F468965

General Info

Members Datasets Scaffolds Average Seq Length
610 260 608 315

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10322425|Ga0105242_103224251
Length 331
Sequence MNTQPISSEPLPVPASVAGTSAAKSPAEIIPHPNPPSAARLSQMAXXXXPPASRLSGYLAELPDRLRSVATTVLPTIVTLCALLIVWQFICGGEGSSLPSPLKIWTESHDLIVHPFKGVSLDFGGLHIAEGGDVGIAGHIIASLKRVAMGYGLAAIAGIALGILIGQSVIAYRALDPLFQVLRTIPPLAWLPISLAIFQQAGPSTVFLIFITAIWPVILNTAAGVQAMPPTYRNVARVLALRPTTYFFRIMLPATVPYMFTGLRISVGMSWLAIVAAEMVQGGAGIGFFIWDSYNSSLLTDTIVALVWIGMVGFTLDRLVAWIGRRIAHQA

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
217 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
218 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
219 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
220 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
223 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
224 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
225 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
226 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
232 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
235 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
236 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
237 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
238 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
239 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
240 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0
Rhizoplane 4.26
Rhizosphere 87.38
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000015 3300001904 Bacteria 28999
2 JGI24736J21556_1000376 3300001904 Bacteria 8442
3 JGI24741J21665_1000325 3300001915 Bacteria 14260
4 JGI24752J21851_1000049 3300001976 Bacteria 14646
5 JGI24752J21851_1000292 3300001976 Bacteria 7003
6 JGI24740J21852_10000356 3300001979 Bacteria 19617
7 JGI24740J21852_10013955 3300001979 Bacteria 2978
8 JGI24740J21852_10037279 3300001979 Bacteria 1502
9 JGI24739J22299_10002707 3300001989 Bacteria 6820
10 JGI24739J22299_10017157 3300001989 Bacteria 2615
11 JGI24739J22299_10036742 3300001989 Bacteria 1653
12 JGI24737J22298_10001009 3300001990 Bacteria 9974
13 JGI24737J22298_10001181 3300001990 Bacteria 9201
14 JGI24737J22298_10002130 3300001990 Bacteria 7052
15 JGI24737J22298_10005404 3300001990 Bacteria 4415
16 JGI24737J22298_10019798 3300001990 Bacteria 2152
17 JGI24735J21928_10005899 3300002067 Bacteria 4049
18 JGI24735J21928_10010376 3300002067 Bacteria 2973
19 JGI24750J21931_1000468 3300002070 Bacteria 6462
20 JGI24748J21848_1000023 3300002074 Bacteria 106523
21 JGI24738J21930_10000327 3300002075 Bacteria 13102
22 JGI24738J21930_10003551 3300002075 Bacteria 3913
23 JGI24749J21850_1000033 3300002076 Bacteria 25902
24 JGI24749J21850_1003108 3300002076 Bacteria 2317
25 JGI24744J21845_10022409 3300002077 Bacteria 1241
26 JGI24034J26672_10000010 3300002239 Bacteria 150746
27 JGI24034J26672_10019022 3300002239 Bacteria 1069
28 JGI24742J22300_10000379 3300002244 Bacteria 6560
29 JGI24751J29686_10000046 3300002459 Bacteria 73259
30 rootH1_10040862 3300003323 Bacteria 5300
31 Ga0055542_1001654 3300003762 Bacteria 9990
32 Ga0065704_10074031 3300005289 Bacteria 6587
33 Ga0065704_10084088 3300005289 Bacteria 3373
34 Ga0065707_10000756 3300005295 Bacteria 21029
35 Ga0065707_10084013 3300005295 Bacteria 7823
36 Ga0070658_10003723 3300005327 Bacteria 12473
37 Ga0070676_10005501 3300005328 Bacteria 6745
38 Ga0070690_100000055 3300005330 Bacteria 55023
39 Ga0070670_100000006 3300005331 Bacteria 319420
40 Ga0070670_100003689 3300005331 Bacteria 12758
41 Ga0070670_100014302 3300005331 Bacteria 6809
42 Ga0070670_100019603 3300005331 Bacteria 5806
43 Ga0070670_100068597 3300005331 Bacteria 3043
44 Ga0070670_100250667 3300005331 Bacteria 1542
45 Ga0068869_100000031 3300005334 Bacteria 60884
46 Ga0070666_10000009 3300005335 Bacteria 279209
47 Ga0070666_10004989 3300005335 Bacteria 8118
48 Ga0070666_10061827 3300005335 Bacteria 2536
49 Ga0070666_10092046 3300005335 Bacteria 2084
50 Ga0070666_10095505 3300005335 Bacteria 2046
51 Ga0068868_100000060 3300005338 Bacteria 61952
52 Ga0070660_100225084 3300005339 Bacteria 1525
53 Ga0070689_100124649 3300005340 Bacteria 2060
54 Ga0070661_100081195 3300005344 Bacteria 2393
55 Ga0070661_100141800 3300005344 Bacteria 1811
56 Ga0070668_100000026 3300005347 Bacteria 92584
57 Ga0070668_100000815 3300005347 Bacteria 21478
58 Ga0070668_100039604 3300005347 Bacteria 3603
59 Ga0070668_100109352 3300005347 Bacteria 2199
60 Ga0070668_100214518 3300005347 Bacteria 1585
61 Ga0070668_100254690 3300005347 Bacteria 1458
62 Ga0070669_100000017 3300005353 Bacteria 195995
63 Ga0070669_100000102 3300005353 Bacteria 82010
64 Ga0070669_100001143 3300005353 Bacteria 19370
65 Ga0070669_100006890 3300005353 Bacteria 8166
66 Ga0070669_100204575 3300005353 Bacteria 1555
67 Ga0070675_100014931 3300005354 Bacteria 6133
68 Ga0070671_100000034 3300005355 Bacteria 101038
69 Ga0070671_100000040 3300005355 Bacteria 92357
70 Ga0070671_100000470 3300005355 Bacteria 28105
71 Ga0070671_100001027 3300005355 Bacteria 20510
72 Ga0070671_100008047 3300005355 Bacteria 8440
73 Ga0070671_100030576 3300005355 Bacteria 4444
74 Ga0070671_100096957 3300005355 Bacteria 2473
75 Ga0070674_100011647 3300005356 Bacteria 5361
76 Ga0070674_100074716 3300005356 Bacteria 2406
77 Ga0070674_100215238 3300005356 Bacteria 1492
78 Ga0070673_100000009 3300005364 Bacteria 155005
79 Ga0070688_100001642 3300005365 Bacteria 11198
80 Ga0070659_100009830 3300005366 Bacteria 7034
81 Ga0070659_100261767 3300005366 Bacteria 1435
82 Ga0070659_100377530 3300005366 Bacteria 1193
83 Ga0070667_100000019 3300005367 Bacteria 224710
84 Ga0070667_100000076 3300005367 Bacteria 120555
85 Ga0070667_100000692 3300005367 Bacteria 32510
86 Ga0070667_100003424 3300005367 Bacteria 13510
87 Ga0070667_100005285 3300005367 Bacteria 10792
88 Ga0070667_100005856 3300005367 Bacteria 10257
89 Ga0070667_100016118 3300005367 Bacteria 6182
90 Ga0070705_100012769 3300005440 Bacteria 4280
91 Ga0070708_100259127 3300005445 Bacteria 1635
92 Ga0070663_100004783 3300005455 Bacteria 7986
93 Ga0070663_100007749 3300005455 Bacteria 6558
94 Ga0070663_100128828 3300005455 Bacteria 1919
95 Ga0070662_100008232 3300005457 Bacteria 6790
96 Ga0070662_100024596 3300005457 Bacteria 4151
97 Ga0070662_100026537 3300005457 Bacteria 4013
98 Ga0070662_100044512 3300005457 Bacteria 3180
99 Ga0070662_100070971 3300005457 Bacteria 2567
100 Ga0070662_100072153 3300005457 Bacteria 2548
101 Ga0070662_100280455 3300005457 Bacteria 1348
102 Ga0068867_100000002 3300005459 Bacteria 247206
103 Ga0070685_10080002 3300005466 Bacteria 1957
104 Ga0068853_100004448 3300005539 Bacteria 10860
105 Ga0068853_100014991 3300005539 Bacteria 6368
106 Ga0068853_100017709 3300005539 Bacteria 5879
107 Ga0068853_100273547 3300005539 Bacteria 1556
108 Ga0070672_100025226 3300005543 Bacteria 4407
109 Ga0070686_100000041 3300005544 Bacteria 104174
110 Ga0070686_100104625 3300005544 Bacteria 1918
111 Ga0070665_100000368 3300005548 Bacteria 67541
112 Ga0070665_100049328 3300005548 Bacteria 4224
113 Ga0070665_100142939 3300005548 Bacteria 2396
114 Ga0070665_100327622 3300005548 Bacteria 1536
115 Ga0070665_100404532 3300005548 Bacteria 1373
116 Ga0068855_100001164 3300005563 Bacteria 32603
117 Ga0068855_100005469 3300005563 Bacteria 15499
118 Ga0068855_100145237 3300005563 Bacteria 2701
119 Ga0068855_100160958 3300005563 Bacteria 2548
120 Ga0070664_100009350 3300005564 Bacteria 7946
121 Ga0068857_100005402 3300005577 Bacteria 10893
122 Ga0068857_100010757 3300005577 Bacteria 7963
123 Ga0068854_100003204 3300005578 Bacteria 10212
124 Ga0068854_100037700 3300005578 Bacteria 3394
125 Ga0068856_100009439 3300005614 Bacteria 9474
126 Ga0068856_100160218 3300005614 Bacteria 2260
127 Ga0068852_100001541 3300005616 Bacteria 15633
128 Ga0068852_100212228 3300005616 Bacteria 1837
129 Ga0068859_100001942 3300005617 Bacteria 21088
130 Ga0068859_100018363 3300005617 Bacteria 7030
131 Ga0068859_100060919 3300005617 Bacteria 3802
132 Ga0068859_100080679 3300005617 Bacteria 3295
133 Ga0068859_100086954 3300005617 Bacteria 3173
134 Ga0068859_100201774 3300005617 Bacteria 2073
135 Ga0068859_100234921 3300005617 Bacteria 1922
136 Ga0068864_100000014 3300005618 Bacteria 308927
137 Ga0068864_100000218 3300005618 Bacteria 51909
138 Ga0068864_100003451 3300005618 Bacteria 13065
139 Ga0068864_100004287 3300005618 Bacteria 11726
140 Ga0068864_100039341 3300005618 Bacteria 4042
141 Ga0068864_100049025 3300005618 Bacteria 3632
142 Ga0068864_100053745 3300005618 Bacteria 3475
143 Ga0068861_100000007 3300005719 Bacteria 86469
144 Ga0068861_100000441 3300005719 Bacteria 24079
145 Ga0068861_100003012 3300005719 Bacteria 11118
146 Ga0068861_100061595 3300005719 Bacteria 2880
147 Ga0068851_10062517 3300005834 Bacteria 1910
148 Ga0068863_100000006 3300005841 Bacteria 265379
149 Ga0068863_100000131 3300005841 Bacteria 79059
150 Ga0068863_100000705 3300005841 Bacteria 33651
151 Ga0068863_100003894 3300005841 Bacteria 14746
152 Ga0068863_100005111 3300005841 Bacteria 12936
153 Ga0068863_100005275 3300005841 Bacteria 12758
154 Ga0068863_100006871 3300005841 Bacteria 11152
155 Ga0068863_100063552 3300005841 Bacteria 3491
156 Ga0068863_100100122 3300005841 Bacteria 2754
157 Ga0068863_100146767 3300005841 Bacteria 2256
158 Ga0068858_100000352 3300005842 Bacteria 48455
159 Ga0068858_100000637 3300005842 Bacteria 36537
160 Ga0068858_100003305 3300005842 Bacteria 16053
161 Ga0068858_100006275 3300005842 Bacteria 11582
162 Ga0068858_100006825 3300005842 Bacteria 11106
163 Ga0068858_100015300 3300005842 Bacteria 7218
164 Ga0068858_100400496 3300005842 Bacteria 1319
165 Ga0068860_100000022 3300005843 Bacteria 279209
166 Ga0068860_100000036 3300005843 Bacteria 234917
167 Ga0068860_100000119 3300005843 Bacteria 127040
168 Ga0068860_100000131 3300005843 Bacteria 121109
169 Ga0068860_100013681 3300005843 Bacteria 7955
170 Ga0068860_100092971 3300005843 Bacteria 2874
171 Ga0068862_100000007 3300005844 Bacteria 313933
172 Ga0068862_100000596 3300005844 Bacteria 37603
173 Ga0068862_100003863 3300005844 Bacteria 12758
174 Ga0068862_100008677 3300005844 Bacteria 8407
175 Ga0068862_100009271 3300005844 Bacteria 8146
176 Ga0068862_100192460 3300005844 Bacteria 1836
177 Ga0081455_10000131 3300005937 Bacteria 87553
178 Ga0097621_100001876 3300006237 Bacteria 14391
179 Ga0075370_10012882 3300006353 Bacteria 4430
180 Ga0068871_100062791 3300006358 Bacteria 3037
181 Ga0075430_100036204 3300006846 Bacteria 4185
182 Ga0068865_100000014 3300006881 Bacteria 138727
183 Ga0097620_100001942 3300006931 Bacteria 21088
184 Ga0097620_100018363 3300006931 Bacteria 7030
185 Ga0097620_100060922 3300006931 Bacteria 3802
186 Ga0097620_100080678 3300006931 Bacteria 3295
187 Ga0097620_100086955 3300006931 Bacteria 3173
188 Ga0097620_100201770 3300006931 Bacteria 2073
189 Ga0097620_100234932 3300006931 Bacteria 1922
190 Ga0105251_10002945 3300009011 Bacteria 12764
191 Ga0105251_10020882 3300009011 Bacteria 3432
192 Ga0105240_10097192 3300009093 Bacteria 3589
193 Ga0105245_10000160 3300009098 Bacteria 63445
194 Ga0105245_10000357 3300009098 Bacteria 42661
195 Ga0105247_10002517 3300009101 Bacteria 12450
196 Ga0105247_10004689 3300009101 Bacteria 8710
197 Ga0114129_10096454 3300009147 Bacteria 4094
198 Ga0105243_10000070 3300009148 Bacteria 120851
199 Ga0105243_10043313 3300009148 Bacteria 3527
200 Ga0105241_10002084 3300009174 Bacteria 15106
201 Ga0105241_10305683 3300009174 Bacteria 1366
202 Ga0105242_10001604 3300009176 Bacteria 17808
203 Ga0105242_10322425 3300009176 Bacteria 1417
204 Ga0105248_10000026 3300009177 Bacteria 257155
205 Ga0105248_10000139 3300009177 Bacteria 84082
206 Ga0105248_10000723 3300009177 Bacteria 37295
207 Ga0105248_10003764 3300009177 Bacteria 16798
208 Ga0105248_10017214 3300009177 Bacteria 7963
209 Ga0105248_10098411 3300009177 Bacteria 3296
210 Ga0105248_10438920 3300009177 Bacteria 1471
211 Ga0105237_10132101 3300009545 Bacteria 2491
212 Ga0105237_10194246 3300009545 Bacteria 2029
213 Ga0105237_10194254 3300009545 Bacteria 2029
214 Ga0105238_10100915 3300009551 Bacteria 2869
215 Ga0105238_10197562 3300009551 Bacteria 1987
216 Ga0105249_10000123 3300009553 Bacteria 104747
217 Ga0105249_10015328 3300009553 Bacteria 6783
218 Ga0105249_10351388 3300009553 Bacteria 1494
219 Ga0105239_10083094 3300010375 Bacteria 3526
220 Ga0105239_10084115 3300010375 Bacteria 3504
221 Ga0105239_10780243 3300010375 Bacteria 1094
222 Ga0105246_10003501 3300011119 Bacteria 9510
223 Ga0105246_10034604 3300011119 Bacteria 3368
224 Ga0105246_10159649 3300011119 Bacteria 1716
225 Ga0157373_10025286 3300013100 Bacteria 4296
226 Ga0157373_10029633 3300013100 Bacteria 3941
227 Ga0157371_10124823 3300013102 Bacteria 1831
228 Ga0157370_10130541 3300013104 Bacteria 2344
229 Ga0157374_10000542 3300013296 Bacteria 33699
230 Ga0157378_10000624 3300013297 Bacteria 33307
231 Ga0157378_10048869 3300013297 Bacteria 3762
232 Ga0163162_10008224 3300013306 Bacteria 10181
233 Ga0163162_10015641 3300013306 Bacteria 7415
234 Ga0163162_10132289 3300013306 Bacteria 2604
235 Ga0163162_10685138 3300013306 Bacteria 1147
236 Ga0157372_10110927 3300013307 Bacteria 3142
237 Ga0157372_10183836 3300013307 Bacteria 2420
238 Ga0157372_10404699 3300013307 Bacteria 1590
239 Ga0157372_10562976 3300013307 Bacteria 1328
240 Ga0157375_10031485 3300013308 Bacteria 5015
241 Ga0163163_10012217 3300014325 Bacteria 7817
242 Ga0163163_10013315 3300014325 Bacteria 7526
243 Ga0163163_10028778 3300014325 Bacteria 5340
244 Ga0163163_10301473 3300014325 Bacteria 1655
245 Ga0157380_10000014 3300014326 Bacteria 130737
246 Ga0157380_10000063 3300014326 Bacteria 61666
247 Ga0157380_10005568 3300014326 Bacteria 8805
248 Ga0157377_10113948 3300014745 Bacteria 1629
249 Ga0157379_10010303 3300014968 Bacteria 8139
250 Ga0157379_10027676 3300014968 Bacteria 5047
251 Ga0157379_10036808 3300014968 Bacteria 4363
252 Ga0157376_10000096 3300014969 Bacteria 65482
253 Ga0163161_10000057 3300017792 Bacteria 114339
254 Ga0163161_10275590 3300017792 Bacteria 1318
255 Ga0207672_1000345 3300025223 Bacteria 6128
256 Ga0209148_1000147 3300025254 Bacteria 160231
257 Ga0207697_10002475 3300025315 Bacteria 9551
258 Ga0207697_10010476 3300025315 Bacteria 3961
259 Ga0207713_1001272 3300025735 Bacteria 20765
260 Ga0207710_10004442 3300025900 Bacteria 6124
261 Ga0207710_10047475 3300025900 Bacteria 1919
262 Ga0207680_10000007 3300025903 Bacteria 623574
263 Ga0207680_10007925 3300025903 Bacteria 5193
264 Ga0207680_10041387 3300025903 Bacteria 2688
265 Ga0207647_10005017 3300025904 Bacteria 9754
266 Ga0207647_10008523 3300025904 Bacteria 7343
267 Ga0207647_10024607 3300025904 Bacteria 3968
268 Ga0207647_10035600 3300025904 Bacteria 3171
269 Ga0207645_10008376 3300025907 Bacteria 7213
270 Ga0207705_10000042 3300025909 Bacteria 182120
271 Ga0207654_10002475 3300025911 Bacteria 9385
272 Ga0207654_10031228 3300025911 Bacteria 2932
273 Ga0207695_10004592 3300025913 Bacteria 18760
274 Ga0207671_10001130 3300025914 Bacteria 32130
275 Ga0207671_10023283 3300025914 Bacteria 4672
276 Ga0207671_10122372 3300025914 Bacteria 1989
277 Ga0207657_10013142 3300025919 Bacteria 8130
278 Ga0207657_10082983 3300025919 Bacteria 2689
279 Ga0207657_10124035 3300025919 Bacteria 2123
280 Ga0207657_10124092 3300025919 Bacteria 2122
281 Ga0207649_10049967 3300025920 Bacteria 2585
282 Ga0207681_10000001 3300025923 Bacteria 1105841
283 Ga0207681_10000008 3300025923 Bacteria 414329
284 Ga0207681_10000029 3300025923 Bacteria 177260
285 Ga0207681_10001400 3300025923 Bacteria 15582
286 Ga0207681_10034705 3300025923 Bacteria 3318
287 Ga0207681_10277872 3300025923 Bacteria 1317
288 Ga0207694_10000589 3300025924 Bacteria 32787
289 Ga0207694_10115523 3300025924 Bacteria 2138
290 Ga0207694_10169129 3300025924 Bacteria 1769
291 Ga0207650_10000023 3300025925 Bacteria 308148
292 Ga0207650_10000657 3300025925 Bacteria 27265
293 Ga0207650_10001245 3300025925 Bacteria 18514
294 Ga0207650_10015378 3300025925 Bacteria 5328
295 Ga0207650_10022933 3300025925 Bacteria 4423
296 Ga0207650_10267614 3300025925 Bacteria 1388
297 Ga0207687_10000252 3300025927 Bacteria 36302
298 Ga0207687_10000323 3300025927 Bacteria 32543
299 Ga0207644_10000005 3300025931 Bacteria 441948
300 Ga0207644_10000033 3300025931 Bacteria 132384
301 Ga0207644_10000067 3300025931 Bacteria 76116
302 Ga0207644_10000121 3300025931 Bacteria 57269
303 Ga0207644_10000468 3300025931 Bacteria 26068
304 Ga0207644_10010698 3300025931 Bacteria 6050
305 Ga0207644_10044438 3300025931 Bacteria 3156
306 Ga0207690_10085978 3300025932 Bacteria 2209
307 Ga0207690_10129207 3300025932 Bacteria 1847
308 Ga0207690_10226345 3300025932 Bacteria 1434
309 Ga0207706_10005304 3300025933 Bacteria 12019
310 Ga0207706_10022176 3300025933 Bacteria 5700
311 Ga0207706_10032956 3300025933 Bacteria 4610
312 Ga0207706_10036849 3300025933 Bacteria 4344
313 Ga0207706_10105772 3300025933 Bacteria 2476
314 Ga0207706_10139817 3300025933 Bacteria 2130
315 Ga0207686_10002334 3300025934 Bacteria 10371
316 Ga0207709_10000066 3300025935 Bacteria 189194
317 Ga0207709_10038576 3300025935 Bacteria 2846
318 Ga0207669_10175222 3300025937 Bacteria 1531
319 Ga0207704_10000002 3300025938 Bacteria 303025
320 Ga0207704_10000007 3300025938 Bacteria 211230
321 Ga0207704_10391481 3300025938 Bacteria 1094
322 Ga0207691_10022342 3300025940 Bacteria 5967
323 Ga0207711_10000004 3300025941 Bacteria 870636
324 Ga0207711_10003786 3300025941 Bacteria 13015
325 Ga0207711_10008095 3300025941 Bacteria 8800
326 Ga0207711_10014506 3300025941 Bacteria 6549
327 Ga0207711_10034550 3300025941 Bacteria 4281
328 Ga0207711_10034963 3300025941 Bacteria 4257
329 Ga0207711_10062552 3300025941 Bacteria 3210
330 Ga0207711_10108136 3300025941 Bacteria 2470
331 Ga0207711_10375462 3300025941 Bacteria 1319
332 Ga0207689_10000060 3300025942 Bacteria 85326
333 Ga0207689_10165729 3300025942 Bacteria 1821
334 Ga0207661_10260147 3300025944 Bacteria 1546
335 Ga0207667_10000017 3300025949 Bacteria 390654
336 Ga0207667_10008884 3300025949 Bacteria 11890
337 Ga0207667_10041478 3300025949 Bacteria 4894
338 Ga0207651_10000004 3300025960 Bacteria 290191
339 Ga0207712_10000004 3300025961 Bacteria 614655
340 Ga0207712_10000102 3300025961 Bacteria 96444
341 Ga0207712_10004665 3300025961 Bacteria 8661
342 Ga0207712_10007169 3300025961 Bacteria 7030
343 Ga0207712_10066820 3300025961 Bacteria 2571
344 Ga0207712_10234294 3300025961 Bacteria 1475
345 Ga0207668_10000029 3300025972 Bacteria 123784
346 Ga0207668_10000081 3300025972 Bacteria 72145
347 Ga0207668_10002224 3300025972 Bacteria 11311
348 Ga0207668_10181195 3300025972 Bacteria 1662
349 Ga0207668_10228538 3300025972 Bacteria 1498
350 Ga0207640_10000695 3300025981 Bacteria 19606
351 Ga0207640_10011693 3300025981 Bacteria 4975
352 Ga0207640_10015659 3300025981 Bacteria 4394
353 Ga0207640_10023945 3300025981 Bacteria 3677
354 Ga0207640_10045130 3300025981 Bacteria 2828
355 Ga0207658_10000002 3300025986 Bacteria 1364188
356 Ga0207658_10000094 3300025986 Bacteria 98638
357 Ga0207658_10000462 3300025986 Bacteria 38001
358 Ga0207658_10001289 3300025986 Bacteria 19824
359 Ga0207658_10002693 3300025986 Bacteria 12831
360 Ga0207658_10011568 3300025986 Bacteria 6007
361 Ga0207677_10000231 3300026023 Bacteria 43615
362 Ga0207703_10000630 3300026035 Bacteria 35501
363 Ga0207703_10001574 3300026035 Bacteria 20688
364 Ga0207703_10003457 3300026035 Bacteria 13224
365 Ga0207703_10005308 3300026035 Bacteria 10384
366 Ga0207703_10007341 3300026035 Bacteria 8760
367 Ga0207703_10042209 3300026035 Bacteria 3658
368 Ga0207703_10127394 3300026035 Bacteria 2194
369 Ga0207639_10003463 3300026041 Bacteria 10614
370 Ga0207639_10003882 3300026041 Bacteria 10075
371 Ga0207639_10004222 3300026041 Bacteria 9682
372 Ga0207639_10004903 3300026041 Bacteria 9018
373 Ga0207639_10067713 3300026041 Bacteria 2779
374 Ga0207639_10352757 3300026041 Bacteria 1314
375 Ga0207678_10000404 3300026067 Bacteria 39097
376 Ga0207678_10023713 3300026067 Bacteria 5366
377 Ga0207702_10005874 3300026078 Bacteria 10670
378 Ga0207702_10006618 3300026078 Bacteria 9969
379 Ga0207702_10055754 3300026078 Bacteria 3353
380 Ga0207702_10393948 3300026078 Bacteria 1334
381 Ga0207641_10000004 3300026088 Bacteria 481088
382 Ga0207641_10000054 3300026088 Bacteria 170887
383 Ga0207641_10000263 3300026088 Bacteria 66525
384 Ga0207641_10001006 3300026088 Bacteria 28784
385 Ga0207641_10002254 3300026088 Bacteria 17975
386 Ga0207641_10003954 3300026088 Bacteria 12949
387 Ga0207641_10008512 3300026088 Bacteria 8478
388 Ga0207641_10009407 3300026088 Bacteria 8052
389 Ga0207641_10023359 3300026088 Bacteria 5094
390 Ga0207641_10073932 3300026088 Bacteria 2938
391 Ga0207648_10000003 3300026089 Bacteria 289983
392 Ga0207676_10000017 3300026095 Bacteria 308709
393 Ga0207676_10000169 3300026095 Bacteria 57208
394 Ga0207676_10000696 3300026095 Bacteria 26511
395 Ga0207676_10002192 3300026095 Bacteria 14077
396 Ga0207676_10012220 3300026095 Bacteria 6146
397 Ga0207676_10012270 3300026095 Bacteria 6133
398 Ga0207676_10014589 3300026095 Bacteria 5657
399 Ga0207676_10156766 3300026095 Bacteria 1968
400 Ga0207674_10000308 3300026116 Bacteria 62120
401 Ga0207674_10011602 3300026116 Bacteria 9898
402 Ga0207674_10019102 3300026116 Bacteria 7430
403 Ga0207674_10034252 3300026116 Bacteria 5312
404 Ga0207674_10160738 3300026116 Bacteria 2201
405 Ga0207674_10174914 3300026116 Bacteria 2099
406 Ga0207674_10416303 3300026116 Bacteria 1298
407 Ga0207675_100000131 3300026118 Bacteria 62791
408 Ga0207675_100000147 3300026118 Bacteria 61195
409 Ga0207675_100000891 3300026118 Bacteria 29831
410 Ga0207675_100011955 3300026118 Bacteria 8111
411 Ga0207698_10001072 3300026142 Bacteria 15905
412 Ga0207698_10132403 3300026142 Bacteria 2133
413 Ga0207698_10164486 3300026142 Bacteria 1945
414 Ga0207698_10188365 3300026142 Bacteria 1835
415 Ga0268266_10000117 3300028379 Bacteria 163515
416 Ga0268266_10016659 3300028379 Bacteria 6280
417 Ga0268266_10113660 3300028379 Bacteria 2401
418 Ga0268266_10262887 3300028379 Bacteria 1600
419 Ga0268265_10000002 3300028380 Bacteria 1035381
420 Ga0268265_10000266 3300028380 Bacteria 59618
421 Ga0268265_10000357 3300028380 Bacteria 49395
422 Ga0268265_10002836 3300028380 Bacteria 12746
423 Ga0268265_10004816 3300028380 Bacteria 9303
424 Ga0268265_10009732 3300028380 Bacteria 6488
425 Ga0268265_10274487 3300028380 Bacteria 1505
426 Ga0268264_10000001 3300028381 Bacteria 1221000
427 Ga0268264_10000003 3300028381 Bacteria 1141976
428 Ga0268264_10000128 3300028381 Bacteria 183164
429 Ga0268264_10000204 3300028381 Bacteria 120959
430 Ga0268264_10002511 3300028381 Bacteria 16129
431 Ga0268264_10004853 3300028381 Bacteria 11395
432 Ga0307408_100087280 3300031548 Bacteria 2346
433 Ga0307508_10000960 3300031616 Bacteria 33550
434 Ga0307410_10118174 3300031852 Bacteria 1929
435 Ga0307410_10170247 3300031852 Bacteria 1640
436 Ga0307406_10045872 3300031901 Bacteria 2747
437 Ga0307412_10005555 3300031911 Bacteria 7082
438 Ga0307412_10028705 3300031911 Bacteria 3484
439 Ga0307412_10037699 3300031911 Bacteria 3107
440 Ga0307409_100013246 3300031995 Bacteria 5296
441 Ga0307416_100213642 3300032002 Bacteria 1842
442 Ga0307414_10041862 3300032004 Bacteria 3107
443 Ga0307411_10275425 3300032005 Bacteria 1336
444 Ga0307510_10016083 3300033180 Bacteria 8836
445 Ga0395899_0074705 3300037312 Bacteria 2476
446 Ga0395899_0080799 3300037312 Bacteria 2366
447 Ga0395900_0002071 3300037418 Bacteria 22508
448 Ga0395900_0026267 3300037418 Bacteria 5963
449 Ga0395900_0187559 3300037418 Bacteria 2099
450 Ga0395900_0397970 3300037418 Bacteria 1342
451 Ga0395898_0030947 3300037466 Bacteria 5352
452 Ga0395898_0250273 3300037466 Bacteria 1690
453 Ga0395905_0003291 3300037471 Bacteria 17350
454 Ga0395905_0007105 3300037471 Bacteria 11190
455 Ga0395905_0015849 3300037471 Bacteria 7160
456 Ga0395905_0016103 3300037471 Bacteria 7107
457 Ga0395905_0044251 3300037471 Bacteria 4178
458 Ga0395905_0137916 3300037471 Bacteria 2295
459 Ga0395905_0273449 3300037471 Bacteria 1575
460 Ga0395901_0002697 3300038443 Bacteria 17888
461 Ga0395901_0006189 3300038443 Bacteria 12126
462 Ga0395901_0065408 3300038443 Bacteria 3786
463 Ga0395901_0283683 3300038443 Bacteria 1720
464 Ga0451841_0951447 3300041498 Bacteria 1684
465 Ga0439445_0000124 3300042004 Bacteria 13248
466 Ga0439448_0000114 3300042005 Bacteria 14867
467 Ga0439448_0009599 3300042005 Bacteria 2855
468 Ga0439455_0000039 3300042012 Bacteria 11478
469 Ga0439458_0000037 3300042157 Bacteria 20859
470 Ga0439458_0000482 3300042157 Bacteria 10218
471 Ga0439458_0001251 3300042157 Bacteria 6407
472 Ga0466966_0051064 3300044684 Bacteria 2629
473 Ga0466961_0003244 3300044693 Bacteria 10121
474 Ga0466963_0003682 3300044694 Bacteria 8824
475 Ga0466964_0002676 3300044706 Bacteria 6381
476 Ga0453684_0024245 3300044712 Bacteria 8878
477 Ga0466971_0006185 3300044719 Bacteria 5204
478 Ga0466970_0033196 3300044765 Bacteria 2728
479 Ga0466960_0011210 3300044901 Bacteria 3742
480 Ga0466959_0032431 3300045049 Bacteria 3866
481 Ga0466958_0006700 3300045836 Bacteria 6287
482 Ga0466967_0046722 3300045976 Bacteria 3771
483 Ga0495638_0148361 3300046460 Bacteria 1362
484 Ga0495583_0016733 3300046506 Bacteria 3927
485 Ga0495648_0171063 3300046524 Bacteria 1113
486 Ga0495663_0004218 3300046525 Bacteria 4058
487 Ga0495654_0003096 3300046530 Bacteria 10338
488 Ga0495597_0002879 3300046542 Bacteria 10497
489 Ga0495668_0000989 3300046616 Bacteria 30903
490 Ga0495668_0015112 3300046616 Bacteria 4514
491 Ga0495668_0015152 3300046616 Bacteria 4508
492 Ga0495668_0016112 3300046616 Bacteria 4349
493 Ga0495625_0000460 3300046660 Bacteria 61217
494 Ga0495625_0027206 3300046660 Bacteria 4310
495 Ga0495625_0082012 3300046660 Bacteria 2244
496 Ga0495625_0095936 3300046660 Bacteria 2043
497 Ga0495670_0020432 3300046691 Bacteria 3266
498 Ga0495671_0018660 3300046692 Bacteria 3678
499 Ga0495649_0036870 3300046694 Bacteria 2686
500 Ga0495677_0002123 3300047445 Bacteria 7855
501 Ga0495681_0087104 3300047470 Bacteria 1385
502 Ga0496101_0020678 3300048904 Bacteria 4512
503 Ga0496101_0061575 3300048904 Bacteria 2726
504 Ga0496102_0007301 3300048905 Bacteria 9431
505 Ga0496102_0065611 3300048905 Bacteria 3328
506 Ga0496102_0087058 3300048905 Bacteria 2886
507 Ga0496102_0279022 3300048905 Bacteria 1575
508 Ga0496102_0303373 3300048905 Bacteria 1505
509 Ga0496103_0018596 3300048906 Bacteria 4169
510 Ga0496103_0039583 3300048906 Bacteria 2897
511 Ga0496104_0010865 3300048907 Bacteria 8143
512 Ga0496104_0050409 3300048907 Bacteria 3928
513 Ga0496105_0037080 3300048908 Bacteria 4016
514 Ga0496105_0039921 3300048908 Bacteria 3870
515 Ga0496105_0103552 3300048908 Bacteria 2350
516 Ga0496106_0002615 3300048909 Bacteria 13399
517 Ga0496106_0054464 3300048909 Bacteria 3022
518 Ga0496107_0033143 3300048910 Bacteria 3695
519 Ga0496107_0110159 3300048910 Bacteria 2023
520 Ga0496108_0152521 3300048911 Bacteria 1994
521 Ga0496108_0326496 3300048911 Bacteria 1338
522 Ga0496109_0059305 3300048912 Bacteria 3496
523 Ga0496109_0115253 3300048912 Bacteria 2500
524 Ga0496110_0151791 3300048913 Bacteria 2098
525 Ga0496112_0502037 3300048915 Bacteria 1148
526 Ga0496113_0002879 3300048916 Bacteria 10132
527 Ga0496113_0064522 3300048916 Bacteria 2769
528 Ga0496116_0086824 3300048919 Bacteria 1917
529 Ga0496117_0002856 3300048920 Bacteria 21010
530 Ga0496117_0015664 3300048920 Bacteria 6444
531 Ga0496117_0045989 3300048920 Bacteria 3145
532 Ga0496118_0001042 3300048921 Bacteria 43202
533 Ga0496118_0004960 3300048921 Bacteria 15403
534 Ga0496118_0089039 3300048921 Bacteria 2132
535 Ga0496119_0134661 3300048922 Bacteria 1342
536 Ga0496120_0146545 3300048923 Bacteria 1192
537 Ga0496121_0000222 3300048924 Bacteria 123595
538 Ga0496121_0022851 3300048924 Bacteria 6045
539 Ga0496122_0017693 3300048925 Bacteria 6640
540 Ga0496123_0025780 3300048926 Bacteria 4422
541 Ga0496124_0012517 3300048927 Bacteria 8367
542 Ga0496124_0051506 3300048927 Bacteria 3503
543 Ga0496124_0092797 3300048927 Bacteria 2459
544 Ga0496125_0051862 3300048928 Bacteria 3379
545 Ga0496125_0070540 3300048928 Bacteria 2735
546 Ga0496126_0058769 3300048929 Bacteria 3465
547 Ga0501290_000084 3300049513 Bacteria 13312
548 Ga0501292_000041 3300049515 Bacteria 30091
549 Ga0501294_000202 3300049517 Bacteria 7346
550 Ga0501297_012961 3300049520 Bacteria 974
551 Ga0501317_003229 3300049533 Bacteria 1608
552 Ga0501034_0046201 3300049571 Bacteria 4400
553 Ga0501198_005078 3300049649 Bacteria 1843
554 Ga0501206_000705 3300049653 Bacteria 4060
555 Ga0501223_000025 3300049663 Bacteria 58092
556 Ga0501223_000049 3300049663 Bacteria 40988
557 Ga0501223_000315 3300049663 Bacteria 12017
558 Ga0501224_000007 3300049664 Bacteria 127654
559 Ga0501224_005679 3300049664 Bacteria 1796
560 Ga0501227_014021 3300049665 Bacteria 1773
561 Ga0501233_014942 3300049668 Bacteria 1593
562 Ga0501235_002024 3300049669 Bacteria 4345
563 Ga0501236_005872 3300049670 Bacteria 1495
564 Ga0501257_018640 3300049686 Bacteria 1620
565 Ga0501259_000419 3300049688 Bacteria 6745
566 Ga0501261_000157 3300049690 Bacteria 9760
567 Ga0501225_0000055 3300049705 Bacteria 38821
568 Ga0501225_0000658 3300049705 Bacteria 10757
569 Ga0501225_0001833 3300049705 Bacteria 6658
570 Ga0501225_0002958 3300049705 Bacteria 5206
571 Ga0501225_0009100 3300049705 Bacteria 2837
572 Ga0501234_000223 3300049707 Bacteria 8202
573 Ga0501245_000086 3300049708 Bacteria 9191
574 Ga0501279_000086 3300049775 Bacteria 15076
575 Ga0501280_000113 3300049776 Bacteria 21120
576 Ga0501280_000158 3300049776 Bacteria 17654
577 Ga0501281_00396 3300049777 Bacteria 4348
578 Ga0501282_000040 3300049778 Bacteria 17093
579 Ga0501226_000025 3300049853 Bacteria 91197
580 nmdc:mga07m45_7264_c1 3300050496 Bacteria 5650
581 nmdc:mga0qj67_12348_c1 3300050509 Bacteria 6433
582 Ga0500643_000139 3300053087 Bacteria 73348
583 Ga0500643_000544 3300053087 Bacteria 26284
584 Ga0500643_001645 3300053087 Bacteria 12492
585 Ga0500643_001664 3300053087 Bacteria 12390
586 Ga0500643_013891 3300053087 Bacteria 2818
587 Ga0500651_0003722 3300053093 Bacteria 8398
588 Ga0500641_0007726 3300053096 Bacteria 3833
589 Ga0500556_0000040 3300053104 Bacteria 137489
590 Ga0500592_000096 3300053116 Bacteria 19420
591 Ga0500592_000854 3300053116 Bacteria 4968
592 Ga0500594_0001632 3300053118 Bacteria 4876
593 Ga0500642_0000003 3300053130 Bacteria 544899
594 Ga0500655_000091 3300053133 Bacteria 23663
595 Ga0500559_0031708 3300053136 Bacteria 2268
596 Ga0500559_0130518 3300053136 Bacteria 1173
597 Ga0500590_000125 3300053148 Bacteria 21213
598 Ga0500590_042572 3300053148 Bacteria 2331
599 Ga0500604_0009325 3300053151 Bacteria 2614
600 Ga0500622_0002615 3300053156 Bacteria 12812
601 Ga0500624_000051 3300053157 Bacteria 76932
602 Ga0500627_0000119 3300053158 Bacteria 24541
603 Ga0500627_0000371 3300053158 Bacteria 12236
604 Ga0500636_0000838 3300053177 Bacteria 16555
605 Ga0500645_001009 3300053730 Bacteria 15836
606 Ga0587077_001780 3300059493 Bacteria 2404
607 Ga0466962_0008298 3300061719 Bacteria 4976
608 Ga0466962_0045753 3300061719 Bacteria 2092

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0024245 Ga0453684_0024245_7085_7924 266
2 3300049520 Ga0501297_012961 Ga0501297_012961_140_949 268
3 3300049776 Ga0501280_000158 Ga0501280_000158_1305_2114 268
4 3300049663 Ga0501223_000049 Ga0501223_000049_25413_26237 273
5 3300049664 Ga0501224_000007 Ga0501224_000007_14956_15780 273
6 3300049705 Ga0501225_0000055 Ga0501225_0000055_23129_23953 273
7 3300049707 Ga0501234_000223 Ga0501234_000223_5037_5861 273
8 3300049853 Ga0501226_000025 Ga0501226_000025_75412_76236 273
9 3300005614 Ga0068856_100160218 Ga0068856_1001602182 275
10 3300044706 Ga0466964_0002676 Ga0466964_0002676_2951_3913 277
11 3300044693 Ga0466961_0003244 Ga0466961_0003244_7046_8029 278
12 3300044765 Ga0466970_0033196 Ga0466970_0033196_272_1255 278
13 3300044901 Ga0466960_0011210 Ga0466960_0011210_1672_2658 278
14 3300045049 Ga0466959_0032431 Ga0466959_0032431_1903_2886 278
15 3300061719 Ga0466962_0045753 Ga0466962_0045753_462_1445 278
16 3300006353 Ga0075370_10012882 Ga0075370_100128823 279
17 3300050496 nmdc:mga07m45_7264_c1 nmdc:mga07m45_7264_c1_2019_2975 279
18 3300049649 Ga0501198_005078 Ga0501198_005078_533_1387 280
19 3300046506 Ga0495583_0016733 Ga0495583_0016733_2111_2962 281
20 3300046524 Ga0495648_0171063 Ga0495648_0171063_93_944 281
21 3300046616 Ga0495668_0015152 Ga0495668_0015152_2917_3768 281
22 3300046660 Ga0495625_0027206 Ga0495625_0027206_992_1843 281
23 3300047445 Ga0495677_0002123 Ga0495677_0002123_198_1049 281
24 3300053087 Ga0500643_001664 Ga0500643_001664_7452_8303 281
25 3300005366 Ga0070659_100261767 Ga0070659_1002617672 282
26 3300005457 Ga0070662_100024596 Ga0070662_1000245965 282
27 3300025919 Ga0207657_10082983 Ga0207657_100829832 282
28 3300025932 Ga0207690_10129207 Ga0207690_101292072 282
29 3300025933 Ga0207706_10105772 Ga0207706_101057722 282
30 3300044684 Ga0466966_0051064 Ga0466966_0051064_1560_2543 282
31 3300013307 Ga0157372_10183836 Ga0157372_101838362 283
32 3300031616 Ga0307508_10000960 Ga0307508_1000096011 287
33 3300048912 Ga0496109_0059305 Ga0496109_0059305_2449_3339 287
34 3300048928 Ga0496125_0070540 Ga0496125_0070540_162_1052 287
35 3300013307 Ga0157372_10404699 Ga0157372_104046992 290
36 3300053087 Ga0500643_013891 Ga0500643_013891_1882_2781 290
37 3300009098 Ga0105245_10000357 Ga0105245_1000035737 293
38 3300025927 Ga0207687_10000323 Ga0207687_1000032320 293
39 3300005617 Ga0068859_100001942 Ga0068859_10000194210 294
40 3300005719 Ga0068861_100000007 Ga0068861_10000000728 294
41 3300006931 Ga0097620_100001942 Ga0097620_10000194210 294
42 3300009148 Ga0105243_10043313 Ga0105243_100433133 294
43 3300009177 Ga0105248_10000723 Ga0105248_1000072323 294
44 3300014968 Ga0157379_10036808 Ga0157379_100368083 294
45 3300025935 Ga0207709_10038576 Ga0207709_100385763 294
46 3300025938 Ga0207704_10391481 Ga0207704_103914812 294
47 3300025941 Ga0207711_10008095 Ga0207711_100080953 294
48 3300026118 Ga0207675_100000147 Ga0207675_1000001474 294
49 3300046660 Ga0495625_0082012 Ga0495625_0082012_980_1933 295
50 3300049513 Ga0501290_000084 Ga0501290_000084_4751_5716 295
51 3300049515 Ga0501292_000041 Ga0501292_000041_11272_12237 295
52 3300049517 Ga0501294_000202 Ga0501294_000202_3967_4932 295
53 3300049653 Ga0501206_000705 Ga0501206_000705_2469_3434 295
54 3300049663 Ga0501223_000315 Ga0501223_000315_4751_5716 295
55 3300049664 Ga0501224_005679 Ga0501224_005679_605_1570 295
56 3300049665 Ga0501227_014021 Ga0501227_014021_611_1576 295
57 3300049668 Ga0501233_014942 Ga0501233_014942_601_1566 295
58 3300049669 Ga0501235_002024 Ga0501235_002024_2676_3641 295
59 3300049686 Ga0501257_018640 Ga0501257_018640_77_1042 295
60 3300049688 Ga0501259_000419 Ga0501259_000419_2890_3855 295
61 3300049690 Ga0501261_000157 Ga0501261_000157_2177_3142 295
62 3300049705 Ga0501225_0002958 Ga0501225_0002958_624_1589 295
63 3300049708 Ga0501245_000086 Ga0501245_000086_2707_3672 295
64 3300049775 Ga0501279_000086 Ga0501279_000086_11256_12221 295
65 3300049776 Ga0501280_000113 Ga0501280_000113_13021_13986 295
66 3300049777 Ga0501281_00396 Ga0501281_00396_611_1576 295
67 3300049778 Ga0501282_000040 Ga0501282_000040_8531_9496 295
68 3300059493 Ga0587077_001780 Ga0587077_001780_1041_2006 295
69 3300048911 Ga0496108_0326496 Ga0496108_0326496_315_1280 297
70 3300048916 Ga0496113_0064522 Ga0496113_0064522_1773_2738 297
71 3300046616 Ga0495668_0015112 Ga0495668_0015112_1370_2338 298
72 3300053151 Ga0500604_0009325 Ga0500604_0009325_401_1369 298
73 3300002077 JGI24744J21845_10022409 JGI24744J21845_100224092 299
74 3300005354 Ga0070675_100014931 Ga0070675_1000149318 299
75 3300005355 Ga0070671_100030576 Ga0070671_1000305765 299
76 3300005356 Ga0070674_100011647 Ga0070674_1000116474 299
77 3300005457 Ga0070662_100008232 Ga0070662_1000082327 299
78 3300005539 Ga0068853_100273547 Ga0068853_1002735472 299
79 3300013306 Ga0163162_10685138 Ga0163162_106851382 299
80 3300025904 Ga0207647_10008523 Ga0207647_100085237 299
81 3300025931 Ga0207644_10044438 Ga0207644_100444382 299
82 3300025937 Ga0207669_10175222 Ga0207669_101752222 299
83 3300046660 Ga0495625_0000460 Ga0495625_0000460_26863_27831 299
84 3300005563 Ga0068855_100001164 Ga0068855_10000116425 300
85 3300005616 Ga0068852_100001541 Ga0068852_1000015418 300
86 3300025949 Ga0207667_10000017 Ga0207667_10000017285 300
87 3300026142 Ga0207698_10001072 Ga0207698_100010728 300
88 3300046691 Ga0495670_0020432 Ga0495670_0020432_144_1070 300
89 3300013307 Ga0157372_10110927 Ga0157372_101109273 301
90 3300017792 Ga0163161_10275590 Ga0163161_102755901 301
91 3300025981 Ga0207640_10023945 Ga0207640_100239452 301
92 3300041498 Ga0451841_0951447 Ga0451841_0951447_719_1636 301
93 3300005842 Ga0068858_100006825 Ga0068858_1000068254 302
94 3300026035 Ga0207703_10000630 Ga0207703_1000063021 302
95 3300037466 Ga0395898_0250273 Ga0395898_0250273_733_1665 302
96 3300053087 Ga0500643_000139 Ga0500643_000139_44067_45038 303
97 3300001990 JGI24737J22298_10001009 JGI24737J22298_100010094 304
98 3300005331 Ga0070670_100250667 Ga0070670_1002506672 304
99 3300005335 Ga0070666_10004989 Ga0070666_100049894 304
100 3300005347 Ga0070668_100109352 Ga0070668_1001093522 304
101 3300005353 Ga0070669_100006890 Ga0070669_1000068904 304
102 3300005355 Ga0070671_100000034 Ga0070671_1000000344 304
103 3300005367 Ga0070667_100005856 Ga0070667_1000058564 304
104 3300005440 Ga0070705_100012769 Ga0070705_1000127694 304
105 3300005548 Ga0070665_100142939 Ga0070665_1001429393 304
106 3300005577 Ga0068857_100010757 Ga0068857_1000107576 304
107 3300005618 Ga0068864_100039341 Ga0068864_1000393413 304
108 3300005719 Ga0068861_100003012 Ga0068861_1000030124 304
109 3300005841 Ga0068863_100003894 Ga0068863_1000038949 304
110 3300005842 Ga0068858_100006275 Ga0068858_1000062754 304
111 3300005843 Ga0068860_100013681 Ga0068860_1000136817 304
112 3300005844 Ga0068862_100009271 Ga0068862_1000092714 304
113 3300005844 Ga0068862_100192460 Ga0068862_1001924602 304
114 3300009011 Ga0105251_10020882 Ga0105251_100208824 304
115 3300009101 Ga0105247_10004689 Ga0105247_100046892 304
116 3300009177 Ga0105248_10098411 Ga0105248_100984112 304
117 3300011119 Ga0105246_10034604 Ga0105246_100346044 304
118 3300013306 Ga0163162_10008224 Ga0163162_100082247 304
119 3300014325 Ga0163163_10012217 Ga0163163_100122178 304
120 3300014325 Ga0163163_10013315 Ga0163163_100133152 304
121 3300014968 Ga0157379_10027676 Ga0157379_100276765 304
122 3300025315 Ga0207697_10002475 Ga0207697_100024754 304
123 3300025900 Ga0207710_10004442 Ga0207710_100044427 304
124 3300025903 Ga0207680_10007925 Ga0207680_100079254 304
125 3300025923 Ga0207681_10000008 Ga0207681_100000084 304
126 3300025925 Ga0207650_10022933 Ga0207650_100229334 304
127 3300025925 Ga0207650_10267614 Ga0207650_102676142 304
128 3300025931 Ga0207644_10000033 Ga0207644_1000003389 304
129 3300025932 Ga0207690_10226345 Ga0207690_102263452 304
130 3300025941 Ga0207711_10062552 Ga0207711_100625523 304
131 3300025961 Ga0207712_10004665 Ga0207712_100046653 304
132 3300025972 Ga0207668_10002224 Ga0207668_100022244 304
133 3300026035 Ga0207703_10007341 Ga0207703_100073413 304
134 3300026088 Ga0207641_10023359 Ga0207641_100233596 304
135 3300026088 Ga0207641_10073932 Ga0207641_100739322 304
136 3300026095 Ga0207676_10000696 Ga0207676_1000069618 304
137 3300026116 Ga0207674_10000308 Ga0207674_1000030810 304
138 3300026118 Ga0207675_100011955 Ga0207675_1000119556 304
139 3300028379 Ga0268266_10113660 Ga0268266_101136602 304
140 3300028380 Ga0268265_10000357 Ga0268265_1000035740 304
141 3300028380 Ga0268265_10274487 Ga0268265_102744872 304
142 3300028381 Ga0268264_10004853 Ga0268264_100048534 304
143 3300049571 Ga0501034_0046201 Ga0501034_0046201_1439_2365 304
144 3300005328 Ga0070676_10005501 Ga0070676_100055017 305
145 3300005334 Ga0068869_100000031 Ga0068869_1000000312 305
146 3300005338 Ga0068868_100000060 Ga0068868_10000006061 305
147 3300005364 Ga0070673_100000009 Ga0070673_10000000961 305
148 3300005459 Ga0068867_100000002 Ga0068867_100000002228 305
149 3300005543 Ga0070672_100025226 Ga0070672_1000252264 305
150 3300006881 Ga0068865_100000014 Ga0068865_10000001482 305
151 3300009098 Ga0105245_10000160 Ga0105245_100001605 305
152 3300009148 Ga0105243_10000070 Ga0105243_1000007061 305
153 3300009176 Ga0105242_10001604 Ga0105242_1000160410 305
154 3300009553 Ga0105249_10015328 Ga0105249_100153284 305
155 3300011119 Ga0105246_10003501 Ga0105246_100035012 305
156 3300013296 Ga0157374_10000542 Ga0157374_1000054240 305
157 3300013297 Ga0157378_10000624 Ga0157378_1000062440 305
158 3300013308 Ga0157375_10031485 Ga0157375_100314855 305
159 3300014745 Ga0157377_10113948 Ga0157377_101139482 305
160 3300014969 Ga0157376_10000096 Ga0157376_1000009661 305
161 3300025907 Ga0207645_10008376 Ga0207645_100083762 305
162 3300025927 Ga0207687_10000252 Ga0207687_1000025227 305
163 3300025934 Ga0207686_10002334 Ga0207686_100023342 305
164 3300025935 Ga0207709_10000066 Ga0207709_1000006639 305
165 3300025938 Ga0207704_10000002 Ga0207704_10000002159 305
166 3300025938 Ga0207704_10000007 Ga0207704_10000007159 305
167 3300025940 Ga0207691_10022342 Ga0207691_100223423 305
168 3300025942 Ga0207689_10000060 Ga0207689_1000006026 305
169 3300025960 Ga0207651_10000004 Ga0207651_10000004228 305
170 3300025961 Ga0207712_10007169 Ga0207712_100071695 305
171 3300026023 Ga0207677_10000231 Ga0207677_100002319 305
172 3300026089 Ga0207648_10000003 Ga0207648_1000000361 305
173 3300031911 Ga0307412_10005555 Ga0307412_100055555 305
174 3300049533 Ga0501317_003229 Ga0501317_003229_310_1275 305
175 iso_pu_bacteria 2775507255 2778123930 305
176 3300005335 Ga0070666_10095505 Ga0070666_100955052 306
177 3300005367 Ga0070667_100000692 Ga0070667_10000069214 306
178 3300005618 Ga0068864_100049025 Ga0068864_1000490252 306
179 3300005841 Ga0068863_100000006 Ga0068863_100000006210 306
180 3300005842 Ga0068858_100015300 Ga0068858_1000153005 306
181 3300005843 Ga0068860_100000119 Ga0068860_10000011928 306
182 3300009147 Ga0114129_10096454 Ga0114129_100964541 306
183 3300025986 Ga0207658_10001289 Ga0207658_1000128914 306
184 3300026035 Ga0207703_10042209 Ga0207703_100422094 306
185 3300026088 Ga0207641_10000054 Ga0207641_1000005449 306
186 3300026095 Ga0207676_10014589 Ga0207676_100145892 306
187 3300028379 Ga0268266_10016659 Ga0268266_100166592 306
188 3300028381 Ga0268264_10000128 Ga0268264_1000012870 306
189 3300048905 Ga0496102_0065611 Ga0496102_0065611_643_1611 306
190 3300048907 Ga0496104_0050409 Ga0496104_0050409_934_1902 306
191 3300048908 Ga0496105_0103552 Ga0496105_0103552_225_1193 306
192 3300048920 Ga0496117_0045989 Ga0496117_0045989_205_1173 306
193 3300048921 Ga0496118_0004960 Ga0496118_0004960_4428_5396 306
194 3300048922 Ga0496119_0134661 Ga0496119_0134661_275_1225 306
195 3300048924 Ga0496121_0000222 Ga0496121_0000222_95612_96580 306
196 3300048924 Ga0496121_0022851 Ga0496121_0022851_4425_5375 306
197 3300048925 Ga0496122_0017693 Ga0496122_0017693_3780_4730 306
198 3300048926 Ga0496123_0025780 Ga0496123_0025780_1604_2554 306
199 3300048927 Ga0496124_0012517 Ga0496124_0012517_1353_2303 306
200 3300048929 Ga0496126_0058769 Ga0496126_0058769_267_1217 306
201 3300005356 Ga0070674_100215238 Ga0070674_1002152382 307
202 3300046692 Ga0495671_0018660 Ga0495671_0018660_487_1443 307
203 3300053118 Ga0500594_0001632 Ga0500594_0001632_2070_3026 307
204 3300053156 Ga0500622_0002615 Ga0500622_0002615_2646_3572 307
205 3300001904 JGI24736J21556_1000376 JGI24736J21556_10003767 308
206 3300001915 JGI24741J21665_1000325 JGI24741J21665_100032513 308
207 3300001979 JGI24740J21852_10000356 JGI24740J21852_100003562 308
208 3300001989 JGI24739J22299_10017157 JGI24739J22299_100171572 308
209 3300001990 JGI24737J22298_10005404 JGI24737J22298_100054043 308
210 3300002067 JGI24735J21928_10005899 JGI24735J21928_100058993 308
211 3300002075 JGI24738J21930_10003551 JGI24738J21930_100035514 308
212 3300005340 Ga0070689_100124649 Ga0070689_1001246492 308
213 3300005344 Ga0070661_100141800 Ga0070661_1001418002 308
214 3300005353 Ga0070669_100001143 Ga0070669_10000114312 308
215 3300005355 Ga0070671_100000040 Ga0070671_10000004051 308
216 3300005366 Ga0070659_100009830 Ga0070659_1000098304 308
217 3300005455 Ga0070663_100007749 Ga0070663_1000077494 308
218 3300005544 Ga0070686_100104625 Ga0070686_1001046252 308
219 3300005548 Ga0070665_100049328 Ga0070665_1000493284 308
220 3300005563 Ga0068855_100005469 Ga0068855_1000054697 308
221 3300005563 Ga0068855_100145237 Ga0068855_1001452372 308
222 3300005564 Ga0070664_100009350 Ga0070664_1000093508 308
223 3300005614 Ga0068856_100009439 Ga0068856_1000094393 308
224 3300005616 Ga0068852_100212228 Ga0068852_1002122281 308
225 3300005617 Ga0068859_100201774 Ga0068859_1002017742 308
226 3300005841 Ga0068863_100146767 Ga0068863_1001467672 308
227 3300005842 Ga0068858_100000352 Ga0068858_10000035249 308
228 3300006931 Ga0097620_100201770 Ga0097620_1002017701 308
229 3300009177 Ga0105248_10003764 Ga0105248_100037646 308
230 3300009553 Ga0105249_10351388 Ga0105249_103513882 308
231 3300013306 Ga0163162_10132289 Ga0163162_101322892 308
232 3300025904 Ga0207647_10035600 Ga0207647_100356002 308
233 3300025911 Ga0207654_10031228 Ga0207654_100312283 308
234 3300025914 Ga0207671_10023283 Ga0207671_100232833 308
235 3300025919 Ga0207657_10013142 Ga0207657_100131425 308
236 3300025920 Ga0207649_10049967 Ga0207649_100499673 308
237 3300025923 Ga0207681_10001400 Ga0207681_1000140011 308
238 3300025924 Ga0207694_10169129 Ga0207694_101691292 308
239 3300025931 Ga0207644_10000005 Ga0207644_10000005397 308
240 3300025932 Ga0207690_10085978 Ga0207690_100859782 308
241 3300025933 Ga0207706_10022176 Ga0207706_100221762 308
242 3300025941 Ga0207711_10034963 Ga0207711_100349632 308
243 3300025949 Ga0207667_10008884 Ga0207667_100088847 308
244 3300025961 Ga0207712_10234294 Ga0207712_102342942 308
245 3300025972 Ga0207668_10181195 Ga0207668_101811952 308
246 3300025981 Ga0207640_10011693 Ga0207640_100116933 308
247 3300026035 Ga0207703_10001574 Ga0207703_1000157419 308
248 3300026041 Ga0207639_10003463 Ga0207639_100034632 308
249 3300026067 Ga0207678_10000404 Ga0207678_1000040420 308
250 3300026078 Ga0207702_10005874 Ga0207702_100058744 308
251 3300026095 Ga0207676_10156766 Ga0207676_101567662 308
252 3300026116 Ga0207674_10019102 Ga0207674_100191025 308
253 3300026142 Ga0207698_10164486 Ga0207698_101644861 308
254 3300031852 Ga0307410_10170247 Ga0307410_101702472 308
255 3300031995 Ga0307409_100013246 Ga0307409_1000132462 308
256 3300032002 Ga0307416_100213642 Ga0307416_1002136422 308
257 3300032004 Ga0307414_10041862 Ga0307414_100418622 308
258 3300032005 Ga0307411_10275425 Ga0307411_102754252 308
259 3300046460 Ga0495638_0148361 Ga0495638_0148361_313_1269 308
260 3300048904 Ga0496101_0020678 Ga0496101_0020678_2203_3159 308
261 3300048906 Ga0496103_0018596 Ga0496103_0018596_1680_2636 308
262 3300048908 Ga0496105_0037080 Ga0496105_0037080_2007_2963 308
263 3300048909 Ga0496106_0002615 Ga0496106_0002615_7570_8526 308
264 3300048910 Ga0496107_0033143 Ga0496107_0033143_748_1704 308
265 3300048910 Ga0496107_0110159 Ga0496107_0110159_1086_2012 308
266 3300048911 Ga0496108_0152521 Ga0496108_0152521_816_1772 308
267 3300048912 Ga0496109_0115253 Ga0496109_0115253_638_1594 308
268 3300048915 Ga0496112_0502037 Ga0496112_0502037_127_1083 308
269 3300048916 Ga0496113_0002879 Ga0496113_0002879_3576_4532 308
270 3300053104 Ga0500556_0000040 Ga0500556_0000040_76406_77362 308
271 3300053130 Ga0500642_0000003 Ga0500642_0000003_204382_205338 308
272 3300053157 Ga0500624_000051 Ga0500624_000051_37432_38391 308
273 3300053177 Ga0500636_0000838 Ga0500636_0000838_1520_2479 308
274 3300053730 Ga0500645_001009 Ga0500645_001009_3248_4204 308
275 3300005289 Ga0065704_10084088 Ga0065704_100840884 309
276 3300005331 Ga0070670_100068597 Ga0070670_1000685972 309
277 3300005347 Ga0070668_100039604 Ga0070668_1000396042 309
278 3300005466 Ga0070685_10080002 Ga0070685_100800021 309
279 3300005539 Ga0068853_100004448 Ga0068853_1000044482 309
280 3300005563 Ga0068855_100160958 Ga0068855_1001609582 309
281 3300009093 Ga0105240_10097192 Ga0105240_100971922 309
282 3300009174 Ga0105241_10002084 Ga0105241_100020846 309
283 3300009177 Ga0105248_10438920 Ga0105248_104389202 309
284 3300009545 Ga0105237_10132101 Ga0105237_101321012 309
285 3300010375 Ga0105239_10083094 Ga0105239_100830942 309
286 3300013100 Ga0157373_10029633 Ga0157373_100296333 309
287 3300013102 Ga0157371_10124823 Ga0157371_101248232 309
288 3300013104 Ga0157370_10130541 Ga0157370_101305412 309
289 3300025941 Ga0207711_10375462 Ga0207711_103754621 309
290 3300026041 Ga0207639_10003882 Ga0207639_100038823 309
291 3300026078 Ga0207702_10055754 Ga0207702_100557542 309
292 3300026116 Ga0207674_10011602 Ga0207674_100116025 309
293 3300031852 Ga0307410_10118174 Ga0307410_101181742 309
294 3300031911 Ga0307412_10037699 Ga0307412_100376992 309
295 3300037418 Ga0395900_0397970 Ga0395900_0397970_75_1031 309
296 3300037471 Ga0395905_0003291 Ga0395905_0003291_13424_14380 309
297 3300037471 Ga0395905_0016103 Ga0395905_0016103_2414_3370 309
298 3300038443 Ga0395901_0065408 Ga0395901_0065408_1467_2423 309
299 3300048905 Ga0496102_0087058 Ga0496102_0087058_133_1098 309
300 3300048927 Ga0496124_0051506 Ga0496124_0051506_1629_2594 309
301 3300049663 Ga0501223_000025 Ga0501223_000025_33238_34197 309
302 3300049705 Ga0501225_0000658 Ga0501225_0000658_5713_6672 309
303 3300053148 Ga0500590_042572 Ga0500590_042572_20_991 309
304 3300005841 Ga0068863_100006871 Ga0068863_1000068713 310
305 3300026088 Ga0207641_10009407 Ga0207641_100094077 310
306 3300046660 Ga0495625_0095936 Ga0495625_0095936_393_1328 310
307 3300049670 Ga0501236_005872 Ga0501236_005872_119_1096 310
308 3300049705 Ga0501225_0001833 Ga0501225_0001833_4600_5577 310
309 3300049705 Ga0501225_0009100 Ga0501225_0009100_464_1441 310
310 3300005347 Ga0070668_100000815 Ga0070668_1000008156 311
311 3300005548 Ga0070665_100327622 Ga0070665_1003276222 311
312 3300005617 Ga0068859_100086954 Ga0068859_1000869543 311
313 3300006931 Ga0097620_100086955 Ga0097620_1000869553 311
314 3300025972 Ga0207668_10000029 Ga0207668_100000296 311
315 3300028379 Ga0268266_10262887 Ga0268266_102628872 311
316 3300028381 Ga0268264_10002511 Ga0268264_1000251111 311
317 3300053136 Ga0500559_0130518 Ga0500559_0130518_146_1144 311
318 3300005331 Ga0070670_100014302 Ga0070670_1000143027 313
319 3300005335 Ga0070666_10061827 Ga0070666_100618272 313
320 3300005347 Ga0070668_100000026 Ga0070668_10000002643 313
321 3300005355 Ga0070671_100000470 Ga0070671_1000004705 313
322 3300005367 Ga0070667_100000019 Ga0070667_100000019202 313
323 3300005367 Ga0070667_100000076 Ga0070667_10000007653 313
324 3300005617 Ga0068859_100080679 Ga0068859_1000806792 313
325 3300005841 Ga0068863_100005111 Ga0068863_1000051115 313
326 3300005841 Ga0068863_100100122 Ga0068863_1001001222 313
327 3300005842 Ga0068858_100003305 Ga0068858_1000033058 313
328 3300005843 Ga0068860_100000036 Ga0068860_100000036216 313
329 3300005843 Ga0068860_100000131 Ga0068860_10000013154 313
330 3300005844 Ga0068862_100008677 Ga0068862_1000086772 313
331 3300006931 Ga0097620_100080678 Ga0097620_1000806782 313
332 3300025903 Ga0207680_10041387 Ga0207680_100413872 313
333 3300025923 Ga0207681_10034705 Ga0207681_100347052 313
334 3300025925 Ga0207650_10000657 Ga0207650_1000065721 313
335 3300025931 Ga0207644_10000067 Ga0207644_1000006733 313
336 3300025972 Ga0207668_10000081 Ga0207668_1000008143 313
337 3300025986 Ga0207658_10000002 Ga0207658_10000002228 313
338 3300025986 Ga0207658_10000094 Ga0207658_1000009452 313
339 3300026035 Ga0207703_10005308 Ga0207703_100053088 313
340 3300026088 Ga0207641_10002254 Ga0207641_100022549 313
341 3300026088 Ga0207641_10003954 Ga0207641_100039542 313
342 3300028380 Ga0268265_10004816 Ga0268265_100048168 313
343 3300028381 Ga0268264_10000001 Ga0268264_10000001553 313
344 3300028381 Ga0268264_10000204 Ga0268264_1000020452 313
345 iso_pu_bacteria 2582581305 2585262188 313
346 3300002459 JGI24751J29686_10000046 JGI24751J29686_1000004612 314
347 3300005331 Ga0070670_100000006 Ga0070670_10000000662 314
348 3300005617 Ga0068859_100234921 Ga0068859_1002349211 314
349 3300005618 Ga0068864_100000014 Ga0068864_100000014253 314
350 3300006931 Ga0097620_100234932 Ga0097620_1002349321 314
351 3300025925 Ga0207650_10000023 Ga0207650_10000023249 314
352 3300025961 Ga0207712_10066820 Ga0207712_100668202 314
353 3300026095 Ga0207676_10000017 Ga0207676_10000017251 314
354 3300002076 JGI24749J21850_1000033 JGI24749J21850_10000339 315
355 3300003323 rootH1_10040862 rootH1_100408627 315
356 3300005295 Ga0065707_10084013 Ga0065707_100840132 315
357 3300005353 Ga0070669_100000102 Ga0070669_10000010220 315
358 3300005353 Ga0070669_100204575 Ga0070669_1002045752 315
359 3300005367 Ga0070667_100003424 Ga0070667_1000034247 315
360 3300005578 Ga0068854_100037700 Ga0068854_1000377003 315
361 3300005618 Ga0068864_100000218 Ga0068864_10000021823 315
362 3300005618 Ga0068864_100004287 Ga0068864_1000042872 315
363 3300005719 Ga0068861_100061595 Ga0068861_1000615952 315
364 3300005841 Ga0068863_100063552 Ga0068863_1000635522 315
365 3300005844 Ga0068862_100000007 Ga0068862_10000000750 315
366 3300009177 Ga0105248_10000139 Ga0105248_1000013913 315
367 3300014326 Ga0157380_10000014 Ga0157380_1000001436 315
368 3300025923 Ga0207681_10000001 Ga0207681_10000001247 315
369 3300025923 Ga0207681_10277872 Ga0207681_102778722 315
370 3300025941 Ga0207711_10003786 Ga0207711_100037867 315
371 3300025941 Ga0207711_10108136 Ga0207711_101081362 315
372 3300025981 Ga0207640_10015659 Ga0207640_100156593 315
373 3300025986 Ga0207658_10011568 Ga0207658_100115686 315
374 3300026088 Ga0207641_10008512 Ga0207641_100085123 315
375 3300026095 Ga0207676_10000169 Ga0207676_1000016923 315
376 3300026095 Ga0207676_10012270 Ga0207676_100122703 315
377 3300026118 Ga0207675_100000891 Ga0207675_10000089113 315
378 3300026142 Ga0207698_10188365 Ga0207698_101883652 315
379 3300028380 Ga0268265_10000002 Ga0268265_10000002252 315
380 3300033180 Ga0307510_10016083 Ga0307510_100160835 315
381 3300037312 Ga0395899_0074705 Ga0395899_0074705_1442_2413 315
382 3300037418 Ga0395900_0002071 Ga0395900_0002071_11437_12408 315
383 3300037418 Ga0395900_0026267 Ga0395900_0026267_709_1680 315
384 3300037471 Ga0395905_0007105 Ga0395905_0007105_8649_9620 315
385 3300037471 Ga0395905_0044251 Ga0395905_0044251_2945_3916 315
386 3300037471 Ga0395905_0273449 Ga0395905_0273449_254_1225 315
387 3300038443 Ga0395901_0002697 Ga0395901_0002697_14181_15152 315
388 3300053087 Ga0500643_000544 Ga0500643_000544_6868_7839 315
389 3300005327 Ga0070658_10003723 Ga0070658_100037239 316
390 3300005455 Ga0070663_100004783 Ga0070663_1000047835 316
391 3300005539 Ga0068853_100014991 Ga0068853_1000149916 316
392 3300005548 Ga0070665_100404532 Ga0070665_1004045322 316
393 3300005577 Ga0068857_100005402 Ga0068857_1000054028 316
394 3300005578 Ga0068854_100003204 Ga0068854_1000032045 316
395 3300005834 Ga0068851_10062517 Ga0068851_100625172 316
396 3300006237 Ga0097621_100001876 Ga0097621_10000187613 316
397 3300006358 Ga0068871_100062791 Ga0068871_1000627914 316
398 3300009177 Ga0105248_10017214 Ga0105248_100172142 316
399 3300010375 Ga0105239_10084115 Ga0105239_100841153 316
400 3300013100 Ga0157373_10025286 Ga0157373_100252862 316
401 3300025909 Ga0207705_10000042 Ga0207705_1000004288 316
402 3300025941 Ga0207711_10014506 Ga0207711_100145066 316
403 3300025981 Ga0207640_10000695 Ga0207640_1000069519 316
404 3300026041 Ga0207639_10004222 Ga0207639_1000422210 316
405 3300026116 Ga0207674_10034252 Ga0207674_100342522 316
406 3300031548 Ga0307408_100087280 Ga0307408_1000872802 316
407 3300031901 Ga0307406_10045872 Ga0307406_100458723 316
408 3300037418 Ga0395900_0187559 Ga0395900_0187559_682_1659 316
409 3300037471 Ga0395905_0015849 Ga0395905_0015849_3836_4813 316
410 3300037471 Ga0395905_0137916 Ga0395905_0137916_649_1605 316
411 3300038443 Ga0395901_0283683 Ga0395901_0283683_667_1644 316
412 3300042004 Ga0439445_0000124 Ga0439445_0000124_10325_11299 316
413 3300042157 Ga0439458_0000482 Ga0439458_0000482_3029_4006 316
414 3300044694 Ga0466963_0003682 Ga0466963_0003682_365_1321 316
415 3300044719 Ga0466971_0006185 Ga0466971_0006185_4191_5147 316
416 3300045836 Ga0466958_0006700 Ga0466958_0006700_1025_1981 316
417 3300045976 Ga0466967_0046722 Ga0466967_0046722_1058_2014 316
418 3300048905 Ga0496102_0303373 Ga0496102_0303373_202_1158 316
419 3300048928 Ga0496125_0051862 Ga0496125_0051862_2055_3008 316
420 3300061719 Ga0466962_0008298 Ga0466962_0008298_2796_3752 316
421 3300002239 JGI24034J26672_10019022 JGI24034J26672_100190221 317
422 3300003762 Ga0055542_1001654 Ga0055542_10016546 317
423 3300005335 Ga0070666_10092046 Ga0070666_100920462 317
424 3300005347 Ga0070668_100214518 Ga0070668_1002145182 317
425 3300005355 Ga0070671_100096957 Ga0070671_1000969574 317
426 3300005356 Ga0070674_100074716 Ga0070674_1000747163 317
427 3300005457 Ga0070662_100044512 Ga0070662_1000445124 317
428 3300006846 Ga0075430_100036204 Ga0075430_1000362044 317
429 3300011119 Ga0105246_10159649 Ga0105246_101596492 317
430 3300025931 Ga0207644_10010698 Ga0207644_100106984 317
431 3300025933 Ga0207706_10139817 Ga0207706_101398172 317
432 3300037312 Ga0395899_0080799 Ga0395899_0080799_656_1645 317
433 3300037466 Ga0395898_0030947 Ga0395898_0030947_3708_4697 317
434 3300038443 Ga0395901_0006189 Ga0395901_0006189_1487_2476 317
435 3300042005 Ga0439448_0000114 Ga0439448_0000114_1866_2828 317
436 3300042005 Ga0439448_0009599 Ga0439448_0009599_642_1601 317
437 3300042012 Ga0439455_0000039 Ga0439455_0000039_8779_9741 317
438 3300042157 Ga0439458_0000037 Ga0439458_0000037_1961_2923 317
439 3300042157 Ga0439458_0001251 Ga0439458_0001251_3245_4204 317
440 3300046542 Ga0495597_0002879 Ga0495597_0002879_663_1619 317
441 3300046616 Ga0495668_0016112 Ga0495668_0016112_1069_2025 317
442 3300047470 Ga0495681_0087104 Ga0495681_0087104_297_1253 317
443 3300050509 nmdc:mga0qj67_12348_c1 nmdc:mga0qj67_12348_c1_3854_4828 317
444 3300053087 Ga0500643_001645 Ga0500643_001645_9280_10236 317
445 3300053093 Ga0500651_0003722 Ga0500651_0003722_4243_5199 317
446 3300053096 Ga0500641_0007726 Ga0500641_0007726_2500_3456 317
447 3300053133 Ga0500655_000091 Ga0500655_000091_9987_10943 317
448 3300053136 Ga0500559_0031708 Ga0500559_0031708_222_1178 317
449 3300053148 Ga0500590_000125 Ga0500590_000125_10704_11660 317
450 3300001989 JGI24739J22299_10002707 JGI24739J22299_100027072 318
451 3300001990 JGI24737J22298_10001181 JGI24737J22298_1000118113 318
452 3300001990 JGI24737J22298_10019798 JGI24737J22298_100197982 318
453 3300002067 JGI24735J21928_10010376 JGI24735J21928_100103762 318
454 3300002075 JGI24738J21930_10000327 JGI24738J21930_1000032713 318
455 3300005457 Ga0070662_100070971 Ga0070662_1000709713 318
456 3300009176 Ga0105242_10322425 Ga0105242_103224251 318
457 3300009545 Ga0105237_10194246 Ga0105237_101942463 318
458 3300013307 Ga0157372_10562976 Ga0157372_105629762 318
459 3300025254 Ga0209148_1000147 Ga0209148_1000147105 318
460 3300025904 Ga0207647_10005017 Ga0207647_100050175 318
461 3300025914 Ga0207671_10122372 Ga0207671_101223721 318
462 3300025933 Ga0207706_10005304 Ga0207706_100053047 318
463 3300025942 Ga0207689_10165729 Ga0207689_101657292 318
464 3300046694 Ga0495649_0036870 Ga0495649_0036870_449_1423 319
465 3300053116 Ga0500592_000096 Ga0500592_000096_7526_8497 319
466 3300053158 Ga0500627_0000119 Ga0500627_0000119_10917_11888 319
467 3300005355 Ga0070671_100001027 Ga0070671_1000010275 320
468 3300005445 Ga0070708_100259127 Ga0070708_1002591272 320
469 3300005841 Ga0068863_100000131 Ga0068863_10000013175 320
470 3300005843 Ga0068860_100092971 Ga0068860_1000929712 320
471 3300025315 Ga0207697_10010476 Ga0207697_100104763 320
472 3300025931 Ga0207644_10000468 Ga0207644_100004689 320
473 3300026088 Ga0207641_10000004 Ga0207641_10000004320 320
474 3300028380 Ga0268265_10009732 Ga0268265_100097323 320
475 3300005937 Ga0081455_10000131 Ga0081455_1000013111 321
476 3300001904 JGI24736J21556_1000015 JGI24736J21556_100001528 322
477 3300001976 JGI24752J21851_1000049 JGI24752J21851_10000497 322
478 3300001976 JGI24752J21851_1000292 JGI24752J21851_10002924 322
479 3300001979 JGI24740J21852_10013955 JGI24740J21852_100139553 322
480 3300001979 JGI24740J21852_10037279 JGI24740J21852_100372792 322
481 3300001989 JGI24739J22299_10036742 JGI24739J22299_100367421 322
482 3300001990 JGI24737J22298_10002130 JGI24737J22298_100021302 322
483 3300002070 JGI24750J21931_1000468 JGI24750J21931_10004684 322
484 3300002074 JGI24748J21848_1000023 JGI24748J21848_100002358 322
485 3300002076 JGI24749J21850_1003108 JGI24749J21850_10031082 322
486 3300002239 JGI24034J26672_10000010 JGI24034J26672_1000001050 322
487 3300002244 JGI24742J22300_10000379 JGI24742J22300_100003795 322
488 3300005289 Ga0065704_10074031 Ga0065704_100740313 322
489 3300005295 Ga0065707_10000756 Ga0065707_1000075611 322
490 3300005330 Ga0070690_100000055 Ga0070690_10000005538 322
491 3300005331 Ga0070670_100003689 Ga0070670_1000036896 322
492 3300005331 Ga0070670_100019603 Ga0070670_1000196033 322
493 3300005335 Ga0070666_10000009 Ga0070666_10000009208 322
494 3300005339 Ga0070660_100225084 Ga0070660_1002250842 322
495 3300005344 Ga0070661_100081195 Ga0070661_1000811951 322
496 3300005347 Ga0070668_100254690 Ga0070668_1002546902 322
497 3300005353 Ga0070669_100000017 Ga0070669_10000001776 322
498 3300005355 Ga0070671_100008047 Ga0070671_1000080473 322
499 3300005365 Ga0070688_100001642 Ga0070688_1000016428 322
500 3300005366 Ga0070659_100377530 Ga0070659_1003775301 322
501 3300005367 Ga0070667_100005285 Ga0070667_1000052856 322
502 3300005367 Ga0070667_100016118 Ga0070667_1000161183 322
503 3300005455 Ga0070663_100128828 Ga0070663_1001288282 322
504 3300005457 Ga0070662_100026537 Ga0070662_1000265373 322
505 3300005457 Ga0070662_100072153 Ga0070662_1000721532 322
506 3300005457 Ga0070662_100280455 Ga0070662_1002804552 322
507 3300005539 Ga0068853_100017709 Ga0068853_1000177098 322
508 3300005544 Ga0070686_100000041 Ga0070686_10000004146 322
509 3300005548 Ga0070665_100000368 Ga0070665_1000003688 322
510 3300005617 Ga0068859_100018363 Ga0068859_1000183635 322
511 3300005617 Ga0068859_100060919 Ga0068859_1000609191 322
512 3300005618 Ga0068864_100003451 Ga0068864_1000034516 322
513 3300005618 Ga0068864_100053745 Ga0068864_1000537453 322
514 3300005719 Ga0068861_100000441 Ga0068861_1000004414 322
515 3300005841 Ga0068863_100000705 Ga0068863_10000070510 322
516 3300005841 Ga0068863_100005275 Ga0068863_1000052756 322
517 3300005842 Ga0068858_100000637 Ga0068858_10000063733 322
518 3300005842 Ga0068858_100400496 Ga0068858_1004004962 322
519 3300005843 Ga0068860_100000022 Ga0068860_100000022208 322
520 3300005844 Ga0068862_100000596 Ga0068862_10000059615 322
521 3300005844 Ga0068862_100003863 Ga0068862_1000038636 322
522 3300006931 Ga0097620_100018363 Ga0097620_1000183635 322
523 3300006931 Ga0097620_100060922 Ga0097620_1000609221 322
524 3300009011 Ga0105251_10002945 Ga0105251_100029456 322
525 3300009101 Ga0105247_10002517 Ga0105247_1000251710 322
526 3300009174 Ga0105241_10305683 Ga0105241_103056832 322
527 3300009177 Ga0105248_10000026 Ga0105248_1000002620 322
528 3300009545 Ga0105237_10194254 Ga0105237_101942542 322
529 3300009551 Ga0105238_10100915 Ga0105238_101009151 322
530 3300009551 Ga0105238_10197562 Ga0105238_101975622 322
531 3300009553 Ga0105249_10000123 Ga0105249_100001234 322
532 3300010375 Ga0105239_10780243 Ga0105239_107802431 322
533 3300013297 Ga0157378_10048869 Ga0157378_100488693 322
534 3300013306 Ga0163162_10015641 Ga0163162_100156413 322
535 3300014325 Ga0163163_10028778 Ga0163163_100287785 322
536 3300014325 Ga0163163_10301473 Ga0163163_103014732 322
537 3300014326 Ga0157380_10000063 Ga0157380_1000006320 322
538 3300014326 Ga0157380_10005568 Ga0157380_100055685 322
539 3300014968 Ga0157379_10010303 Ga0157379_100103037 322
540 3300017792 Ga0163161_10000057 Ga0163161_10000057106 322
541 3300025223 Ga0207672_1000345 Ga0207672_10003453 322
542 3300025735 Ga0207713_1001272 Ga0207713_10012723 322
543 3300025900 Ga0207710_10047475 Ga0207710_100474752 322
544 3300025903 Ga0207680_10000007 Ga0207680_1000000770 322
545 3300025904 Ga0207647_10024607 Ga0207647_100246073 322
546 3300025911 Ga0207654_10002475 Ga0207654_100024753 322
547 3300025913 Ga0207695_10004592 Ga0207695_1000459220 322
548 3300025914 Ga0207671_10001130 Ga0207671_1000113010 322
549 3300025919 Ga0207657_10124035 Ga0207657_101240352 322
550 3300025919 Ga0207657_10124092 Ga0207657_101240922 322
551 3300025923 Ga0207681_10000029 Ga0207681_10000029117 322
552 3300025924 Ga0207694_10000589 Ga0207694_1000058929 322
553 3300025924 Ga0207694_10115523 Ga0207694_101155232 322
554 3300025925 Ga0207650_10001245 Ga0207650_100012453 322
555 3300025925 Ga0207650_10015378 Ga0207650_100153783 322
556 3300025931 Ga0207644_10000121 Ga0207644_100001216 322
557 3300025933 Ga0207706_10032956 Ga0207706_100329562 322
558 3300025933 Ga0207706_10036849 Ga0207706_100368493 322
559 3300025941 Ga0207711_10000004 Ga0207711_1000000434 322
560 3300025941 Ga0207711_10034550 Ga0207711_100345503 322
561 3300025944 Ga0207661_10260147 Ga0207661_102601472 322
562 3300025949 Ga0207667_10041478 Ga0207667_100414784 322
563 3300025961 Ga0207712_10000004 Ga0207712_1000000458 322
564 3300025961 Ga0207712_10000102 Ga0207712_100001024 322
565 3300025972 Ga0207668_10228538 Ga0207668_102285382 322
566 3300025981 Ga0207640_10045130 Ga0207640_100451302 322
567 3300025986 Ga0207658_10000462 Ga0207658_1000046215 322
568 3300025986 Ga0207658_10002693 Ga0207658_100026936 322
569 3300026035 Ga0207703_10003457 Ga0207703_1000345715 322
570 3300026035 Ga0207703_10127394 Ga0207703_101273942 322
571 3300026041 Ga0207639_10004903 Ga0207639_100049032 322
572 3300026041 Ga0207639_10067713 Ga0207639_100677132 322
573 3300026041 Ga0207639_10352757 Ga0207639_103527572 322
574 3300026067 Ga0207678_10023713 Ga0207678_100237132 322
575 3300026078 Ga0207702_10006618 Ga0207702_100066185 322
576 3300026078 Ga0207702_10393948 Ga0207702_103939482 322
577 3300026088 Ga0207641_10000263 Ga0207641_1000026320 322
578 3300026088 Ga0207641_10001006 Ga0207641_1000100621 322
579 3300026095 Ga0207676_10002192 Ga0207676_100021928 322
580 3300026095 Ga0207676_10012220 Ga0207676_100122203 322
581 3300026116 Ga0207674_10160738 Ga0207674_101607382 322
582 3300026116 Ga0207674_10174914 Ga0207674_101749142 322
583 3300026116 Ga0207674_10416303 Ga0207674_104163032 322
584 3300026118 Ga0207675_100000131 Ga0207675_10000013118 322
585 3300026142 Ga0207698_10132403 Ga0207698_101324032 322
586 3300028379 Ga0268266_10000117 Ga0268266_10000117156 322
587 3300028380 Ga0268265_10000266 Ga0268265_1000026639 322
588 3300028380 Ga0268265_10002836 Ga0268265_100028364 322
589 3300028381 Ga0268264_10000003 Ga0268264_1000000372 322
590 3300031911 Ga0307412_10028705 Ga0307412_100287052 322
591 3300046525 Ga0495663_0004218 Ga0495663_0004218_2662_3630 322
592 3300046530 Ga0495654_0003096 Ga0495654_0003096_8696_9664 322
593 3300046616 Ga0495668_0000989 Ga0495668_0000989_23631_24599 322
594 3300048904 Ga0496101_0061575 Ga0496101_0061575_890_1858 322
595 3300048905 Ga0496102_0007301 Ga0496102_0007301_4313_5287 322
596 3300048905 Ga0496102_0279022 Ga0496102_0279022_462_1430 322
597 3300048906 Ga0496103_0039583 Ga0496103_0039583_215_1183 322
598 3300048907 Ga0496104_0010865 Ga0496104_0010865_5880_6854 322
599 3300048908 Ga0496105_0039921 Ga0496105_0039921_2588_3562 322
600 3300048909 Ga0496106_0054464 Ga0496106_0054464_1996_2970 322
601 3300048913 Ga0496110_0151791 Ga0496110_0151791_315_1289 322
602 3300048919 Ga0496116_0086824 Ga0496116_0086824_510_1484 322
603 3300048920 Ga0496117_0002856 Ga0496117_0002856_18553_19527 322
604 3300048920 Ga0496117_0015664 Ga0496117_0015664_2019_2987 322
605 3300048921 Ga0496118_0001042 Ga0496118_0001042_33174_34142 322
606 3300048921 Ga0496118_0089039 Ga0496118_0089039_194_1168 322
607 3300048923 Ga0496120_0146545 Ga0496120_0146545_85_1059 322
608 3300048927 Ga0496124_0092797 Ga0496124_0092797_829_1803 322
609 3300053116 Ga0500592_000854 Ga0500592_000854_1381_2352 322
610 3300053158 Ga0500627_0000371 Ga0500627_0000371_9083_10051 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

158

329

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8663 131 321
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7619 128 316
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7583 128 318
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.739 131 321
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7264 133 316
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9486 128 321 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9393 125 318 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.937 133 317 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9326 128 316 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9316 131 317 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A530M5U9-F1-model_v4 deleted 0.9738 143 287
AF-A0A485EKB7-F1-model_v4 deleted 0.963 198 321
AF-A0A530M5U9-F1-model_v4 deleted 0.9545 143 287
AF-A0A531JBF7-F1-model_v4 ABC transporter permease subunit 0.953 193 321 GO:0005886
GO:0010438
GO:0055085
AF-A0A090RDL0-F1-model_v4 deleted 0.9385 167 321

Feature Viewer

pLDDT pTM Quality
78.93 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map