F468977

General Info

Members Datasets Scaffolds Average Seq Length
610 339 1220 211

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10247262|Ga0207671_102472622
Length 204
Sequence VTTSSPETGRPVVDFYFDPLCPFAWVSSRWILEVEKERDIDLTFRVMSLSVLNEGRDELPERYKEMLERGWGPVRICIAAEQAHGTAVLRDLYTALGTKHHNEGREFDEALQEVGLPVELADAAETDEYDDALRKSHHQGMDPVGMDVGTPTLHVDGVAFFGPVLTRIPRGEEAVKLWDGARLLASYPYFFELKRTRTEDPQFD

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
180 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
204 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
205 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
232 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
233 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
323 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
324 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
325 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
326 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
327 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
328 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
329 2891562705 Microbispora tritici MT50 Isolate Unclassified
330 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
331 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
332 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
333 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
334 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
335 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
336 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
337 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
338 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
339 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 2.62
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 6.72
Rhizosphere 87.54
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10247262 3300025914 Bacteria 1402
2 JGI24752J21851_1006635 3300001976 Bacteria 1514
3 JGI24745J21846_1018052 3300002073 Bacteria 822
4 JGI24033J26618_1020287 3300002155 Bacteria 847
5 JGI24751J29686_10043488 3300002459 Bacteria 928
6 Ga0058859_11299901 3300004798 Bacteria 1168
7 Ga0070658_10050435 3300005327 Bacteria 3374
8 Ga0070658_10143083 3300005327 Bacteria 1998
9 Ga0070676_10194569 3300005328 Bacteria 1326
10 Ga0070683_100011300 3300005329 Bacteria 7709
11 Ga0070683_100402431 3300005329 Bacteria 1305
12 Ga0070683_100426902 3300005329 Bacteria 1265
13 Ga0070690_100299359 3300005330 Bacteria 1153
14 Ga0070670_100062081 3300005331 Bacteria 3208
15 Ga0068869_100047199 3300005334 Bacteria 3109
16 Ga0068869_100055639 3300005334 Bacteria 2884
17 Ga0070666_10003675 3300005335 Bacteria 9296
18 Ga0070666_10149455 3300005335 Bacteria 1629
19 Ga0070666_10299881 3300005335 Bacteria 1144
20 Ga0070680_100018400 3300005336 Bacteria 5519
21 Ga0070680_100137353 3300005336 Bacteria 2048
22 Ga0070682_100015721 3300005337 Bacteria 4390
23 Ga0070682_100017220 3300005337 Bacteria 4211
24 Ga0068868_100007882 3300005338 Bacteria 7607
25 Ga0068868_100021035 3300005338 Bacteria 4912
26 Ga0070691_10020865 3300005341 Bacteria 3030
27 Ga0070691_10089915 3300005341 Bacteria 1513
28 Ga0070687_100045873 3300005343 Bacteria 2235
29 Ga0070661_100572888 3300005344 Bacteria 910
30 Ga0070692_10005913 3300005345 Bacteria 5268
31 Ga0070692_10024403 3300005345 Bacteria 2971
32 Ga0070692_10176163 3300005345 Bacteria 1236
33 Ga0070668_100000709 3300005347 Bacteria 22813
34 Ga0070668_100006792 3300005347 Bacteria 8486
35 Ga0070668_100211992 3300005347 Bacteria 1594
36 Ga0070668_100634672 3300005347 Bacteria 937
37 Ga0070669_100180739 3300005353 Bacteria 1650
38 Ga0070671_100036207 3300005355 Bacteria 4091
39 Ga0070671_100246165 3300005355 Bacteria 1518
40 Ga0070673_100234333 3300005364 Bacteria 1593
41 Ga0070688_100098775 3300005365 Bacteria 1921
42 Ga0070659_100097039 3300005366 Bacteria 2368
43 Ga0070667_100018295 3300005367 Bacteria 5809
44 Ga0070667_100194731 3300005367 Bacteria 1797
45 Ga0070703_10109292 3300005406 Bacteria 987
46 Ga0070709_10071888 3300005434 Bacteria 2234
47 Ga0070709_10304547 3300005434 Bacteria 1165
48 Ga0070714_100000008 3300005435 Bacteria 278734
49 Ga0070714_100039704 3300005435 Bacteria 3963
50 Ga0070714_100082612 3300005435 Bacteria 2799
51 Ga0070714_100117384 3300005435 Bacteria 2363
52 Ga0070714_100153211 3300005435 Bacteria 2079
53 Ga0070714_100552206 3300005435 Bacteria 1103
54 Ga0070714_101109347 3300005435 Bacteria 771
55 Ga0070713_100007612 3300005436 Bacteria 7620
56 Ga0070713_100550315 3300005436 Bacteria 1092
57 Ga0070713_100577778 3300005436 Bacteria 1066
58 Ga0070710_10177146 3300005437 Bacteria 1332
59 Ga0070701_10033780 3300005438 Bacteria 2558
60 Ga0070705_100087720 3300005440 Bacteria 1929
61 Ga0070700_100022021 3300005441 Bacteria 3711
62 Ga0070700_100149886 3300005441 Bacteria 1594
63 Ga0070700_100219031 3300005441 Bacteria 1347
64 Ga0070694_100208464 3300005444 Bacteria 1460
65 Ga0070663_100002192 3300005455 Bacteria 10918
66 Ga0070663_100020823 3300005455 Bacteria 4347
67 Ga0070663_100048455 3300005455 Bacteria 3013
68 Ga0070663_100540398 3300005455 Bacteria 973
69 Ga0070678_100035653 3300005456 Bacteria 3476
70 Ga0070678_100378286 3300005456 Bacteria 1224
71 Ga0070681_10077051 3300005458 Bacteria 3292
72 Ga0070681_10363345 3300005458 Bacteria 1358
73 Ga0070681_10459052 3300005458 Bacteria 1186
74 Ga0070685_10011821 3300005466 Bacteria 4577
75 Ga0070707_100173129 3300005468 Bacteria 2104
76 Ga0070707_100223832 3300005468 Bacteria 1832
77 Ga0070698_100045876 3300005471 Bacteria 4471
78 Ga0070679_100048935 3300005530 Bacteria 4211
79 Ga0070679_100094593 3300005530 Bacteria 2975
80 Ga0070679_100119142 3300005530 Bacteria 2624
81 Ga0070679_100282260 3300005530 Bacteria 1613
82 Ga0070679_100630254 3300005530 Bacteria 1015
83 Ga0070684_100690108 3300005535 Bacteria 951
84 Ga0070697_100250035 3300005536 Bacteria 1516
85 Ga0068853_100027178 3300005539 Bacteria 4807
86 Ga0068853_100226806 3300005539 Bacteria 1708
87 Ga0070686_100105131 3300005544 Bacteria 1914
88 Ga0070696_100133554 3300005546 Bacteria 1808
89 Ga0070696_100227537 3300005546 Bacteria 1402
90 Ga0070693_100009183 3300005547 Bacteria 4911
91 Ga0070693_100014611 3300005547 Bacteria 4026
92 Ga0070665_100006527 3300005548 Bacteria 11855
93 Ga0070665_100211169 3300005548 Bacteria 1942
94 Ga0070665_100335691 3300005548 Bacteria 1516
95 Ga0070665_100764243 3300005548 Bacteria 979
96 Ga0068855_100004156 3300005563 Bacteria 17664
97 Ga0068855_100006398 3300005563 Bacteria 14344
98 Ga0068855_100050060 3300005563 Bacteria 4924
99 Ga0068855_100054218 3300005563 Bacteria 4713
100 Ga0070664_100117117 3300005564 Bacteria 2330
101 Ga0068857_100493015 3300005577 Bacteria 1149
102 Ga0068854_100349125 3300005578 Bacteria 1210
103 Ga0068856_100004627 3300005614 Bacteria 13666
104 Ga0068856_100048883 3300005614 Bacteria 4169
105 Ga0068856_100239346 3300005614 Bacteria 1830
106 Ga0068856_100418130 3300005614 Bacteria 1361
107 Ga0070702_100006479 3300005615 Bacteria 5545
108 Ga0070702_100013136 3300005615 Bacteria 4173
109 Ga0068852_100022379 3300005616 Bacteria 5068
110 Ga0068852_100520693 3300005616 Bacteria 1186
111 Ga0068859_100031262 3300005617 Bacteria 5344
112 Ga0068859_100034525 3300005617 Bacteria 5077
113 Ga0068859_100095834 3300005617 Bacteria 3020
114 Ga0068864_100019855 3300005618 Bacteria 5620
115 Ga0068866_10059893 3300005718 Bacteria 1972
116 Ga0068861_100051457 3300005719 Bacteria 3127
117 Ga0068851_10027386 3300005834 Bacteria 2809
118 Ga0068870_10009335 3300005840 Bacteria 4457
119 Ga0068863_100000271 3300005841 Bacteria 53894
120 Ga0068863_100025529 3300005841 Bacteria 5633
121 Ga0068863_100048872 3300005841 Bacteria 4011
122 Ga0068858_100002463 3300005842 Bacteria 18687
123 Ga0068858_100245423 3300005842 Bacteria 1700
124 Ga0068860_100000017 3300005843 Bacteria 307083
125 Ga0068860_100177775 3300005843 Bacteria 2057
126 Ga0068860_100226184 3300005843 Bacteria 1817
127 Ga0081455_10009106 3300005937 Bacteria 10244
128 Ga0081540_1008537 3300005983 Bacteria 7149
129 Ga0081540_1060922 3300005983 Bacteria 1802
130 Ga0070717_10013277 3300006028 Bacteria 6306
131 Ga0070717_10310339 3300006028 Bacteria 1404
132 Ga0070717_10945080 3300006028 Bacteria 785
133 Ga0070716_100149970 3300006173 Bacteria 1498
134 Ga0070712_100028490 3300006175 Bacteria 3736
135 Ga0070712_100304131 3300006175 Bacteria 1291
136 Ga0097621_100021386 3300006237 Bacteria 5004
137 Ga0097621_100038436 3300006237 Bacteria 3841
138 Ga0097621_100664638 3300006237 Bacteria 957
139 Ga0068871_100027570 3300006358 Bacteria 4444
140 Ga0068871_100511724 3300006358 Bacteria 1083
141 Ga0075428_100043829 3300006844 Bacteria 4918
142 Ga0075433_10009465 3300006852 Bacteria 7787
143 Ga0075433_10122796 3300006852 Bacteria 2307
144 Ga0075434_100003664 3300006871 Bacteria 13726
145 Ga0075434_100078732 3300006871 Bacteria 3292
146 Ga0075429_100051549 3300006880 Bacteria 3581
147 Ga0068865_100521766 3300006881 Bacteria 993
148 Ga0075436_100001371 3300006914 Bacteria 16587
149 Ga0075436_100032981 3300006914 Bacteria 3568
150 Ga0097620_100031262 3300006931 Bacteria 5344
151 Ga0097620_100034525 3300006931 Bacteria 5077
152 Ga0097620_100095822 3300006931 Bacteria 3020
153 Ga0075435_100011416 3300007076 Bacteria 6534
154 Ga0105240_10123319 3300009093 Bacteria 3118
155 Ga0105240_10396811 3300009093 Bacteria 1555
156 Ga0105240_10399796 3300009093 Bacteria 1548
157 Ga0111539_10223992 3300009094 Bacteria 2190
158 Ga0105245_10616411 3300009098 Bacteria 1113
159 Ga0105247_10005745 3300009101 Bacteria 7768
160 Ga0105247_10019614 3300009101 Bacteria 4060
161 Ga0105247_10053689 3300009101 Bacteria 2486
162 Ga0114129_10084092 3300009147 Bacteria 4419
163 Ga0105243_10239339 3300009148 Bacteria 1614
164 Ga0105241_10016063 3300009174 Bacteria 5488
165 Ga0105241_10078713 3300009174 Bacteria 2576
166 Ga0105241_10085663 3300009174 Bacteria 2477
167 Ga0105242_10016670 3300009176 Bacteria 5716
168 Ga0105248_10047322 3300009177 Bacteria 4823
169 Ga0105248_10076796 3300009177 Bacteria 3754
170 Ga0105237_10043397 3300009545 Bacteria 4529
171 Ga0105237_10065764 3300009545 Bacteria 3621
172 Ga0105237_10113030 3300009545 Bacteria 2708
173 Ga0105238_10118105 3300009551 Bacteria 2632
174 Ga0105249_10010204 3300009553 Bacteria 8252
175 Ga0105249_10065191 3300009553 Bacteria 3350
176 Ga0105239_10470788 3300010375 Bacteria 1427
177 Ga0105246_10000627 3300011119 Bacteria 19701
178 Ga0105246_10015928 3300011119 Bacteria 4754
179 Ga0105246_10805339 3300011119 Bacteria 834
180 Ga0157373_10033840 3300013100 Bacteria 3673
181 Ga0157371_10040264 3300013102 Bacteria 3338
182 Ga0157370_10060968 3300013104 Bacteria 3580
183 Ga0157370_10236716 3300013104 Bacteria 1690
184 Ga0157370_10280370 3300013104 Bacteria 1540
185 Ga0157369_10082229 3300013105 Bacteria 3446
186 Ga0157369_10118358 3300013105 Bacteria 2812
187 Ga0157369_10168017 3300013105 Bacteria 2312
188 Ga0157369_10547835 3300013105 Bacteria 1196
189 Ga0157369_10572267 3300013105 Bacteria 1167
190 Ga0157369_11475144 3300013105 Bacteria 692
191 Ga0157374_10054615 3300013296 Bacteria 3726
192 Ga0157374_10117982 3300013296 Bacteria 2558
193 Ga0157378_10087437 3300013297 Bacteria 2827
194 Ga0163162_10268371 3300013306 Bacteria 1838
195 Ga0163162_10406811 3300013306 Bacteria 1493
196 Ga0157372_10000195 3300013307 Bacteria 66634
197 Ga0157372_10176070 3300013307 Bacteria 2476
198 Ga0157375_10245669 3300013308 Bacteria 1950
199 Ga0157375_10561070 3300013308 Bacteria 1303
200 Ga0157380_10091161 3300014326 Bacteria 2516
201 Ga0157380_10302849 3300014326 Bacteria 1473
202 Ga0157377_10111344 3300014745 Bacteria 1646
203 Ga0157379_10036181 3300014968 Bacteria 4403
204 Ga0157379_10437336 3300014968 Bacteria 1206
205 Ga0157376_10137247 3300014969 Bacteria 2190
206 Ga0163161_10020266 3300017792 Bacteria 4665
207 Ga0163161_10578132 3300017792 Bacteria 924
208 Ga0197907_10306656 3300020069 Bacteria 1592
209 Ga0197907_10659117 3300020069 Bacteria 852
210 Ga0206356_11870013 3300020070 Bacteria 1195
211 Ga0206349_1891324 3300020075 Bacteria 845
212 Ga0206351_10964695 3300020077 Bacteria 800
213 Ga0206350_10785953 3300020080 Bacteria 1280
214 Ga0206354_10876564 3300020081 Bacteria 3546
215 Ga0206354_11531443 3300020081 Bacteria 731
216 Ga0206353_11559299 3300020082 Bacteria 1257
217 Ga0154015_1048981 3300020610 Bacteria 2134
218 Ga0154015_1153432 3300020610 Bacteria 915
219 Ga0154015_1349502 3300020610 Bacteria 1159
220 Ga0213875_10324568 3300021388 Bacteria 730
221 Ga0224712_10021381 3300022467 Bacteria 2213
222 Ga0224712_10077861 3300022467 Bacteria 1362
223 Ga0207656_10041489 3300025321 Bacteria 1955
224 Ga0207692_10002822 3300025898 Bacteria 6708
225 Ga0207692_10079576 3300025898 Bacteria 1749
226 Ga0207692_10139016 3300025898 Bacteria 1380
227 Ga0207642_10020156 3300025899 Bacteria 2597
228 Ga0207710_10002941 3300025900 Bacteria 7731
229 Ga0207710_10068859 3300025900 Bacteria 1619
230 Ga0207710_10136959 3300025900 Bacteria 1180
231 Ga0207688_10023762 3300025901 Bacteria 3359
232 Ga0207680_10009015 3300025903 Bacteria 4927
233 Ga0207680_10166689 3300025903 Bacteria 1481
234 Ga0207680_10222138 3300025903 Bacteria 1295
235 Ga0207647_10047030 3300025904 Bacteria 2686
236 Ga0207647_10061539 3300025904 Bacteria 2290
237 Ga0207647_10086412 3300025904 Bacteria 1874
238 Ga0207647_10162531 3300025904 Bacteria 1302
239 Ga0207647_10176266 3300025904 Bacteria 1244
240 Ga0207647_10305773 3300025904 Bacteria 905
241 Ga0207643_10000112 3300025908 Bacteria 55805
242 Ga0207643_10063978 3300025908 Bacteria 2105
243 Ga0207705_10012218 3300025909 Bacteria 6206
244 Ga0207705_10014292 3300025909 Bacteria 5716
245 Ga0207705_10079647 3300025909 Bacteria 2386
246 Ga0207654_10007758 3300025911 Bacteria 5416
247 Ga0207654_10055233 3300025911 Bacteria 2298
248 Ga0207654_10058026 3300025911 Bacteria 2252
249 Ga0207707_10010656 3300025912 Bacteria 7986
250 Ga0207707_10109458 3300025912 Bacteria 2415
251 Ga0207707_10632295 3300025912 Bacteria 904
252 Ga0207695_10202644 3300025913 Bacteria 1898
253 Ga0207671_10354987 3300025914 Bacteria 1163
254 Ga0207693_10002350 3300025915 Bacteria 16433
255 Ga0207693_10014527 3300025915 Bacteria 6328
256 Ga0207693_10160333 3300025915 Bacteria 1769
257 Ga0207663_10043275 3300025916 Bacteria 2756
258 Ga0207660_10284347 3300025917 Bacteria 1313
259 Ga0207662_10016611 3300025918 Bacteria 4156
260 Ga0207657_10005281 3300025919 Bacteria 13536
261 Ga0207657_10027799 3300025919 Bacteria 5173
262 Ga0207649_10220442 3300025920 Bacteria 1351
263 Ga0207649_10471982 3300025920 Bacteria 950
264 Ga0207652_10013348 3300025921 Bacteria 6652
265 Ga0207652_10013580 3300025921 Bacteria 6586
266 Ga0207652_10086028 3300025921 Bacteria 2756
267 Ga0207652_10486063 3300025921 Bacteria 1112
268 Ga0207646_10124495 3300025922 Bacteria 2317
269 Ga0207650_10007760 3300025925 Bacteria 7316
270 Ga0207687_10075547 3300025927 Bacteria 2418
271 Ga0207687_10401893 3300025927 Bacteria 1127
272 Ga0207700_10006552 3300025928 Bacteria 7044
273 Ga0207700_10076548 3300025928 Bacteria 2596
274 Ga0207700_10085981 3300025928 Bacteria 2470
275 Ga0207700_10209815 3300025928 Bacteria 1646
276 Ga0207700_10678328 3300025928 Bacteria 919
277 Ga0207664_10000002 3300025929 Bacteria 657053
278 Ga0207664_10093066 3300025929 Bacteria 2475
279 Ga0207664_10390327 3300025929 Bacteria 1237
280 Ga0207644_10154062 3300025931 Bacteria 1781
281 Ga0207690_10122055 3300025932 Bacteria 1894
282 Ga0207670_10076598 3300025936 Bacteria 2328
283 Ga0207665_10003116 3300025939 Bacteria 11120
284 Ga0207665_10040554 3300025939 Bacteria 3107
285 Ga0207711_10040716 3300025941 Bacteria 3954
286 Ga0207711_10057283 3300025941 Bacteria 3350
287 Ga0207689_10000391 3300025942 Bacteria 41247
288 Ga0207689_10040980 3300025942 Bacteria 3832
289 Ga0207689_10444340 3300025942 Bacteria 1083
290 Ga0207661_10003751 3300025944 Bacteria 10583
291 Ga0207661_10269812 3300025944 Bacteria 1518
292 Ga0207661_10378426 3300025944 Bacteria 1281
293 Ga0207679_10024195 3300025945 Bacteria 4162
294 Ga0207667_10057832 3300025949 Bacteria 4069
295 Ga0207667_10071316 3300025949 Bacteria 3613
296 Ga0207651_10035829 3300025960 Bacteria 3232
297 Ga0207712_10576765 3300025961 Bacteria 970
298 Ga0207668_10009581 3300025972 Bacteria 5813
299 Ga0207668_10030636 3300025972 Bacteria 3537
300 Ga0207668_10054577 3300025972 Bacteria 2774
301 Ga0207668_10160602 3300025972 Bacteria 1751
302 Ga0207668_10243389 3300025972 Bacteria 1457
303 Ga0207640_10066924 3300025981 Bacteria 2402
304 Ga0207640_10124395 3300025981 Bacteria 1854
305 Ga0207658_10041867 3300025986 Bacteria 3319
306 Ga0207677_10005321 3300026023 Bacteria 6978
307 Ga0207677_10146164 3300026023 Bacteria 1817
308 Ga0207703_10010385 3300026035 Bacteria 7283
309 Ga0207703_10331435 3300026035 Bacteria 1396
310 Ga0207639_10283241 3300026041 Bacteria 1458
311 Ga0207639_10583618 3300026041 Bacteria 1029
312 Ga0207678_10001184 3300026067 Bacteria 23897
313 Ga0207678_10003683 3300026067 Bacteria 13778
314 Ga0207708_10005926 3300026075 Bacteria 9041
315 Ga0207708_10185122 3300026075 Bacteria 1655
316 Ga0207708_10295905 3300026075 Bacteria 1315
317 Ga0207702_10004634 3300026078 Bacteria 12175
318 Ga0207702_10005265 3300026078 Bacteria 11357
319 Ga0207702_10058820 3300026078 Bacteria 3272
320 Ga0207641_10006406 3300026088 Bacteria 9922
321 Ga0207641_10155163 3300026088 Bacteria 2076
322 Ga0207676_10003384 3300026095 Bacteria 11276
323 Ga0207676_10171189 3300026095 Bacteria 1892
324 Ga0207674_10014768 3300026116 Bacteria 8614
325 Ga0207674_10116721 3300026116 Bacteria 2640
326 Ga0207674_10223566 3300026116 Bacteria 1831
327 Ga0207675_100002341 3300026118 Bacteria 18785
328 Ga0207675_100071860 3300026118 Bacteria 3235
329 Ga0207683_10000967 3300026121 Bacteria 26303
330 Ga0207683_10009886 3300026121 Bacteria 8134
331 Ga0207698_10011342 3300026142 Bacteria 5772
332 Ga0207698_10031920 3300026142 Bacteria 3809
333 Ga0207698_10108520 3300026142 Bacteria 2320
334 Ga0207428_10021543 3300027907 Bacteria 5456
335 Ga0265354_1011186 3300028016 Bacteria 854
336 Ga0268266_10003027 3300028379 Bacteria 17268
337 Ga0268266_10098010 3300028379 Bacteria 2579
338 Ga0268266_10166786 3300028379 Bacteria 1996
339 Ga0268265_10506428 3300028380 Bacteria 1139
340 Ga0268265_11389365 3300028380 Bacteria 704
341 Ga0268264_10000033 3300028381 Bacteria 404123
342 Ga0268264_10021790 3300028381 Bacteria 5230
343 Ga0265337_1081692 3300028556 Bacteria 883
344 Ga0265319_1004253 3300028563 Bacteria 7137
345 Ga0265334_10003003 3300028573 Bacteria 7709
346 Ga0265318_10009714 3300028577 Bacteria 4219
347 Ga0265323_10060420 3300028653 Bacteria 1319
348 Ga0265322_10069782 3300028654 Bacteria 996
349 Ga0265336_10016956 3300028666 Bacteria 2374
350 Ga0307515_10195685 3300028794 Bacteria 1915
351 Ga0265338_10000059 3300028800 Bacteria 198047
352 Ga0265338_10007182 3300028800 Bacteria 13939
353 Ga0265338_10104881 3300028800 Bacteria 2293
354 Ga0265324_10000821 3300029957 Bacteria 20206
355 Ga0307512_10167430 3300030522 Bacteria 1269
356 Ga0265770_1002461 3300030878 Bacteria 2515
357 Ga0265332_10004728 3300031238 Bacteria 6352
358 Ga0265320_10006149 3300031240 Bacteria 7599
359 Ga0265340_10006340 3300031247 Bacteria 6520
360 Ga0265339_10033917 3300031249 Bacteria 2871
361 Ga0265316_10013649 3300031344 Bacteria 7207
362 Ga0307509_10080879 3300031507 Bacteria 3359
363 Ga0265313_10068905 3300031595 Bacteria 1633
364 Ga0307508_10169663 3300031616 Bacteria 1786
365 Ga0265314_10014727 3300031711 Bacteria 6239
366 Ga0265342_10001214 3300031712 Bacteria 24392
367 Ga0307518_10019259 3300031838 Bacteria 4904
368 Ga0326468_10003200 3300031889 Bacteria 1382
369 Ga0307416_100509625 3300032002 Bacteria 1269
370 Ga0307415_100106591 3300032126 Bacteria 2069
371 Ga0307507_10064045 3300033179 Bacteria 3396
372 Ga0307510_10062042 3300033180 Bacteria 3823
373 Ga0316215_1013242 3300033544 Bacteria 822
374 Ga0316212_1001600 3300033547 Bacteria 3113
375 Ga0316216_1001204 3300033548 Bacteria 1921
376 Ga0373948_0034647 3300034817 Bacteria 1033
377 Ga0373958_0022922 3300034819 Bacteria 1171
378 Ga0373959_0021524 3300034820 Bacteria 1239
379 Ga0373934_0020633 3300035086 Bacteria 2533
380 Ga0373940_0023737 3300035088 Bacteria 1585
381 Ga0373923_0047567 3300035111 Bacteria 1788
382 Ga0373936_0102928 3300035113 Bacteria 1206
383 Ga0373953_0125381 3300035117 Bacteria 1092
384 Ga0373954_0142962 3300035118 Bacteria 1167
385 Ga0373956_0013322 3300035119 Bacteria 3420
386 Ga0373957_0038263 3300035120 Bacteria 1795
387 Ga0373960_0001892 3300035121 Bacteria 4686
388 Ga0373943_0236642 3300035170 Bacteria 1022
389 Ga0373955_0019144 3300035172 Bacteria 3416
390 Ga0373962_0003077 3300035242 Bacteria 3998
391 Ga0373924_0022427 3300035410 Bacteria 2468
392 Ga0373931_0317718 3300035691 Bacteria 966
393 Ga0373935_0061610 3300035692 Bacteria 2402
394 Ga0373927_0055598 3300035695 Bacteria 2559
395 Ga0373933_0042452 3300035724 Bacteria 2688
396 Ga0373947_0370821 3300035725 Bacteria 963
397 Ga0373937_0212053 3300036401 Bacteria 1822
398 Ga0373925_0000779 3300037068 Bacteria 29324
399 Ga0395898_0927519 3300037466 Bacteria 808
400 Ga0395898_0946201 3300037466 Bacteria 799
401 Ga0436364_0905203 3300037853 Bacteria 1169
402 Ga0436364_1071383 3300037853 Bacteria 976
403 Ga0436364_1130976 3300037853 Bacteria 1268
404 Ga0400485_18159 3300038735 Bacteria 3046
405 Ga0400487_41166 3300039110 Bacteria 1856
406 Ga0439463_009676 3300042016 Bacteria 2370
407 Ga0439459_0018353 3300042438 Bacteria 1314
408 Ga0466969_0010688 3300044656 Bacteria 4864
409 Ga0466969_0162266 3300044656 Bacteria 1027
410 Ga0466972_0010234 3300044658 Bacteria 4710
411 Ga0466972_0020008 3300044658 Bacteria 3346
412 Ga0466972_0132933 3300044658 Bacteria 1171
413 Ga0466965_0027264 3300044683 Bacteria 2772
414 Ga0466965_0081520 3300044683 Bacteria 1636
415 Ga0466965_0174184 3300044683 Bacteria 1133
416 Ga0466966_0005150 3300044684 Bacteria 8591
417 Ga0466966_0076800 3300044684 Bacteria 2085
418 Ga0466966_0398574 3300044684 Bacteria 827
419 Ga0466966_0442713 3300044684 Bacteria 781
420 Ga0466966_0493877 3300044684 Bacteria 736
421 Ga0466961_0003526 3300044693 Bacteria 9757
422 Ga0466961_0003853 3300044693 Bacteria 9373
423 Ga0466961_0064545 3300044693 Bacteria 2327
424 Ga0466961_0073013 3300044693 Bacteria 2176
425 Ga0466961_0246331 3300044693 Bacteria 1098
426 Ga0466963_0014301 3300044694 Bacteria 4890
427 Ga0466963_0016872 3300044694 Bacteria 4547
428 Ga0466963_0064303 3300044694 Bacteria 2457
429 Ga0466963_0073001 3300044694 Bacteria 2312
430 Ga0466963_0460655 3300044694 Bacteria 897
431 Ga0466963_0693690 3300044694 Bacteria 718
432 Ga0466964_0013600 3300044706 Bacteria 3087
433 Ga0466971_0001159 3300044719 Bacteria 10958
434 Ga0466971_0021547 3300044719 Bacteria 2867
435 Ga0466968_0077816 3300044735 Bacteria 1453
436 Ga0466968_0204876 3300044735 Bacteria 925
437 Ga0466968_0224506 3300044735 Bacteria 886
438 Ga0466970_0032284 3300044765 Bacteria 2766
439 Ga0466970_0048779 3300044765 Bacteria 2258
440 Ga0466970_0134360 3300044765 Bacteria 1360
441 Ga0466957_0049449 3300044842 Bacteria 2556
442 Ga0466957_0074332 3300044842 Bacteria 2107
443 Ga0466957_0208321 3300044842 Bacteria 1287
444 Ga0466957_0714061 3300044842 Bacteria 708
445 Ga0466960_0009298 3300044901 Bacteria 4047
446 Ga0466960_0014141 3300044901 Bacteria 3408
447 Ga0466960_0058967 3300044901 Bacteria 1876
448 Ga0466960_0099880 3300044901 Bacteria 1493
449 Ga0466959_0004974 3300045049 Bacteria 9009
450 Ga0466959_0047349 3300045049 Bacteria 3162
451 Ga0466959_0055195 3300045049 Bacteria 2901
452 Ga0466959_0088813 3300045049 Bacteria 2222
453 Ga0466959_0214055 3300045049 Bacteria 1338
454 Ga0466959_0236918 3300045049 Bacteria 1262
455 Ga0466959_0261481 3300045049 Bacteria 1191
456 Ga0466959_0304136 3300045049 Bacteria 1092
457 Ga0466958_0010218 3300045836 Bacteria 5250
458 Ga0466958_0016550 3300045836 Bacteria 4247
459 Ga0466958_0021656 3300045836 Bacteria 3759
460 Ga0466958_0052101 3300045836 Bacteria 2479
461 Ga0466958_0113605 3300045836 Bacteria 1691
462 Ga0466958_0153163 3300045836 Bacteria 1455
463 Ga0466967_0005135 3300045976 Bacteria 9001
464 Ga0466967_0005774 3300045976 Bacteria 8651
465 Ga0466967_0014140 3300045976 Bacteria 6202
466 Ga0466967_0031717 3300045976 Bacteria 4453
467 Ga0466967_0076666 3300045976 Bacteria 3008
468 Ga0466967_0158178 3300045976 Bacteria 2125
469 Ga0466967_0286051 3300045976 Bacteria 1583
470 Ga0466967_0287783 3300045976 Bacteria 1578
471 Ga0466967_0293261 3300045976 Bacteria 1563
472 Ga0466967_0658220 3300045976 Bacteria 1036
473 Ga0466967_0689236 3300045976 Bacteria 1011
474 Ga0466967_1101487 3300045976 Bacteria 791
475 Ga0495592_0241733 3300046454 Bacteria 1197
476 Ga0495651_0090276 3300046462 Bacteria 2298
477 Ga0495653_0027656 3300046463 Bacteria 4539
478 Ga0495664_0257317 3300046477 Bacteria 1055
479 Ga0495608_0015764 3300046511 Bacteria 5230
480 Ga0495618_0003595 3300046514 Bacteria 9608
481 Ga0495618_0194130 3300046514 Bacteria 1286
482 Ga0495628_0011707 3300046516 Bacteria 7408
483 Ga0495628_0026687 3300046516 Bacteria 4705
484 Ga0495630_0339864 3300046517 Bacteria 1148
485 Ga0495652_0005750 3300046529 Bacteria 11611
486 Ga0495652_0093500 3300046529 Bacteria 2454
487 Ga0495640_0084691 3300046533 Bacteria 2102
488 Ga0495587_0027889 3300046536 Bacteria 3438
489 Ga0495645_0282667 3300046543 Bacteria 1090
490 Ga0495667_0059406 3300046559 Bacteria 2509
491 Ga0495634_0042353 3300046642 Bacteria 3089
492 Ga0495634_0265686 3300046642 Bacteria 1045
493 Ga0495635_0001181 3300046663 Bacteria 17399
494 Ga0495635_0060671 3300046663 Bacteria 2598
495 Ga0495657_0028145 3300046675 Bacteria 3957
496 Ga0495599_0047392 3300046678 Bacteria 2693
497 Ga0495623_0012260 3300046679 Bacteria 5552
498 Ga0495646_0035322 3300046680 Bacteria 3101
499 Ga0495646_0088462 3300046680 Bacteria 1794
500 Ga0495613_0180275 3300046689 Bacteria 1496
501 Ga0495624_0297146 3300046690 Bacteria 974
502 Ga0495600_0089526 3300046809 Bacteria 2007
503 Ga0495600_0425778 3300046809 Bacteria 823
504 Ga0495604_0156086 3300047317 Bacteria 1616
505 Ga0495674_0063601 3300047319 Bacteria 3209
506 Ga0495680_0130457 3300047322 Bacteria 1847
507 Ga0495675_0189144 3300047444 Bacteria 1257
508 Ga0495684_0032643 3300047471 Bacteria 3997
509 Ga0495602_0074941 3300048088 Bacteria 2873
510 Ga0495602_0161890 3300048088 Bacteria 1746
511 Ga0496100_0048048 3300048903 Bacteria 2753
512 Ga0496101_0091317 3300048904 Bacteria 2266
513 Ga0496102_0000142 3300048905 Bacteria 97037
514 Ga0496102_0001260 3300048905 Bacteria 22839
515 Ga0496102_0003886 3300048905 Bacteria 12657
516 Ga0496102_0019734 3300048905 Bacteria 5942
517 Ga0496102_0053624 3300048905 Bacteria 3675
518 Ga0496102_0448216 3300048905 Bacteria 1211
519 Ga0496103_0000085 3300048906 Bacteria 105412
520 Ga0496103_0006950 3300048906 Bacteria 6758
521 Ga0496103_0065420 3300048906 Bacteria 2268
522 Ga0496104_0015528 3300048907 Bacteria 6898
523 Ga0496104_0141015 3300048907 Bacteria 2315
524 Ga0496104_0145949 3300048907 Bacteria 2272
525 Ga0496105_0118439 3300048908 Bacteria 2184
526 Ga0496105_0123581 3300048908 Bacteria 2133
527 Ga0496106_0165879 3300048909 Bacteria 1748
528 Ga0496107_0111358 3300048910 Bacteria 2012
529 Ga0496108_0026525 3300048911 Bacteria 4779
530 Ga0496108_0036728 3300048911 Bacteria 4077
531 Ga0496108_0148588 3300048911 Bacteria 2021
532 Ga0496109_0004796 3300048912 Bacteria 11290
533 Ga0496109_0011456 3300048912 Bacteria 7625
534 Ga0496109_0023781 3300048912 Bacteria 5438
535 Ga0496109_0342758 3300048912 Bacteria 1411
536 Ga0496110_0046735 3300048913 Bacteria 3787
537 Ga0496110_0069269 3300048913 Bacteria 3124
538 Ga0496111_0002010 3300048914 Bacteria 12096
539 Ga0496111_0071677 3300048914 Bacteria 2522
540 Ga0496111_0458310 3300048914 Bacteria 940
541 Ga0496112_0030585 3300048915 Bacteria 5212
542 Ga0496112_0034462 3300048915 Bacteria 4926
543 Ga0496113_0009443 3300048916 Bacteria 6400
544 Ga0496113_0044443 3300048916 Bacteria 3291
545 Ga0496113_0059868 3300048916 Bacteria 2869
546 Ga0496114_0021637 3300048917 Bacteria 5233
547 Ga0496114_0128470 3300048917 Bacteria 2187
548 Ga0496114_0278211 3300048917 Bacteria 1475
549 Ga0496115_0019552 3300048918 Bacteria 5213
550 Ga0496115_0226024 3300048918 Bacteria 1544
551 Ga0496115_0233754 3300048918 Bacteria 1515
552 Ga0496118_0030245 3300048921 Bacteria 4522
553 Ga0496119_0009361 3300048922 Bacteria 8423
554 Ga0496121_0017747 3300048924 Bacteria 7239
555 Ga0496126_0014015 3300048929 Bacteria 8125
556 Ga0496126_0025703 3300048929 Bacteria 5659
557 Ga0501032_0039938 3300049569 Bacteria 3191
558 Ga0501036_0020752 3300049572 Bacteria 5518
559 Ga0501037_0056471 3300049573 Bacteria 2867
560 Ga0501038_0060252 3300049574 Bacteria 3248
561 Ga0501039_0644702 3300049575 Bacteria 829
562 Ga0501046_0353627 3300049580 Bacteria 1066
563 Ga0501047_0045861 3300049581 Bacteria 4225
564 Ga0501048_0000234 3300049582 Bacteria 36730
565 Ga0501069_0537103 3300049585 Bacteria 699
566 Ga0501070_0075127 3300049586 Bacteria 2797
567 Ga0501079_0283020 3300049741 Bacteria 1297
568 Ga0501035_0005970 3300049822 Bacteria 11464
569 Ga0501035_0608094 3300049822 Bacteria 890
570 Ga0501044_0008121 3300049823 Bacteria 11518
571 Ga0501044_0138910 3300049823 Bacteria 2419
572 nmdc:mga05p37_236187_c1 3300050507 Bacteria 2200
573 nmdc:mga08y16_1185367_c1 3300050511 Bacteria 735
574 nmdc:mga08y16_23265_c1 3300050511 Bacteria 6543
575 nmdc:mga0n895_100144_c1 3300050512 Bacteria 2907
576 nmdc:mga0n895_35445_c1 3300050512 Bacteria 4811
577 nmdc:mga0rr50_12682_c1 3300050513 Bacteria 5458
578 nmdc:mga0rr50_17482_c1 3300050513 Bacteria 4790
579 nmdc:mga08x19_418019_c1 3300050514 Bacteria 942
580 nmdc:mga08x19_82008_c1 3300050514 Bacteria 2119
581 nmdc:mga0a205_10382_c1 3300050515 Bacteria 8557
582 nmdc:mga0a205_19121_c1 3300050515 Bacteria 6458
583 Ga0495601_0041948 3300053077 Bacteria 2869
584 Ga0495601_0346958 3300053077 Bacteria 965
585 Ga0495612_0004957 3300053078 Bacteria 5510
586 Ga0495619_0020586 3300053085 Bacteria 4204
587 Ga0495619_0271023 3300053085 Bacteria 1176
588 Ga0500644_0118637 3300053088 Bacteria 1028
589 Ga0466962_0000236 3300061719 Bacteria 23080
590 Ga0466962_0002952 3300061719 Bacteria 8115
591 Ga0466962_0010331 3300061719 Bacteria 4484
592 Ga0466962_0092923 3300061719 Bacteria 1446
593 2776371006 2775506925 Bacteria 7237746
594 2795784704 2795385470 Bacteria 8317180
595 2856748175 2856741275 Bacteria 8096094
596 2863068575 2863067949 Bacteria 8541735
597 2866615370 2866612099 Bacteria 7543886
598 2891397348 2891395885 Bacteria 9251614
599 2891557083 2891554331 Bacteria 8812224
600 2891568967 2891562705 Bacteria 8039471
601 2899362843 2899359706 Bacteria 10940472
602 2899371443 2899370129 Bacteria 6781179
603 2917737073 2917736166 Bacteria 9690793
604 2935394040 2935390628 Bacteria 7043367
605 2984577166 2984576629 Bacteria 4248407
606 2990260487 2990256926 Bacteria 4252839
607 3002999010 3002998708 Bacteria 11715108
608 8003320146 8003314358 Bacteria 10575343
609 8025481876 8025478263 Bacteria 8209203
610 8056215663 8056207758 Bacteria 8639239
611 Ga0207671_10247262
612 JGI24752J21851_1006635
613 JGI24745J21846_1018052
614 JGI24033J26618_1020287
615 JGI24751J29686_10043488
616 Ga0058859_11299901
617 Ga0070658_10050435
618 Ga0070658_10143083
619 Ga0070676_10194569
620 Ga0070683_100011300
621 Ga0070683_100402431
622 Ga0070683_100426902
623 Ga0070690_100299359
624 Ga0070670_100062081
625 Ga0068869_100047199
626 Ga0068869_100055639
627 Ga0070666_10003675
628 Ga0070666_10149455
629 Ga0070666_10299881
630 Ga0070680_100018400
631 Ga0070680_100137353
632 Ga0070682_100015721
633 Ga0070682_100017220
634 Ga0068868_100007882
635 Ga0068868_100021035
636 Ga0070691_10020865
637 Ga0070691_10089915
638 Ga0070687_100045873
639 Ga0070661_100572888
640 Ga0070692_10005913
641 Ga0070692_10024403
642 Ga0070692_10176163
643 Ga0070668_100000709
644 Ga0070668_100006792
645 Ga0070668_100211992
646 Ga0070668_100634672
647 Ga0070669_100180739
648 Ga0070671_100036207
649 Ga0070671_100246165
650 Ga0070673_100234333
651 Ga0070688_100098775
652 Ga0070659_100097039
653 Ga0070667_100018295
654 Ga0070667_100194731
655 Ga0070703_10109292
656 Ga0070709_10071888
657 Ga0070709_10304547
658 Ga0070714_100000008
659 Ga0070714_100039704
660 Ga0070714_100082612
661 Ga0070714_100117384
662 Ga0070714_100153211
663 Ga0070714_100552206
664 Ga0070714_101109347
665 Ga0070713_100007612
666 Ga0070713_100550315
667 Ga0070713_100577778
668 Ga0070710_10177146
669 Ga0070701_10033780
670 Ga0070705_100087720
671 Ga0070700_100022021
672 Ga0070700_100149886
673 Ga0070700_100219031
674 Ga0070694_100208464
675 Ga0070663_100002192
676 Ga0070663_100020823
677 Ga0070663_100048455
678 Ga0070663_100540398
679 Ga0070678_100035653
680 Ga0070678_100378286
681 Ga0070681_10077051
682 Ga0070681_10363345
683 Ga0070681_10459052
684 Ga0070685_10011821
685 Ga0070707_100173129
686 Ga0070707_100223832
687 Ga0070698_100045876
688 Ga0070679_100048935
689 Ga0070679_100094593
690 Ga0070679_100119142
691 Ga0070679_100282260
692 Ga0070679_100630254
693 Ga0070684_100690108
694 Ga0070697_100250035
695 Ga0068853_100027178
696 Ga0068853_100226806
697 Ga0070686_100105131
698 Ga0070696_100133554
699 Ga0070696_100227537
700 Ga0070693_100009183
701 Ga0070693_100014611
702 Ga0070665_100006527
703 Ga0070665_100211169
704 Ga0070665_100335691
705 Ga0070665_100764243
706 Ga0068855_100004156
707 Ga0068855_100006398
708 Ga0068855_100050060
709 Ga0068855_100054218
710 Ga0070664_100117117
711 Ga0068857_100493015
712 Ga0068854_100349125
713 Ga0068856_100004627
714 Ga0068856_100048883
715 Ga0068856_100239346
716 Ga0068856_100418130
717 Ga0070702_100006479
718 Ga0070702_100013136
719 Ga0068852_100022379
720 Ga0068852_100520693
721 Ga0068859_100031262
722 Ga0068859_100034525
723 Ga0068859_100095834
724 Ga0068864_100019855
725 Ga0068866_10059893
726 Ga0068861_100051457
727 Ga0068851_10027386
728 Ga0068870_10009335
729 Ga0068863_100000271
730 Ga0068863_100025529
731 Ga0068863_100048872
732 Ga0068858_100002463
733 Ga0068858_100245423
734 Ga0068860_100000017
735 Ga0068860_100177775
736 Ga0068860_100226184
737 Ga0081455_10009106
738 Ga0081540_1008537
739 Ga0081540_1060922
740 Ga0070717_10013277
741 Ga0070717_10310339
742 Ga0070717_10945080
743 Ga0070716_100149970
744 Ga0070712_100028490
745 Ga0070712_100304131
746 Ga0097621_100021386
747 Ga0097621_100038436
748 Ga0097621_100664638
749 Ga0068871_100027570
750 Ga0068871_100511724
751 Ga0075428_100043829
752 Ga0075433_10009465
753 Ga0075433_10122796
754 Ga0075434_100003664
755 Ga0075434_100078732
756 Ga0075429_100051549
757 Ga0068865_100521766
758 Ga0075436_100001371
759 Ga0075436_100032981
760 Ga0097620_100031262
761 Ga0097620_100034525
762 Ga0097620_100095822
763 Ga0075435_100011416
764 Ga0105240_10123319
765 Ga0105240_10396811
766 Ga0105240_10399796
767 Ga0111539_10223992
768 Ga0105245_10616411
769 Ga0105247_10005745
770 Ga0105247_10019614
771 Ga0105247_10053689
772 Ga0114129_10084092
773 Ga0105243_10239339
774 Ga0105241_10016063
775 Ga0105241_10078713
776 Ga0105241_10085663
777 Ga0105242_10016670
778 Ga0105248_10047322
779 Ga0105248_10076796
780 Ga0105237_10043397
781 Ga0105237_10065764
782 Ga0105237_10113030
783 Ga0105238_10118105
784 Ga0105249_10010204
785 Ga0105249_10065191
786 Ga0105239_10470788
787 Ga0105246_10000627
788 Ga0105246_10015928
789 Ga0105246_10805339
790 Ga0157373_10033840
791 Ga0157371_10040264
792 Ga0157370_10060968
793 Ga0157370_10236716
794 Ga0157370_10280370
795 Ga0157369_10082229
796 Ga0157369_10118358
797 Ga0157369_10168017
798 Ga0157369_10547835
799 Ga0157369_10572267
800 Ga0157369_11475144
801 Ga0157374_10054615
802 Ga0157374_10117982
803 Ga0157378_10087437
804 Ga0163162_10268371
805 Ga0163162_10406811
806 Ga0157372_10000195
807 Ga0157372_10176070
808 Ga0157375_10245669
809 Ga0157375_10561070
810 Ga0157380_10091161
811 Ga0157380_10302849
812 Ga0157377_10111344
813 Ga0157379_10036181
814 Ga0157379_10437336
815 Ga0157376_10137247
816 Ga0163161_10020266
817 Ga0163161_10578132
818 Ga0197907_10306656
819 Ga0197907_10659117
820 Ga0206356_11870013
821 Ga0206349_1891324
822 Ga0206351_10964695
823 Ga0206350_10785953
824 Ga0206354_10876564
825 Ga0206354_11531443
826 Ga0206353_11559299
827 Ga0154015_1048981
828 Ga0154015_1153432
829 Ga0154015_1349502
830 Ga0213875_10324568
831 Ga0224712_10021381
832 Ga0224712_10077861
833 Ga0207656_10041489
834 Ga0207692_10002822
835 Ga0207692_10079576
836 Ga0207692_10139016
837 Ga0207642_10020156
838 Ga0207710_10002941
839 Ga0207710_10068859
840 Ga0207710_10136959
841 Ga0207688_10023762
842 Ga0207680_10009015
843 Ga0207680_10166689
844 Ga0207680_10222138
845 Ga0207647_10047030
846 Ga0207647_10061539
847 Ga0207647_10086412
848 Ga0207647_10162531
849 Ga0207647_10176266
850 Ga0207647_10305773
851 Ga0207643_10000112
852 Ga0207643_10063978
853 Ga0207705_10012218
854 Ga0207705_10014292
855 Ga0207705_10079647
856 Ga0207654_10007758
857 Ga0207654_10055233
858 Ga0207654_10058026
859 Ga0207707_10010656
860 Ga0207707_10109458
861 Ga0207707_10632295
862 Ga0207695_10202644
863 Ga0207671_10354987
864 Ga0207693_10002350
865 Ga0207693_10014527
866 Ga0207693_10160333
867 Ga0207663_10043275
868 Ga0207660_10284347
869 Ga0207662_10016611
870 Ga0207657_10005281
871 Ga0207657_10027799
872 Ga0207649_10220442
873 Ga0207649_10471982
874 Ga0207652_10013348
875 Ga0207652_10013580
876 Ga0207652_10086028
877 Ga0207652_10486063
878 Ga0207646_10124495
879 Ga0207650_10007760
880 Ga0207687_10075547
881 Ga0207687_10401893
882 Ga0207700_10006552
883 Ga0207700_10076548
884 Ga0207700_10085981
885 Ga0207700_10209815
886 Ga0207700_10678328
887 Ga0207664_10000002
888 Ga0207664_10093066
889 Ga0207664_10390327
890 Ga0207644_10154062
891 Ga0207690_10122055
892 Ga0207670_10076598
893 Ga0207665_10003116
894 Ga0207665_10040554
895 Ga0207711_10040716
896 Ga0207711_10057283
897 Ga0207689_10000391
898 Ga0207689_10040980
899 Ga0207689_10444340
900 Ga0207661_10003751
901 Ga0207661_10269812
902 Ga0207661_10378426
903 Ga0207679_10024195
904 Ga0207667_10057832
905 Ga0207667_10071316
906 Ga0207651_10035829
907 Ga0207712_10576765
908 Ga0207668_10009581
909 Ga0207668_10030636
910 Ga0207668_10054577
911 Ga0207668_10160602
912 Ga0207668_10243389
913 Ga0207640_10066924
914 Ga0207640_10124395
915 Ga0207658_10041867
916 Ga0207677_10005321
917 Ga0207677_10146164
918 Ga0207703_10010385
919 Ga0207703_10331435
920 Ga0207639_10283241
921 Ga0207639_10583618
922 Ga0207678_10001184
923 Ga0207678_10003683
924 Ga0207708_10005926
925 Ga0207708_10185122
926 Ga0207708_10295905
927 Ga0207702_10004634
928 Ga0207702_10005265
929 Ga0207702_10058820
930 Ga0207641_10006406
931 Ga0207641_10155163
932 Ga0207676_10003384
933 Ga0207676_10171189
934 Ga0207674_10014768
935 Ga0207674_10116721
936 Ga0207674_10223566
937 Ga0207675_100002341
938 Ga0207675_100071860
939 Ga0207683_10000967
940 Ga0207683_10009886
941 Ga0207698_10011342
942 Ga0207698_10031920
943 Ga0207698_10108520
944 Ga0207428_10021543
945 Ga0265354_1011186
946 Ga0268266_10003027
947 Ga0268266_10098010
948 Ga0268266_10166786
949 Ga0268265_10506428
950 Ga0268265_11389365
951 Ga0268264_10000033
952 Ga0268264_10021790
953 Ga0265337_1081692
954 Ga0265319_1004253
955 Ga0265334_10003003
956 Ga0265318_10009714
957 Ga0265323_10060420
958 Ga0265322_10069782
959 Ga0265336_10016956
960 Ga0307515_10195685
961 Ga0265338_10000059
962 Ga0265338_10007182
963 Ga0265338_10104881
964 Ga0265324_10000821
965 Ga0307512_10167430
966 Ga0265770_1002461
967 Ga0265332_10004728
968 Ga0265320_10006149
969 Ga0265340_10006340
970 Ga0265339_10033917
971 Ga0265316_10013649
972 Ga0307509_10080879
973 Ga0265313_10068905
974 Ga0307508_10169663
975 Ga0265314_10014727
976 Ga0265342_10001214
977 Ga0307518_10019259
978 Ga0326468_10003200
979 Ga0307416_100509625
980 Ga0307415_100106591
981 Ga0307507_10064045
982 Ga0307510_10062042
983 Ga0316215_1013242
984 Ga0316212_1001600
985 Ga0316216_1001204
986 Ga0373948_0034647
987 Ga0373958_0022922
988 Ga0373959_0021524
989 Ga0373934_0020633
990 Ga0373940_0023737
991 Ga0373923_0047567
992 Ga0373936_0102928
993 Ga0373953_0125381
994 Ga0373954_0142962
995 Ga0373956_0013322
996 Ga0373957_0038263
997 Ga0373960_0001892
998 Ga0373943_0236642
999 Ga0373955_0019144
1000 Ga0373962_0003077
1001 Ga0373924_0022427
1002 Ga0373931_0317718
1003 Ga0373935_0061610
1004 Ga0373927_0055598
1005 Ga0373933_0042452
1006 Ga0373947_0370821
1007 Ga0373937_0212053
1008 Ga0373925_0000779
1009 Ga0395898_0927519
1010 Ga0395898_0946201
1011 Ga0436364_0905203
1012 Ga0436364_1071383
1013 Ga0436364_1130976
1014 Ga0400485_18159
1015 Ga0400487_41166
1016 Ga0439463_009676
1017 Ga0439459_0018353
1018 Ga0466969_0010688
1019 Ga0466969_0162266
1020 Ga0466972_0010234
1021 Ga0466972_0020008
1022 Ga0466972_0132933
1023 Ga0466965_0027264
1024 Ga0466965_0081520
1025 Ga0466965_0174184
1026 Ga0466966_0005150
1027 Ga0466966_0076800
1028 Ga0466966_0398574
1029 Ga0466966_0442713
1030 Ga0466966_0493877
1031 Ga0466961_0003526
1032 Ga0466961_0003853
1033 Ga0466961_0064545
1034 Ga0466961_0073013
1035 Ga0466961_0246331
1036 Ga0466963_0014301
1037 Ga0466963_0016872
1038 Ga0466963_0064303
1039 Ga0466963_0073001
1040 Ga0466963_0460655
1041 Ga0466963_0693690
1042 Ga0466964_0013600
1043 Ga0466971_0001159
1044 Ga0466971_0021547
1045 Ga0466968_0077816
1046 Ga0466968_0204876
1047 Ga0466968_0224506
1048 Ga0466970_0032284
1049 Ga0466970_0048779
1050 Ga0466970_0134360
1051 Ga0466957_0049449
1052 Ga0466957_0074332
1053 Ga0466957_0208321
1054 Ga0466957_0714061
1055 Ga0466960_0009298
1056 Ga0466960_0014141
1057 Ga0466960_0058967
1058 Ga0466960_0099880
1059 Ga0466959_0004974
1060 Ga0466959_0047349
1061 Ga0466959_0055195
1062 Ga0466959_0088813
1063 Ga0466959_0214055
1064 Ga0466959_0236918
1065 Ga0466959_0261481
1066 Ga0466959_0304136
1067 Ga0466958_0010218
1068 Ga0466958_0016550
1069 Ga0466958_0021656
1070 Ga0466958_0052101
1071 Ga0466958_0113605
1072 Ga0466958_0153163
1073 Ga0466967_0005135
1074 Ga0466967_0005774
1075 Ga0466967_0014140
1076 Ga0466967_0031717
1077 Ga0466967_0076666
1078 Ga0466967_0158178
1079 Ga0466967_0286051
1080 Ga0466967_0287783
1081 Ga0466967_0293261
1082 Ga0466967_0658220
1083 Ga0466967_0689236
1084 Ga0466967_1101487
1085 Ga0495592_0241733
1086 Ga0495651_0090276
1087 Ga0495653_0027656
1088 Ga0495664_0257317
1089 Ga0495608_0015764
1090 Ga0495618_0003595
1091 Ga0495618_0194130
1092 Ga0495628_0011707
1093 Ga0495628_0026687
1094 Ga0495630_0339864
1095 Ga0495652_0005750
1096 Ga0495652_0093500
1097 Ga0495640_0084691
1098 Ga0495587_0027889
1099 Ga0495645_0282667
1100 Ga0495667_0059406
1101 Ga0495634_0042353
1102 Ga0495634_0265686
1103 Ga0495635_0001181
1104 Ga0495635_0060671
1105 Ga0495657_0028145
1106 Ga0495599_0047392
1107 Ga0495623_0012260
1108 Ga0495646_0035322
1109 Ga0495646_0088462
1110 Ga0495613_0180275
1111 Ga0495624_0297146
1112 Ga0495600_0089526
1113 Ga0495600_0425778
1114 Ga0495604_0156086
1115 Ga0495674_0063601
1116 Ga0495680_0130457
1117 Ga0495675_0189144
1118 Ga0495684_0032643
1119 Ga0495602_0074941
1120 Ga0495602_0161890
1121 Ga0496100_0048048
1122 Ga0496101_0091317
1123 Ga0496102_0000142
1124 Ga0496102_0001260
1125 Ga0496102_0003886
1126 Ga0496102_0019734
1127 Ga0496102_0053624
1128 Ga0496102_0448216
1129 Ga0496103_0000085
1130 Ga0496103_0006950
1131 Ga0496103_0065420
1132 Ga0496104_0015528
1133 Ga0496104_0141015
1134 Ga0496104_0145949
1135 Ga0496105_0118439
1136 Ga0496105_0123581
1137 Ga0496106_0165879
1138 Ga0496107_0111358
1139 Ga0496108_0026525
1140 Ga0496108_0036728
1141 Ga0496108_0148588
1142 Ga0496109_0004796
1143 Ga0496109_0011456
1144 Ga0496109_0023781
1145 Ga0496109_0342758
1146 Ga0496110_0046735
1147 Ga0496110_0069269
1148 Ga0496111_0002010
1149 Ga0496111_0071677
1150 Ga0496111_0458310
1151 Ga0496112_0030585
1152 Ga0496112_0034462
1153 Ga0496113_0009443
1154 Ga0496113_0044443
1155 Ga0496113_0059868
1156 Ga0496114_0021637
1157 Ga0496114_0128470
1158 Ga0496114_0278211
1159 Ga0496115_0019552
1160 Ga0496115_0226024
1161 Ga0496115_0233754
1162 Ga0496118_0030245
1163 Ga0496119_0009361
1164 Ga0496121_0017747
1165 Ga0496126_0014015
1166 Ga0496126_0025703
1167 Ga0501032_0039938
1168 Ga0501036_0020752
1169 Ga0501037_0056471
1170 Ga0501038_0060252
1171 Ga0501039_0644702
1172 Ga0501046_0353627
1173 Ga0501047_0045861
1174 Ga0501048_0000234
1175 Ga0501069_0537103
1176 Ga0501070_0075127
1177 Ga0501079_0283020
1178 Ga0501035_0005970
1179 Ga0501035_0608094
1180 Ga0501044_0008121
1181 Ga0501044_0138910
1182 nmdc:mga05p37_236187_c1
1183 nmdc:mga08y16_1185367_c1
1184 nmdc:mga08y16_23265_c1
1185 nmdc:mga0n895_100144_c1
1186 nmdc:mga0n895_35445_c1
1187 nmdc:mga0rr50_12682_c1
1188 nmdc:mga0rr50_17482_c1
1189 nmdc:mga08x19_418019_c1
1190 nmdc:mga08x19_82008_c1
1191 nmdc:mga0a205_10382_c1
1192 nmdc:mga0a205_19121_c1
1193 Ga0495601_0041948
1194 Ga0495601_0346958
1195 Ga0495612_0004957
1196 Ga0495619_0020586
1197 Ga0495619_0271023
1198 Ga0500644_0118637
1199 Ga0466962_0000236
1200 Ga0466962_0002952
1201 Ga0466962_0010331
1202 Ga0466962_0092923
1203 2776371006
1204 2795784704
1205 2856748175
1206 2863068575
1207 2866615370
1208 2891397348
1209 2891557083
1210 2891568967
1211 2899362843
1212 2899371443
1213 2917737073
1214 2935394040
1215 2984577166
1216 2990260487
1217 3002999010
1218 8003320146
1219 8025481876
1220 8056215663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

20

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9571 6 201
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9453 4 205
4nxi-assembly1.cif.gz_B rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.941 4 201
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9372 6 201
4nxi-assembly1.cif.gz_B rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.9364 4 201
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9571 6 201 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9372 6 201 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8467 7 197 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8229 7 197 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7816 4 41 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0Q7R068-F1-model_v4 Disulfide bond formation protein DsbA 0.9863 5 202
AF-A0A838G2A1-F1-model_v4 Disulfide bond formation protein DsbA 0.9861 4 144
AF-A0A2P4URS2-F1-model_v4 DSBA-like thioredoxin domain protein 0.9837 3 202
AF-A0A846X0F9-F1-model_v4 DsbA family protein 0.983 4 203
AF-A0A7W0XW83-F1-model_v4 Disulfide bond formation protein DsbA 0.983 3 163

Map