 Ga0501036_0021341
1072 Ga0501036_0033427
1073 Ga0501036_0054861
1074 Ga0501036_0147586
1075 Ga0501036_0305392
1076 Ga0501036_0628660
1077 Ga0501037_0029496
1078 Ga0501037_0054069
1079 Ga0501037_0086892
1080 Ga0501037_0090283
1081 Ga0501037_0129182
1082 Ga0501037_0503608
1083 Ga0501038_0014303
1084 Ga0501038_0034739
1085 Ga0501038_0041327
1086 Ga0501038_0109196
1087 Ga0501038_0123520
1088 Ga0501038_0197867
1089 Ga0501039_0016092
1090 Ga0501039_0063840
1091 Ga0501039_0069965
1092 Ga0501039_0075593
1093 Ga0501040_0024534
1094 Ga0501040_0025946
1095 Ga0501040_0101663
1096 Ga0501040_0213066
1097 Ga0501040_0471817
1098 Ga0501040_1135104
1099 Ga0501041_0000385
1100 Ga0501041_0009427
1101 Ga0501041_0016784
1102 Ga0501041_0112322
1103 Ga0501042_0001515
1104 Ga0501042_0019232
1105 Ga0501042_0096767
1106 Ga0501043_0031893
1107 Ga0501043_0076458
1108 Ga0501043_0143412
1109 Ga0501043_0171773
1110 Ga0501043_0272948
1111 Ga0501043_0404954
1112 Ga0501046_0016261
1113 Ga0501046_0060878
1114 Ga0501046_0093488
1115 Ga0501046_0436441
1116 Ga0501047_0311817
1117 Ga0501048_0013660
1118 Ga0501048_0054968
1119 Ga0501048_0118514
1120 Ga0501068_0009632
1121 Ga0501068_0083712
1122 Ga0501068_0149191
1123 Ga0501068_0204455
1124 Ga0501068_0813495
1125 Ga0501069_0060412
1126 Ga0501070_0290102
1127 Ga0501070_0898173
1128 Ga0501071_0006914
1129 Ga0501071_0009100
1130 Ga0501071_0031833
1131 Ga0501071_0136808
1132 Ga0501071_0311599
1133 Ga0501071_0487997
1134 Ga0501072_0004999
1135 Ga0501072_0017138
1136 Ga0501072_0208202
1137 Ga0501072_0585497
1138 Ga0501073_0082927
1139 Ga0501073_0313524
1140 Ga0501073_0338817
1141 Ga0501074_0001599
1142 Ga0501074_0022717
1143 Ga0501074_0050510
1144 Ga0501074_0096130
1145 Ga0501075_0002774
1146 Ga0501075_0022484
1147 Ga0501075_0236708
1148 Ga0501076_0000282
1149 Ga0501076_0022226
1150 Ga0501076_0064885
1151 Ga0501076_0067868
1152 Ga0501076_0306348
1153 Ga0501076_0456344
1154 Ga0501076_0484690
1155 Ga0501077_0006245
1156 Ga0501077_0041903
1157 Ga0501077_0210120
1158 Ga0501077_0376758
1159 Ga0501214_077274
1160 Ga0501079_0012980
1161 Ga0501079_0043332
1162 Ga0501079_0102575
1163 Ga0501079_0392864
1164 Ga0501080_0024174
1165 Ga0501080_0191120
1166 Ga0501081_0004689
1167 Ga0501081_0019470
1168 Ga0501081_0023657
1169 Ga0501081_0101622
1170 Ga0501083_0034324
1171 Ga0501083_0361144
1172 Ga0501035_0060799
1173 Ga0501035_0089826
1174 Ga0501035_0133097
1175 Ga0501035_0417094
1176 Ga0501035_0559425
1177 Ga0501044_0007289
1178 Ga0501044_0240379
1179 Ga0501044_0637445
1180 Ga0501045_0007477
1181 Ga0501045_0014152
1182 Ga0501045_0071792
1183 Ga0501045_0615884
1184 nmdc:mga05p37_170337_c1
1185 nmdc:mga05p37_589795_c1
1186 nmdc:mga05p37_69786_c1
1187 nmdc:mga09592_235740_c1
1188 nmdc:mga0qj67_280447_c1
1189 nmdc:mga0qj67_514232_c1
1190 nmdc:mga06r32_1701999_c1
1191 nmdc:mga06r32_229224_c1
1192 nmdc:mga06r32_452344_c1
1193 nmdc:mga08y16_10618_c1
1194 nmdc:mga08y16_1250_c1
1195 nmdc:mga08y16_6515_c1
1196 nmdc:mga0n895_44834_c1
1197 nmdc:mga0n895_665877_c1
1198 nmdc:mga08x19_112816_c1
1199 nmdc:mga0a205_14155_c1
1200 nmdc:mga0a205_86957_c1
1201 nmdc:mga0a205_87065_c1
1202 Ga0501084_0031665
1203 Ga0501084_0034270
1204 Ga0501084_0090388
1205 Ga0501084_0117183
1206 Ga0501084_0295253
1207 Ga0501084_0497837
1208 Ga0590071_012838
1209 Ga0590074_057323
1210 Ga0590075_002449
1211 Ga0590077_005996
1212 Ga0501082_0002729
1213 Ga0501082_0080238
1214 Ga0530510_0002402
1215 Ga0530510_0025370
1216 Ga0530510_0030100
1217 Ga0530510_0092728
1218 2808892924
1219 2945922406
1220 2945941841
1221 2953998570
1222 8054107390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k8b-assembly1.cif.gz_B crystal structure of turkey (meleagiris gallopova)hemoglobin at 2.3 angstrom 0.3329 4 151
1yvq-assembly1.cif.gz_D the low salt (peg) crystal structure of co hemoglobin e (betae26k) approaching physiological ph (ph 7.5) 0.3298 9 158
6zqu-assembly1.cif.gz_A cryo-em structure of mature dengue virus 2 at 3.1 angstrom resolution 0.3062 21 156
8t69-assembly1.cif.gz_A human vmat2 in complex with tetrabenazine 0.3023 9 158
3ugy-assembly1.cif.gz_A hbi (f80y) co bound 0.294 4 149
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5879 1 157 1.20.120.550
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5391 1 157 1.20.120.550
af_U4PC71_25_290_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3657 7 105 1.20.1070.10
af_Q8NHS3_42_498_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3654 1 158 1.20.1250.20
af_Q8NHS3_42_498_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3637 1 158 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7ZXC3-F1-model_v4 Glycoside hydrolase family 15 protein 0.9655 5 152 GO:0004553
GO:0005975
GO:0016020
AF-A0A0Q9NK87-F1-model_v4 DUF2938 domain-containing protein 0.9642 1 158 GO:0016020
AF-A0A2V8B195-F1-model_v4 DUF2938 domain-containing protein 0.9629 16 152 GO:0016020
AF-A0A2T2ULB4-F1-model_v4 Uncharacterized protein 0.95 53 152 GO:0016020
AF-A0A2V9V8E6-F1-model_v4 DUF4149 domain-containing protein 0.9493 1 152 GO:0016020

Map