F468965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 610 | 260 | 608 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10322425|Ga0105242_103224251 |
| Length | 331 |
| Sequence | MNTQPISSEPLPVPASVAGTSAAKSPAEIIPHPNPPSAARLSQMAXXXXPPASRLSGYLAELPDRLRSVATTVLPTIVTLCALLIVWQFICGGEGSSLPSPLKIWTESHDLIVHPFKGVSLDFGGLHIAEGGDVGIAGHIIASLKRVAMGYGLAAIAGIALGILIGQSVIAYRALDPLFQVLRTIPPLAWLPISLAIFQQAGPSTVFLIFITAIWPVILNTAAGVQAMPPTYRNVARVLALRPTTYFFRIMLPATVPYMFTGLRISVGMSWLAIVAAEMVQGGAGIGFFIWDSYNSSLLTDTIVALVWIGMVGFTLDRLVAWIGRRIAHQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 165 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 166 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 167 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 168 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 206 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 207 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 208 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 209 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 212 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 216 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 217 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 218 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 219 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 220 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 223 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 224 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 231 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 232 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 236 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 237 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 239 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 240 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 245 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 246 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 247 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 248 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 249 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 253 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 256 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 259 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.33 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.59 |
| Nodule | 0 |
| Rhizoplane | 4.26 |
| Rhizosphere | 87.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000015 | 3300001904 | Bacteria | 28999 |
| 2 | JGI24736J21556_1000376 | 3300001904 | Bacteria | 8442 |
| 3 | JGI24741J21665_1000325 | 3300001915 | Bacteria | 14260 |
| 4 | JGI24752J21851_1000049 | 3300001976 | Bacteria | 14646 |
| 5 | JGI24752J21851_1000292 | 3300001976 | Bacteria | 7003 |
| 6 | JGI24740J21852_10000356 | 3300001979 | Bacteria | 19617 |
| 7 | JGI24740J21852_10013955 | 3300001979 | Bacteria | 2978 |
| 8 | JGI24740J21852_10037279 | 3300001979 | Bacteria | 1502 |
| 9 | JGI24739J22299_10002707 | 3300001989 | Bacteria | 6820 |
| 10 | JGI24739J22299_10017157 | 3300001989 | Bacteria | 2615 |
| 11 | JGI24739J22299_10036742 | 3300001989 | Bacteria | 1653 |
| 12 | JGI24737J22298_10001009 | 3300001990 | Bacteria | 9974 |
| 13 | JGI24737J22298_10001181 | 3300001990 | Bacteria | 9201 |
| 14 | JGI24737J22298_10002130 | 3300001990 | Bacteria | 7052 |
| 15 | JGI24737J22298_10005404 | 3300001990 | Bacteria | 4415 |
| 16 | JGI24737J22298_10019798 | 3300001990 | Bacteria | 2152 |
| 17 | JGI24735J21928_10005899 | 3300002067 | Bacteria | 4049 |
| 18 | JGI24735J21928_10010376 | 3300002067 | Bacteria | 2973 |
| 19 | JGI24750J21931_1000468 | 3300002070 | Bacteria | 6462 |
| 20 | JGI24748J21848_1000023 | 3300002074 | Bacteria | 106523 |
| 21 | JGI24738J21930_10000327 | 3300002075 | Bacteria | 13102 |
| 22 | JGI24738J21930_10003551 | 3300002075 | Bacteria | 3913 |
| 23 | JGI24749J21850_1000033 | 3300002076 | Bacteria | 25902 |
| 24 | JGI24749J21850_1003108 | 3300002076 | Bacteria | 2317 |
| 25 | JGI24744J21845_10022409 | 3300002077 | Bacteria | 1241 |
| 26 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 27 | JGI24034J26672_10019022 | 3300002239 | Bacteria | 1069 |
| 28 | JGI24742J22300_10000379 | 3300002244 | Bacteria | 6560 |
| 29 | JGI24751J29686_10000046 | 3300002459 | Bacteria | 73259 |
| 30 | rootH1_10040862 | 3300003323 | Bacteria | 5300 |
| 31 | Ga0055542_1001654 | 3300003762 | Bacteria | 9990 |
| 32 | Ga0065704_10074031 | 3300005289 | Bacteria | 6587 |
| 33 | Ga0065704_10084088 | 3300005289 | Bacteria | 3373 |
| 34 | Ga0065707_10000756 | 3300005295 | Bacteria | 21029 |
| 35 | Ga0065707_10084013 | 3300005295 | Bacteria | 7823 |
| 36 | Ga0070658_10003723 | 3300005327 | Bacteria | 12473 |
| 37 | Ga0070676_10005501 | 3300005328 | Bacteria | 6745 |
| 38 | Ga0070690_100000055 | 3300005330 | Bacteria | 55023 |
| 39 | Ga0070670_100000006 | 3300005331 | Bacteria | 319420 |
| 40 | Ga0070670_100003689 | 3300005331 | Bacteria | 12758 |
| 41 | Ga0070670_100014302 | 3300005331 | Bacteria | 6809 |
| 42 | Ga0070670_100019603 | 3300005331 | Bacteria | 5806 |
| 43 | Ga0070670_100068597 | 3300005331 | Bacteria | 3043 |
| 44 | Ga0070670_100250667 | 3300005331 | Bacteria | 1542 |
| 45 | Ga0068869_100000031 | 3300005334 | Bacteria | 60884 |
| 46 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 47 | Ga0070666_10004989 | 3300005335 | Bacteria | 8118 |
| 48 | Ga0070666_10061827 | 3300005335 | Bacteria | 2536 |
| 49 | Ga0070666_10092046 | 3300005335 | Bacteria | 2084 |
| 50 | Ga0070666_10095505 | 3300005335 | Bacteria | 2046 |
| 51 | Ga0068868_100000060 | 3300005338 | Bacteria | 61952 |
| 52 | Ga0070660_100225084 | 3300005339 | Bacteria | 1525 |
| 53 | Ga0070689_100124649 | 3300005340 | Bacteria | 2060 |
| 54 | Ga0070661_100081195 | 3300005344 | Bacteria | 2393 |
| 55 | Ga0070661_100141800 | 3300005344 | Bacteria | 1811 |
| 56 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 57 | Ga0070668_100000815 | 3300005347 | Bacteria | 21478 |
| 58 | Ga0070668_100039604 | 3300005347 | Bacteria | 3603 |
| 59 | Ga0070668_100109352 | 3300005347 | Bacteria | 2199 |
| 60 | Ga0070668_100214518 | 3300005347 | Bacteria | 1585 |
| 61 | Ga0070668_100254690 | 3300005347 | Bacteria | 1458 |
| 62 | Ga0070669_100000017 | 3300005353 | Bacteria | 195995 |
| 63 | Ga0070669_100000102 | 3300005353 | Bacteria | 82010 |
| 64 | Ga0070669_100001143 | 3300005353 | Bacteria | 19370 |
| 65 | Ga0070669_100006890 | 3300005353 | Bacteria | 8166 |
| 66 | Ga0070669_100204575 | 3300005353 | Bacteria | 1555 |
| 67 | Ga0070675_100014931 | 3300005354 | Bacteria | 6133 |
| 68 | Ga0070671_100000034 | 3300005355 | Bacteria | 101038 |
| 69 | Ga0070671_100000040 | 3300005355 | Bacteria | 92357 |
| 70 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 71 | Ga0070671_100001027 | 3300005355 | Bacteria | 20510 |
| 72 | Ga0070671_100008047 | 3300005355 | Bacteria | 8440 |
| 73 | Ga0070671_100030576 | 3300005355 | Bacteria | 4444 |
| 74 | Ga0070671_100096957 | 3300005355 | Bacteria | 2473 |
| 75 | Ga0070674_100011647 | 3300005356 | Bacteria | 5361 |
| 76 | Ga0070674_100074716 | 3300005356 | Bacteria | 2406 |
| 77 | Ga0070674_100215238 | 3300005356 | Bacteria | 1492 |
| 78 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 79 | Ga0070688_100001642 | 3300005365 | Bacteria | 11198 |
| 80 | Ga0070659_100009830 | 3300005366 | Bacteria | 7034 |
| 81 | Ga0070659_100261767 | 3300005366 | Bacteria | 1435 |
| 82 | Ga0070659_100377530 | 3300005366 | Bacteria | 1193 |
| 83 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 84 | Ga0070667_100000076 | 3300005367 | Bacteria | 120555 |
| 85 | Ga0070667_100000692 | 3300005367 | Bacteria | 32510 |
| 86 | Ga0070667_100003424 | 3300005367 | Bacteria | 13510 |
| 87 | Ga0070667_100005285 | 3300005367 | Bacteria | 10792 |
| 88 | Ga0070667_100005856 | 3300005367 | Bacteria | 10257 |
| 89 | Ga0070667_100016118 | 3300005367 | Bacteria | 6182 |
| 90 | Ga0070705_100012769 | 3300005440 | Bacteria | 4280 |
| 91 | Ga0070708_100259127 | 3300005445 | Bacteria | 1635 |
| 92 | Ga0070663_100004783 | 3300005455 | Bacteria | 7986 |
| 93 | Ga0070663_100007749 | 3300005455 | Bacteria | 6558 |
| 94 | Ga0070663_100128828 | 3300005455 | Bacteria | 1919 |
| 95 | Ga0070662_100008232 | 3300005457 | Bacteria | 6790 |
| 96 | Ga0070662_100024596 | 3300005457 | Bacteria | 4151 |
| 97 | Ga0070662_100026537 | 3300005457 | Bacteria | 4013 |
| 98 | Ga0070662_100044512 | 3300005457 | Bacteria | 3180 |
| 99 | Ga0070662_100070971 | 3300005457 | Bacteria | 2567 |
| 100 | Ga0070662_100072153 | 3300005457 | Bacteria | 2548 |
| 101 | Ga0070662_100280455 | 3300005457 | Bacteria | 1348 |
| 102 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 103 | Ga0070685_10080002 | 3300005466 | Bacteria | 1957 |
| 104 | Ga0068853_100004448 | 3300005539 | Bacteria | 10860 |
| 105 | Ga0068853_100014991 | 3300005539 | Bacteria | 6368 |
| 106 | Ga0068853_100017709 | 3300005539 | Bacteria | 5879 |
| 107 | Ga0068853_100273547 | 3300005539 | Bacteria | 1556 |
| 108 | Ga0070672_100025226 | 3300005543 | Bacteria | 4407 |
| 109 | Ga0070686_100000041 | 3300005544 | Bacteria | 104174 |
| 110 | Ga0070686_100104625 | 3300005544 | Bacteria | 1918 |
| 111 | Ga0070665_100000368 | 3300005548 | Bacteria | 67541 |
| 112 | Ga0070665_100049328 | 3300005548 | Bacteria | 4224 |
| 113 | Ga0070665_100142939 | 3300005548 | Bacteria | 2396 |
| 114 | Ga0070665_100327622 | 3300005548 | Bacteria | 1536 |
| 115 | Ga0070665_100404532 | 3300005548 | Bacteria | 1373 |
| 116 | Ga0068855_100001164 | 3300005563 | Bacteria | 32603 |
| 117 | Ga0068855_100005469 | 3300005563 | Bacteria | 15499 |
| 118 | Ga0068855_100145237 | 3300005563 | Bacteria | 2701 |
| 119 | Ga0068855_100160958 | 3300005563 | Bacteria | 2548 |
| 120 | Ga0070664_100009350 | 3300005564 | Bacteria | 7946 |
| 121 | Ga0068857_100005402 | 3300005577 | Bacteria | 10893 |
| 122 | Ga0068857_100010757 | 3300005577 | Bacteria | 7963 |
| 123 | Ga0068854_100003204 | 3300005578 | Bacteria | 10212 |
| 124 | Ga0068854_100037700 | 3300005578 | Bacteria | 3394 |
| 125 | Ga0068856_100009439 | 3300005614 | Bacteria | 9474 |
| 126 | Ga0068856_100160218 | 3300005614 | Bacteria | 2260 |
| 127 | Ga0068852_100001541 | 3300005616 | Bacteria | 15633 |
| 128 | Ga0068852_100212228 | 3300005616 | Bacteria | 1837 |
| 129 | Ga0068859_100001942 | 3300005617 | Bacteria | 21088 |
| 130 | Ga0068859_100018363 | 3300005617 | Bacteria | 7030 |
| 131 | Ga0068859_100060919 | 3300005617 | Bacteria | 3802 |
| 132 | Ga0068859_100080679 | 3300005617 | Bacteria | 3295 |
| 133 | Ga0068859_100086954 | 3300005617 | Bacteria | 3173 |
| 134 | Ga0068859_100201774 | 3300005617 | Bacteria | 2073 |
| 135 | Ga0068859_100234921 | 3300005617 | Bacteria | 1922 |
| 136 | Ga0068864_100000014 | 3300005618 | Bacteria | 308927 |
| 137 | Ga0068864_100000218 | 3300005618 | Bacteria | 51909 |
| 138 | Ga0068864_100003451 | 3300005618 | Bacteria | 13065 |
| 139 | Ga0068864_100004287 | 3300005618 | Bacteria | 11726 |
| 140 | Ga0068864_100039341 | 3300005618 | Bacteria | 4042 |
| 141 | Ga0068864_100049025 | 3300005618 | Bacteria | 3632 |
| 142 | Ga0068864_100053745 | 3300005618 | Bacteria | 3475 |
| 143 | Ga0068861_100000007 | 3300005719 | Bacteria | 86469 |
| 144 | Ga0068861_100000441 | 3300005719 | Bacteria | 24079 |
| 145 | Ga0068861_100003012 | 3300005719 | Bacteria | 11118 |
| 146 | Ga0068861_100061595 | 3300005719 | Bacteria | 2880 |
| 147 | Ga0068851_10062517 | 3300005834 | Bacteria | 1910 |
| 148 | Ga0068863_100000006 | 3300005841 | Bacteria | 265379 |
| 149 | Ga0068863_100000131 | 3300005841 | Bacteria | 79059 |
| 150 | Ga0068863_100000705 | 3300005841 | Bacteria | 33651 |
| 151 | Ga0068863_100003894 | 3300005841 | Bacteria | 14746 |
| 152 | Ga0068863_100005111 | 3300005841 | Bacteria | 12936 |
| 153 | Ga0068863_100005275 | 3300005841 | Bacteria | 12758 |
| 154 | Ga0068863_100006871 | 3300005841 | Bacteria | 11152 |
| 155 | Ga0068863_100063552 | 3300005841 | Bacteria | 3491 |
| 156 | Ga0068863_100100122 | 3300005841 | Bacteria | 2754 |
| 157 | Ga0068863_100146767 | 3300005841 | Bacteria | 2256 |
| 158 | Ga0068858_100000352 | 3300005842 | Bacteria | 48455 |
| 159 | Ga0068858_100000637 | 3300005842 | Bacteria | 36537 |
| 160 | Ga0068858_100003305 | 3300005842 | Bacteria | 16053 |
| 161 | Ga0068858_100006275 | 3300005842 | Bacteria | 11582 |
| 162 | Ga0068858_100006825 | 3300005842 | Bacteria | 11106 |
| 163 | Ga0068858_100015300 | 3300005842 | Bacteria | 7218 |
| 164 | Ga0068858_100400496 | 3300005842 | Bacteria | 1319 |
| 165 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 166 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 167 | Ga0068860_100000119 | 3300005843 | Bacteria | 127040 |
| 168 | Ga0068860_100000131 | 3300005843 | Bacteria | 121109 |
| 169 | Ga0068860_100013681 | 3300005843 | Bacteria | 7955 |
| 170 | Ga0068860_100092971 | 3300005843 | Bacteria | 2874 |
| 171 | Ga0068862_100000007 | 3300005844 | Bacteria | 313933 |
| 172 | Ga0068862_100000596 | 3300005844 | Bacteria | 37603 |
| 173 | Ga0068862_100003863 | 3300005844 | Bacteria | 12758 |
| 174 | Ga0068862_100008677 | 3300005844 | Bacteria | 8407 |
| 175 | Ga0068862_100009271 | 3300005844 | Bacteria | 8146 |
| 176 | Ga0068862_100192460 | 3300005844 | Bacteria | 1836 |
| 177 | Ga0081455_10000131 | 3300005937 | Bacteria | 87553 |
| 178 | Ga0097621_100001876 | 3300006237 | Bacteria | 14391 |
| 179 | Ga0075370_10012882 | 3300006353 | Bacteria | 4430 |
| 180 | Ga0068871_100062791 | 3300006358 | Bacteria | 3037 |
| 181 | Ga0075430_100036204 | 3300006846 | Bacteria | 4185 |
| 182 | Ga0068865_100000014 | 3300006881 | Bacteria | 138727 |
| 183 | Ga0097620_100001942 | 3300006931 | Bacteria | 21088 |
| 184 | Ga0097620_100018363 | 3300006931 | Bacteria | 7030 |
| 185 | Ga0097620_100060922 | 3300006931 | Bacteria | 3802 |
| 186 | Ga0097620_100080678 | 3300006931 | Bacteria | 3295 |
| 187 | Ga0097620_100086955 | 3300006931 | Bacteria | 3173 |
| 188 | Ga0097620_100201770 | 3300006931 | Bacteria | 2073 |
| 189 | Ga0097620_100234932 | 3300006931 | Bacteria | 1922 |
| 190 | Ga0105251_10002945 | 3300009011 | Bacteria | 12764 |
| 191 | Ga0105251_10020882 | 3300009011 | Bacteria | 3432 |
| 192 | Ga0105240_10097192 | 3300009093 | Bacteria | 3589 |
| 193 | Ga0105245_10000160 | 3300009098 | Bacteria | 63445 |
| 194 | Ga0105245_10000357 | 3300009098 | Bacteria | 42661 |
| 195 | Ga0105247_10002517 | 3300009101 | Bacteria | 12450 |
| 196 | Ga0105247_10004689 | 3300009101 | Bacteria | 8710 |
| 197 | Ga0114129_10096454 | 3300009147 | Bacteria | 4094 |
| 198 | Ga0105243_10000070 | 3300009148 | Bacteria | 120851 |
| 199 | Ga0105243_10043313 | 3300009148 | Bacteria | 3527 |
| 200 | Ga0105241_10002084 | 3300009174 | Bacteria | 15106 |
| 201 | Ga0105241_10305683 | 3300009174 | Bacteria | 1366 |
| 202 | Ga0105242_10001604 | 3300009176 | Bacteria | 17808 |
| 203 | Ga0105242_10322425 | 3300009176 | Bacteria | 1417 |
| 204 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 205 | Ga0105248_10000139 | 3300009177 | Bacteria | 84082 |
| 206 | Ga0105248_10000723 | 3300009177 | Bacteria | 37295 |
| 207 | Ga0105248_10003764 | 3300009177 | Bacteria | 16798 |
| 208 | Ga0105248_10017214 | 3300009177 | Bacteria | 7963 |
| 209 | Ga0105248_10098411 | 3300009177 | Bacteria | 3296 |
| 210 | Ga0105248_10438920 | 3300009177 | Bacteria | 1471 |
| 211 | Ga0105237_10132101 | 3300009545 | Bacteria | 2491 |
| 212 | Ga0105237_10194246 | 3300009545 | Bacteria | 2029 |
| 213 | Ga0105237_10194254 | 3300009545 | Bacteria | 2029 |
| 214 | Ga0105238_10100915 | 3300009551 | Bacteria | 2869 |
| 215 | Ga0105238_10197562 | 3300009551 | Bacteria | 1987 |
| 216 | Ga0105249_10000123 | 3300009553 | Bacteria | 104747 |
| 217 | Ga0105249_10015328 | 3300009553 | Bacteria | 6783 |
| 218 | Ga0105249_10351388 | 3300009553 | Bacteria | 1494 |
| 219 | Ga0105239_10083094 | 3300010375 | Bacteria | 3526 |
| 220 | Ga0105239_10084115 | 3300010375 | Bacteria | 3504 |
| 221 | Ga0105239_10780243 | 3300010375 | Bacteria | 1094 |
| 222 | Ga0105246_10003501 | 3300011119 | Bacteria | 9510 |
| 223 | Ga0105246_10034604 | 3300011119 | Bacteria | 3368 |
| 224 | Ga0105246_10159649 | 3300011119 | Bacteria | 1716 |
| 225 | Ga0157373_10025286 | 3300013100 | Bacteria | 4296 |
| 226 | Ga0157373_10029633 | 3300013100 | Bacteria | 3941 |
| 227 | Ga0157371_10124823 | 3300013102 | Bacteria | 1831 |
| 228 | Ga0157370_10130541 | 3300013104 | Bacteria | 2344 |
| 229 | Ga0157374_10000542 | 3300013296 | Bacteria | 33699 |
| 230 | Ga0157378_10000624 | 3300013297 | Bacteria | 33307 |
| 231 | Ga0157378_10048869 | 3300013297 | Bacteria | 3762 |
| 232 | Ga0163162_10008224 | 3300013306 | Bacteria | 10181 |
| 233 | Ga0163162_10015641 | 3300013306 | Bacteria | 7415 |
| 234 | Ga0163162_10132289 | 3300013306 | Bacteria | 2604 |
| 235 | Ga0163162_10685138 | 3300013306 | Bacteria | 1147 |
| 236 | Ga0157372_10110927 | 3300013307 | Bacteria | 3142 |
| 237 | Ga0157372_10183836 | 3300013307 | Bacteria | 2420 |
| 238 | Ga0157372_10404699 | 3300013307 | Bacteria | 1590 |
| 239 | Ga0157372_10562976 | 3300013307 | Bacteria | 1328 |
| 240 | Ga0157375_10031485 | 3300013308 | Bacteria | 5015 |
| 241 | Ga0163163_10012217 | 3300014325 | Bacteria | 7817 |
| 242 | Ga0163163_10013315 | 3300014325 | Bacteria | 7526 |
| 243 | Ga0163163_10028778 | 3300014325 | Bacteria | 5340 |
| 244 | Ga0163163_10301473 | 3300014325 | Bacteria | 1655 |
| 245 | Ga0157380_10000014 | 3300014326 | Bacteria | 130737 |
| 246 | Ga0157380_10000063 | 3300014326 | Bacteria | 61666 |
| 247 | Ga0157380_10005568 | 3300014326 | Bacteria | 8805 |
| 248 | Ga0157377_10113948 | 3300014745 | Bacteria | 1629 |
| 249 | Ga0157379_10010303 | 3300014968 | Bacteria | 8139 |
| 250 | Ga0157379_10027676 | 3300014968 | Bacteria | 5047 |
| 251 | Ga0157379_10036808 | 3300014968 | Bacteria | 4363 |
| 252 | Ga0157376_10000096 | 3300014969 | Bacteria | 65482 |
| 253 | Ga0163161_10000057 | 3300017792 | Bacteria | 114339 |
| 254 | Ga0163161_10275590 | 3300017792 | Bacteria | 1318 |
| 255 | Ga0207672_1000345 | 3300025223 | Bacteria | 6128 |
| 256 | Ga0209148_1000147 | 3300025254 | Bacteria | 160231 |
| 257 | Ga0207697_10002475 | 3300025315 | Bacteria | 9551 |
| 258 | Ga0207697_10010476 | 3300025315 | Bacteria | 3961 |
| 259 | Ga0207713_1001272 | 3300025735 | Bacteria | 20765 |
| 260 | Ga0207710_10004442 | 3300025900 | Bacteria | 6124 |
| 261 | Ga0207710_10047475 | 3300025900 | Bacteria | 1919 |
| 262 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 263 | Ga0207680_10007925 | 3300025903 | Bacteria | 5193 |
| 264 | Ga0207680_10041387 | 3300025903 | Bacteria | 2688 |
| 265 | Ga0207647_10005017 | 3300025904 | Bacteria | 9754 |
| 266 | Ga0207647_10008523 | 3300025904 | Bacteria | 7343 |
| 267 | Ga0207647_10024607 | 3300025904 | Bacteria | 3968 |
| 268 | Ga0207647_10035600 | 3300025904 | Bacteria | 3171 |
| 269 | Ga0207645_10008376 | 3300025907 | Bacteria | 7213 |
| 270 | Ga0207705_10000042 | 3300025909 | Bacteria | 182120 |
| 271 | Ga0207654_10002475 | 3300025911 | Bacteria | 9385 |
| 272 | Ga0207654_10031228 | 3300025911 | Bacteria | 2932 |
| 273 | Ga0207695_10004592 | 3300025913 | Bacteria | 18760 |
| 274 | Ga0207671_10001130 | 3300025914 | Bacteria | 32130 |
| 275 | Ga0207671_10023283 | 3300025914 | Bacteria | 4672 |
| 276 | Ga0207671_10122372 | 3300025914 | Bacteria | 1989 |
| 277 | Ga0207657_10013142 | 3300025919 | Bacteria | 8130 |
| 278 | Ga0207657_10082983 | 3300025919 | Bacteria | 2689 |
| 279 | Ga0207657_10124035 | 3300025919 | Bacteria | 2123 |
| 280 | Ga0207657_10124092 | 3300025919 | Bacteria | 2122 |
| 281 | Ga0207649_10049967 | 3300025920 | Bacteria | 2585 |
| 282 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 283 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 284 | Ga0207681_10000029 | 3300025923 | Bacteria | 177260 |
| 285 | Ga0207681_10001400 | 3300025923 | Bacteria | 15582 |
| 286 | Ga0207681_10034705 | 3300025923 | Bacteria | 3318 |
| 287 | Ga0207681_10277872 | 3300025923 | Bacteria | 1317 |
| 288 | Ga0207694_10000589 | 3300025924 | Bacteria | 32787 |
| 289 | Ga0207694_10115523 | 3300025924 | Bacteria | 2138 |
| 290 | Ga0207694_10169129 | 3300025924 | Bacteria | 1769 |
| 291 | Ga0207650_10000023 | 3300025925 | Bacteria | 308148 |
| 292 | Ga0207650_10000657 | 3300025925 | Bacteria | 27265 |
| 293 | Ga0207650_10001245 | 3300025925 | Bacteria | 18514 |
| 294 | Ga0207650_10015378 | 3300025925 | Bacteria | 5328 |
| 295 | Ga0207650_10022933 | 3300025925 | Bacteria | 4423 |
| 296 | Ga0207650_10267614 | 3300025925 | Bacteria | 1388 |
| 297 | Ga0207687_10000252 | 3300025927 | Bacteria | 36302 |
| 298 | Ga0207687_10000323 | 3300025927 | Bacteria | 32543 |
| 299 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 300 | Ga0207644_10000033 | 3300025931 | Bacteria | 132384 |
| 301 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 302 | Ga0207644_10000121 | 3300025931 | Bacteria | 57269 |
| 303 | Ga0207644_10000468 | 3300025931 | Bacteria | 26068 |
| 304 | Ga0207644_10010698 | 3300025931 | Bacteria | 6050 |
| 305 | Ga0207644_10044438 | 3300025931 | Bacteria | 3156 |
| 306 | Ga0207690_10085978 | 3300025932 | Bacteria | 2209 |
| 307 | Ga0207690_10129207 | 3300025932 | Bacteria | 1847 |
| 308 | Ga0207690_10226345 | 3300025932 | Bacteria | 1434 |
| 309 | Ga0207706_10005304 | 3300025933 | Bacteria | 12019 |
| 310 | Ga0207706_10022176 | 3300025933 | Bacteria | 5700 |
| 311 | Ga0207706_10032956 | 3300025933 | Bacteria | 4610 |
| 312 | Ga0207706_10036849 | 3300025933 | Bacteria | 4344 |
| 313 | Ga0207706_10105772 | 3300025933 | Bacteria | 2476 |
| 314 | Ga0207706_10139817 | 3300025933 | Bacteria | 2130 |
| 315 | Ga0207686_10002334 | 3300025934 | Bacteria | 10371 |
| 316 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 317 | Ga0207709_10038576 | 3300025935 | Bacteria | 2846 |
| 318 | Ga0207669_10175222 | 3300025937 | Bacteria | 1531 |
| 319 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 320 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 321 | Ga0207704_10391481 | 3300025938 | Bacteria | 1094 |
| 322 | Ga0207691_10022342 | 3300025940 | Bacteria | 5967 |
| 323 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 324 | Ga0207711_10003786 | 3300025941 | Bacteria | 13015 |
| 325 | Ga0207711_10008095 | 3300025941 | Bacteria | 8800 |
| 326 | Ga0207711_10014506 | 3300025941 | Bacteria | 6549 |
| 327 | Ga0207711_10034550 | 3300025941 | Bacteria | 4281 |
| 328 | Ga0207711_10034963 | 3300025941 | Bacteria | 4257 |
| 329 | Ga0207711_10062552 | 3300025941 | Bacteria | 3210 |
| 330 | Ga0207711_10108136 | 3300025941 | Bacteria | 2470 |
| 331 | Ga0207711_10375462 | 3300025941 | Bacteria | 1319 |
| 332 | Ga0207689_10000060 | 3300025942 | Bacteria | 85326 |
| 333 | Ga0207689_10165729 | 3300025942 | Bacteria | 1821 |
| 334 | Ga0207661_10260147 | 3300025944 | Bacteria | 1546 |
| 335 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 336 | Ga0207667_10008884 | 3300025949 | Bacteria | 11890 |
| 337 | Ga0207667_10041478 | 3300025949 | Bacteria | 4894 |
| 338 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 339 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 340 | Ga0207712_10000102 | 3300025961 | Bacteria | 96444 |
| 341 | Ga0207712_10004665 | 3300025961 | Bacteria | 8661 |
| 342 | Ga0207712_10007169 | 3300025961 | Bacteria | 7030 |
| 343 | Ga0207712_10066820 | 3300025961 | Bacteria | 2571 |
| 344 | Ga0207712_10234294 | 3300025961 | Bacteria | 1475 |
| 345 | Ga0207668_10000029 | 3300025972 | Bacteria | 123784 |
| 346 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 347 | Ga0207668_10002224 | 3300025972 | Bacteria | 11311 |
| 348 | Ga0207668_10181195 | 3300025972 | Bacteria | 1662 |
| 349 | Ga0207668_10228538 | 3300025972 | Bacteria | 1498 |
| 350 | Ga0207640_10000695 | 3300025981 | Bacteria | 19606 |
| 351 | Ga0207640_10011693 | 3300025981 | Bacteria | 4975 |
| 352 | Ga0207640_10015659 | 3300025981 | Bacteria | 4394 |
| 353 | Ga0207640_10023945 | 3300025981 | Bacteria | 3677 |
| 354 | Ga0207640_10045130 | 3300025981 | Bacteria | 2828 |
| 355 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 356 | Ga0207658_10000094 | 3300025986 | Bacteria | 98638 |
| 357 | Ga0207658_10000462 | 3300025986 | Bacteria | 38001 |
| 358 | Ga0207658_10001289 | 3300025986 | Bacteria | 19824 |
| 359 | Ga0207658_10002693 | 3300025986 | Bacteria | 12831 |
| 360 | Ga0207658_10011568 | 3300025986 | Bacteria | 6007 |
| 361 | Ga0207677_10000231 | 3300026023 | Bacteria | 43615 |
| 362 | Ga0207703_10000630 | 3300026035 | Bacteria | 35501 |
| 363 | Ga0207703_10001574 | 3300026035 | Bacteria | 20688 |
| 364 | Ga0207703_10003457 | 3300026035 | Bacteria | 13224 |
| 365 | Ga0207703_10005308 | 3300026035 | Bacteria | 10384 |
| 366 | Ga0207703_10007341 | 3300026035 | Bacteria | 8760 |
| 367 | Ga0207703_10042209 | 3300026035 | Bacteria | 3658 |
| 368 | Ga0207703_10127394 | 3300026035 | Bacteria | 2194 |
| 369 | Ga0207639_10003463 | 3300026041 | Bacteria | 10614 |
| 370 | Ga0207639_10003882 | 3300026041 | Bacteria | 10075 |
| 371 | Ga0207639_10004222 | 3300026041 | Bacteria | 9682 |
| 372 | Ga0207639_10004903 | 3300026041 | Bacteria | 9018 |
| 373 | Ga0207639_10067713 | 3300026041 | Bacteria | 2779 |
| 374 | Ga0207639_10352757 | 3300026041 | Bacteria | 1314 |
| 375 | Ga0207678_10000404 | 3300026067 | Bacteria | 39097 |
| 376 | Ga0207678_10023713 | 3300026067 | Bacteria | 5366 |
| 377 | Ga0207702_10005874 | 3300026078 | Bacteria | 10670 |
| 378 | Ga0207702_10006618 | 3300026078 | Bacteria | 9969 |
| 379 | Ga0207702_10055754 | 3300026078 | Bacteria | 3353 |
| 380 | Ga0207702_10393948 | 3300026078 | Bacteria | 1334 |
| 381 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 382 | Ga0207641_10000054 | 3300026088 | Bacteria | 170887 |
| 383 | Ga0207641_10000263 | 3300026088 | Bacteria | 66525 |
| 384 | Ga0207641_10001006 | 3300026088 | Bacteria | 28784 |
| 385 | Ga0207641_10002254 | 3300026088 | Bacteria | 17975 |
| 386 | Ga0207641_10003954 | 3300026088 | Bacteria | 12949 |
| 387 | Ga0207641_10008512 | 3300026088 | Bacteria | 8478 |
| 388 | Ga0207641_10009407 | 3300026088 | Bacteria | 8052 |
| 389 | Ga0207641_10023359 | 3300026088 | Bacteria | 5094 |
| 390 | Ga0207641_10073932 | 3300026088 | Bacteria | 2938 |
| 391 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 392 | Ga0207676_10000017 | 3300026095 | Bacteria | 308709 |
| 393 | Ga0207676_10000169 | 3300026095 | Bacteria | 57208 |
| 394 | Ga0207676_10000696 | 3300026095 | Bacteria | 26511 |
| 395 | Ga0207676_10002192 | 3300026095 | Bacteria | 14077 |
| 396 | Ga0207676_10012220 | 3300026095 | Bacteria | 6146 |
| 397 | Ga0207676_10012270 | 3300026095 | Bacteria | 6133 |
| 398 | Ga0207676_10014589 | 3300026095 | Bacteria | 5657 |
| 399 | Ga0207676_10156766 | 3300026095 | Bacteria | 1968 |
| 400 | Ga0207674_10000308 | 3300026116 | Bacteria | 62120 |
| 401 | Ga0207674_10011602 | 3300026116 | Bacteria | 9898 |
| 402 | Ga0207674_10019102 | 3300026116 | Bacteria | 7430 |
| 403 | Ga0207674_10034252 | 3300026116 | Bacteria | 5312 |
| 404 | Ga0207674_10160738 | 3300026116 | Bacteria | 2201 |
| 405 | Ga0207674_10174914 | 3300026116 | Bacteria | 2099 |
| 406 | Ga0207674_10416303 | 3300026116 | Bacteria | 1298 |
| 407 | Ga0207675_100000131 | 3300026118 | Bacteria | 62791 |
| 408 | Ga0207675_100000147 | 3300026118 | Bacteria | 61195 |
| 409 | Ga0207675_100000891 | 3300026118 | Bacteria | 29831 |
| 410 | Ga0207675_100011955 | 3300026118 | Bacteria | 8111 |
| 411 | Ga0207698_10001072 | 3300026142 | Bacteria | 15905 |
| 412 | Ga0207698_10132403 | 3300026142 | Bacteria | 2133 |
| 413 | Ga0207698_10164486 | 3300026142 | Bacteria | 1945 |
| 414 | Ga0207698_10188365 | 3300026142 | Bacteria | 1835 |
| 415 | Ga0268266_10000117 | 3300028379 | Bacteria | 163515 |
| 416 | Ga0268266_10016659 | 3300028379 | Bacteria | 6280 |
| 417 | Ga0268266_10113660 | 3300028379 | Bacteria | 2401 |
| 418 | Ga0268266_10262887 | 3300028379 | Bacteria | 1600 |
| 419 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 420 | Ga0268265_10000266 | 3300028380 | Bacteria | 59618 |
| 421 | Ga0268265_10000357 | 3300028380 | Bacteria | 49395 |
| 422 | Ga0268265_10002836 | 3300028380 | Bacteria | 12746 |
| 423 | Ga0268265_10004816 | 3300028380 | Bacteria | 9303 |
| 424 | Ga0268265_10009732 | 3300028380 | Bacteria | 6488 |
| 425 | Ga0268265_10274487 | 3300028380 | Bacteria | 1505 |
| 426 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 427 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 428 | Ga0268264_10000128 | 3300028381 | Bacteria | 183164 |
| 429 | Ga0268264_10000204 | 3300028381 | Bacteria | 120959 |
| 430 | Ga0268264_10002511 | 3300028381 | Bacteria | 16129 |
| 431 | Ga0268264_10004853 | 3300028381 | Bacteria | 11395 |
| 432 | Ga0307408_100087280 | 3300031548 | Bacteria | 2346 |
| 433 | Ga0307508_10000960 | 3300031616 | Bacteria | 33550 |
| 434 | Ga0307410_10118174 | 3300031852 | Bacteria | 1929 |
| 435 | Ga0307410_10170247 | 3300031852 | Bacteria | 1640 |
| 436 | Ga0307406_10045872 | 3300031901 | Bacteria | 2747 |
| 437 | Ga0307412_10005555 | 3300031911 | Bacteria | 7082 |
| 438 | Ga0307412_10028705 | 3300031911 | Bacteria | 3484 |
| 439 | Ga0307412_10037699 | 3300031911 | Bacteria | 3107 |
| 440 | Ga0307409_100013246 | 3300031995 | Bacteria | 5296 |
| 441 | Ga0307416_100213642 | 3300032002 | Bacteria | 1842 |
| 442 | Ga0307414_10041862 | 3300032004 | Bacteria | 3107 |
| 443 | Ga0307411_10275425 | 3300032005 | Bacteria | 1336 |
| 444 | Ga0307510_10016083 | 3300033180 | Bacteria | 8836 |
| 445 | Ga0395899_0074705 | 3300037312 | Bacteria | 2476 |
| 446 | Ga0395899_0080799 | 3300037312 | Bacteria | 2366 |
| 447 | Ga0395900_0002071 | 3300037418 | Bacteria | 22508 |
| 448 | Ga0395900_0026267 | 3300037418 | Bacteria | 5963 |
| 449 | Ga0395900_0187559 | 3300037418 | Bacteria | 2099 |
| 450 | Ga0395900_0397970 | 3300037418 | Bacteria | 1342 |
| 451 | Ga0395898_0030947 | 3300037466 | Bacteria | 5352 |
| 452 | Ga0395898_0250273 | 3300037466 | Bacteria | 1690 |
| 453 | Ga0395905_0003291 | 3300037471 | Bacteria | 17350 |
| 454 | Ga0395905_0007105 | 3300037471 | Bacteria | 11190 |
| 455 | Ga0395905_0015849 | 3300037471 | Bacteria | 7160 |
| 456 | Ga0395905_0016103 | 3300037471 | Bacteria | 7107 |
| 457 | Ga0395905_0044251 | 3300037471 | Bacteria | 4178 |
| 458 | Ga0395905_0137916 | 3300037471 | Bacteria | 2295 |
| 459 | Ga0395905_0273449 | 3300037471 | Bacteria | 1575 |
| 460 | Ga0395901_0002697 | 3300038443 | Bacteria | 17888 |
| 461 | Ga0395901_0006189 | 3300038443 | Bacteria | 12126 |
| 462 | Ga0395901_0065408 | 3300038443 | Bacteria | 3786 |
| 463 | Ga0395901_0283683 | 3300038443 | Bacteria | 1720 |
| 464 | Ga0451841_0951447 | 3300041498 | Bacteria | 1684 |
| 465 | Ga0439445_0000124 | 3300042004 | Bacteria | 13248 |
| 466 | Ga0439448_0000114 | 3300042005 | Bacteria | 14867 |
| 467 | Ga0439448_0009599 | 3300042005 | Bacteria | 2855 |
| 468 | Ga0439455_0000039 | 3300042012 | Bacteria | 11478 |
| 469 | Ga0439458_0000037 | 3300042157 | Bacteria | 20859 |
| 470 | Ga0439458_0000482 | 3300042157 | Bacteria | 10218 |
| 471 | Ga0439458_0001251 | 3300042157 | Bacteria | 6407 |
| 472 | Ga0466966_0051064 | 3300044684 | Bacteria | 2629 |
| 473 | Ga0466961_0003244 | 3300044693 | Bacteria | 10121 |
| 474 | Ga0466963_0003682 | 3300044694 | Bacteria | 8824 |
| 475 | Ga0466964_0002676 | 3300044706 | Bacteria | 6381 |
| 476 | Ga0453684_0024245 | 3300044712 | Bacteria | 8878 |
| 477 | Ga0466971_0006185 | 3300044719 | Bacteria | 5204 |
| 478 | Ga0466970_0033196 | 3300044765 | Bacteria | 2728 |
| 479 | Ga0466960_0011210 | 3300044901 | Bacteria | 3742 |
| 480 | Ga0466959_0032431 | 3300045049 | Bacteria | 3866 |
| 481 | Ga0466958_0006700 | 3300045836 | Bacteria | 6287 |
| 482 | Ga0466967_0046722 | 3300045976 | Bacteria | 3771 |
| 483 | Ga0495638_0148361 | 3300046460 | Bacteria | 1362 |
| 484 | Ga0495583_0016733 | 3300046506 | Bacteria | 3927 |
| 485 | Ga0495648_0171063 | 3300046524 | Bacteria | 1113 |
| 486 | Ga0495663_0004218 | 3300046525 | Bacteria | 4058 |
| 487 | Ga0495654_0003096 | 3300046530 | Bacteria | 10338 |
| 488 | Ga0495597_0002879 | 3300046542 | Bacteria | 10497 |
| 489 | Ga0495668_0000989 | 3300046616 | Bacteria | 30903 |
| 490 | Ga0495668_0015112 | 3300046616 | Bacteria | 4514 |
| 491 | Ga0495668_0015152 | 3300046616 | Bacteria | 4508 |
| 492 | Ga0495668_0016112 | 3300046616 | Bacteria | 4349 |
| 493 | Ga0495625_0000460 | 3300046660 | Bacteria | 61217 |
| 494 | Ga0495625_0027206 | 3300046660 | Bacteria | 4310 |
| 495 | Ga0495625_0082012 | 3300046660 | Bacteria | 2244 |
| 496 | Ga0495625_0095936 | 3300046660 | Bacteria | 2043 |
| 497 | Ga0495670_0020432 | 3300046691 | Bacteria | 3266 |
| 498 | Ga0495671_0018660 | 3300046692 | Bacteria | 3678 |
| 499 | Ga0495649_0036870 | 3300046694 | Bacteria | 2686 |
| 500 | Ga0495677_0002123 | 3300047445 | Bacteria | 7855 |
| 501 | Ga0495681_0087104 | 3300047470 | Bacteria | 1385 |
| 502 | Ga0496101_0020678 | 3300048904 | Bacteria | 4512 |
| 503 | Ga0496101_0061575 | 3300048904 | Bacteria | 2726 |
| 504 | Ga0496102_0007301 | 3300048905 | Bacteria | 9431 |
| 505 | Ga0496102_0065611 | 3300048905 | Bacteria | 3328 |
| 506 | Ga0496102_0087058 | 3300048905 | Bacteria | 2886 |
| 507 | Ga0496102_0279022 | 3300048905 | Bacteria | 1575 |
| 508 | Ga0496102_0303373 | 3300048905 | Bacteria | 1505 |
| 509 | Ga0496103_0018596 | 3300048906 | Bacteria | 4169 |
| 510 | Ga0496103_0039583 | 3300048906 | Bacteria | 2897 |
| 511 | Ga0496104_0010865 | 3300048907 | Bacteria | 8143 |
| 512 | Ga0496104_0050409 | 3300048907 | Bacteria | 3928 |
| 513 | Ga0496105_0037080 | 3300048908 | Bacteria | 4016 |
| 514 | Ga0496105_0039921 | 3300048908 | Bacteria | 3870 |
| 515 | Ga0496105_0103552 | 3300048908 | Bacteria | 2350 |
| 516 | Ga0496106_0002615 | 3300048909 | Bacteria | 13399 |
| 517 | Ga0496106_0054464 | 3300048909 | Bacteria | 3022 |
| 518 | Ga0496107_0033143 | 3300048910 | Bacteria | 3695 |
| 519 | Ga0496107_0110159 | 3300048910 | Bacteria | 2023 |
| 520 | Ga0496108_0152521 | 3300048911 | Bacteria | 1994 |
| 521 | Ga0496108_0326496 | 3300048911 | Bacteria | 1338 |
| 522 | Ga0496109_0059305 | 3300048912 | Bacteria | 3496 |
| 523 | Ga0496109_0115253 | 3300048912 | Bacteria | 2500 |
| 524 | Ga0496110_0151791 | 3300048913 | Bacteria | 2098 |
| 525 | Ga0496112_0502037 | 3300048915 | Bacteria | 1148 |
| 526 | Ga0496113_0002879 | 3300048916 | Bacteria | 10132 |
| 527 | Ga0496113_0064522 | 3300048916 | Bacteria | 2769 |
| 528 | Ga0496116_0086824 | 3300048919 | Bacteria | 1917 |
| 529 | Ga0496117_0002856 | 3300048920 | Bacteria | 21010 |
| 530 | Ga0496117_0015664 | 3300048920 | Bacteria | 6444 |
| 531 | Ga0496117_0045989 | 3300048920 | Bacteria | 3145 |
| 532 | Ga0496118_0001042 | 3300048921 | Bacteria | 43202 |
| 533 | Ga0496118_0004960 | 3300048921 | Bacteria | 15403 |
| 534 | Ga0496118_0089039 | 3300048921 | Bacteria | 2132 |
| 535 | Ga0496119_0134661 | 3300048922 | Bacteria | 1342 |
| 536 | Ga0496120_0146545 | 3300048923 | Bacteria | 1192 |
| 537 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 538 | Ga0496121_0022851 | 3300048924 | Bacteria | 6045 |
| 539 | Ga0496122_0017693 | 3300048925 | Bacteria | 6640 |
| 540 | Ga0496123_0025780 | 3300048926 | Bacteria | 4422 |
| 541 | Ga0496124_0012517 | 3300048927 | Bacteria | 8367 |
| 542 | Ga0496124_0051506 | 3300048927 | Bacteria | 3503 |
| 543 | Ga0496124_0092797 | 3300048927 | Bacteria | 2459 |
| 544 | Ga0496125_0051862 | 3300048928 | Bacteria | 3379 |
| 545 | Ga0496125_0070540 | 3300048928 | Bacteria | 2735 |
| 546 | Ga0496126_0058769 | 3300048929 | Bacteria | 3465 |
| 547 | Ga0501290_000084 | 3300049513 | Bacteria | 13312 |
| 548 | Ga0501292_000041 | 3300049515 | Bacteria | 30091 |
| 549 | Ga0501294_000202 | 3300049517 | Bacteria | 7346 |
| 550 | Ga0501297_012961 | 3300049520 | Bacteria | 974 |
| 551 | Ga0501317_003229 | 3300049533 | Bacteria | 1608 |
| 552 | Ga0501034_0046201 | 3300049571 | Bacteria | 4400 |
| 553 | Ga0501198_005078 | 3300049649 | Bacteria | 1843 |
| 554 | Ga0501206_000705 | 3300049653 | Bacteria | 4060 |
| 555 | Ga0501223_000025 | 3300049663 | Bacteria | 58092 |
| 556 | Ga0501223_000049 | 3300049663 | Bacteria | 40988 |
| 557 | Ga0501223_000315 | 3300049663 | Bacteria | 12017 |
| 558 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 559 | Ga0501224_005679 | 3300049664 | Bacteria | 1796 |
| 560 | Ga0501227_014021 | 3300049665 | Bacteria | 1773 |
| 561 | Ga0501233_014942 | 3300049668 | Bacteria | 1593 |
| 562 | Ga0501235_002024 | 3300049669 | Bacteria | 4345 |
| 563 | Ga0501236_005872 | 3300049670 | Bacteria | 1495 |
| 564 | Ga0501257_018640 | 3300049686 | Bacteria | 1620 |
| 565 | Ga0501259_000419 | 3300049688 | Bacteria | 6745 |
| 566 | Ga0501261_000157 | 3300049690 | Bacteria | 9760 |
| 567 | Ga0501225_0000055 | 3300049705 | Bacteria | 38821 |
| 568 | Ga0501225_0000658 | 3300049705 | Bacteria | 10757 |
| 569 | Ga0501225_0001833 | 3300049705 | Bacteria | 6658 |
| 570 | Ga0501225_0002958 | 3300049705 | Bacteria | 5206 |
| 571 | Ga0501225_0009100 | 3300049705 | Bacteria | 2837 |
| 572 | Ga0501234_000223 | 3300049707 | Bacteria | 8202 |
| 573 | Ga0501245_000086 | 3300049708 | Bacteria | 9191 |
| 574 | Ga0501279_000086 | 3300049775 | Bacteria | 15076 |
| 575 | Ga0501280_000113 | 3300049776 | Bacteria | 21120 |
| 576 | Ga0501280_000158 | 3300049776 | Bacteria | 17654 |
| 577 | Ga0501281_00396 | 3300049777 | Bacteria | 4348 |
| 578 | Ga0501282_000040 | 3300049778 | Bacteria | 17093 |
| 579 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 580 | nmdc:mga07m45_7264_c1 | 3300050496 | Bacteria | 5650 |
| 581 | nmdc:mga0qj67_12348_c1 | 3300050509 | Bacteria | 6433 |
| 582 | Ga0500643_000139 | 3300053087 | Bacteria | 73348 |
| 583 | Ga0500643_000544 | 3300053087 | Bacteria | 26284 |
| 584 | Ga0500643_001645 | 3300053087 | Bacteria | 12492 |
| 585 | Ga0500643_001664 | 3300053087 | Bacteria | 12390 |
| 586 | Ga0500643_013891 | 3300053087 | Bacteria | 2818 |
| 587 | Ga0500651_0003722 | 3300053093 | Bacteria | 8398 |
| 588 | Ga0500641_0007726 | 3300053096 | Bacteria | 3833 |
| 589 | Ga0500556_0000040 | 3300053104 | Bacteria | 137489 |
| 590 | Ga0500592_000096 | 3300053116 | Bacteria | 19420 |
| 591 | Ga0500592_000854 | 3300053116 | Bacteria | 4968 |
| 592 | Ga0500594_0001632 | 3300053118 | Bacteria | 4876 |
| 593 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 594 | Ga0500655_000091 | 3300053133 | Bacteria | 23663 |
| 595 | Ga0500559_0031708 | 3300053136 | Bacteria | 2268 |
| 596 | Ga0500559_0130518 | 3300053136 | Bacteria | 1173 |
| 597 | Ga0500590_000125 | 3300053148 | Bacteria | 21213 |
| 598 | Ga0500590_042572 | 3300053148 | Bacteria | 2331 |
| 599 | Ga0500604_0009325 | 3300053151 | Bacteria | 2614 |
| 600 | Ga0500622_0002615 | 3300053156 | Bacteria | 12812 |
| 601 | Ga0500624_000051 | 3300053157 | Bacteria | 76932 |
| 602 | Ga0500627_0000119 | 3300053158 | Bacteria | 24541 |
| 603 | Ga0500627_0000371 | 3300053158 | Bacteria | 12236 |
| 604 | Ga0500636_0000838 | 3300053177 | Bacteria | 16555 |
| 605 | Ga0500645_001009 | 3300053730 | Bacteria | 15836 |
| 606 | Ga0587077_001780 | 3300059493 | Bacteria | 2404 |
| 607 | Ga0466962_0008298 | 3300061719 | Bacteria | 4976 |
| 608 | Ga0466962_0045753 | 3300061719 | Bacteria | 2092 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0024245 | Ga0453684_0024245_7085_7924 | 266 |
| 2 | 3300049520 | Ga0501297_012961 | Ga0501297_012961_140_949 | 268 |
| 3 | 3300049776 | Ga0501280_000158 | Ga0501280_000158_1305_2114 | 268 |
| 4 | 3300049663 | Ga0501223_000049 | Ga0501223_000049_25413_26237 | 273 |
| 5 | 3300049664 | Ga0501224_000007 | Ga0501224_000007_14956_15780 | 273 |
| 6 | 3300049705 | Ga0501225_0000055 | Ga0501225_0000055_23129_23953 | 273 |
| 7 | 3300049707 | Ga0501234_000223 | Ga0501234_000223_5037_5861 | 273 |
| 8 | 3300049853 | Ga0501226_000025 | Ga0501226_000025_75412_76236 | 273 |
| 9 | 3300005614 | Ga0068856_100160218 | Ga0068856_1001602182 | 275 |
| 10 | 3300044706 | Ga0466964_0002676 | Ga0466964_0002676_2951_3913 | 277 |
| 11 | 3300044693 | Ga0466961_0003244 | Ga0466961_0003244_7046_8029 | 278 |
| 12 | 3300044765 | Ga0466970_0033196 | Ga0466970_0033196_272_1255 | 278 |
| 13 | 3300044901 | Ga0466960_0011210 | Ga0466960_0011210_1672_2658 | 278 |
| 14 | 3300045049 | Ga0466959_0032431 | Ga0466959_0032431_1903_2886 | 278 |
| 15 | 3300061719 | Ga0466962_0045753 | Ga0466962_0045753_462_1445 | 278 |
| 16 | 3300006353 | Ga0075370_10012882 | Ga0075370_100128823 | 279 |
| 17 | 3300050496 | nmdc:mga07m45_7264_c1 | nmdc:mga07m45_7264_c1_2019_2975 | 279 |
| 18 | 3300049649 | Ga0501198_005078 | Ga0501198_005078_533_1387 | 280 |
| 19 | 3300046506 | Ga0495583_0016733 | Ga0495583_0016733_2111_2962 | 281 |
| 20 | 3300046524 | Ga0495648_0171063 | Ga0495648_0171063_93_944 | 281 |
| 21 | 3300046616 | Ga0495668_0015152 | Ga0495668_0015152_2917_3768 | 281 |
| 22 | 3300046660 | Ga0495625_0027206 | Ga0495625_0027206_992_1843 | 281 |
| 23 | 3300047445 | Ga0495677_0002123 | Ga0495677_0002123_198_1049 | 281 |
| 24 | 3300053087 | Ga0500643_001664 | Ga0500643_001664_7452_8303 | 281 |
| 25 | 3300005366 | Ga0070659_100261767 | Ga0070659_1002617672 | 282 |
| 26 | 3300005457 | Ga0070662_100024596 | Ga0070662_1000245965 | 282 |
| 27 | 3300025919 | Ga0207657_10082983 | Ga0207657_100829832 | 282 |
| 28 | 3300025932 | Ga0207690_10129207 | Ga0207690_101292072 | 282 |
| 29 | 3300025933 | Ga0207706_10105772 | Ga0207706_101057722 | 282 |
| 30 | 3300044684 | Ga0466966_0051064 | Ga0466966_0051064_1560_2543 | 282 |
| 31 | 3300013307 | Ga0157372_10183836 | Ga0157372_101838362 | 283 |
| 32 | 3300031616 | Ga0307508_10000960 | Ga0307508_1000096011 | 287 |
| 33 | 3300048912 | Ga0496109_0059305 | Ga0496109_0059305_2449_3339 | 287 |
| 34 | 3300048928 | Ga0496125_0070540 | Ga0496125_0070540_162_1052 | 287 |
| 35 | 3300013307 | Ga0157372_10404699 | Ga0157372_104046992 | 290 |
| 36 | 3300053087 | Ga0500643_013891 | Ga0500643_013891_1882_2781 | 290 |
| 37 | 3300009098 | Ga0105245_10000357 | Ga0105245_1000035737 | 293 |
| 38 | 3300025927 | Ga0207687_10000323 | Ga0207687_1000032320 | 293 |
| 39 | 3300005617 | Ga0068859_100001942 | Ga0068859_10000194210 | 294 |
| 40 | 3300005719 | Ga0068861_100000007 | Ga0068861_10000000728 | 294 |
| 41 | 3300006931 | Ga0097620_100001942 | Ga0097620_10000194210 | 294 |
| 42 | 3300009148 | Ga0105243_10043313 | Ga0105243_100433133 | 294 |
| 43 | 3300009177 | Ga0105248_10000723 | Ga0105248_1000072323 | 294 |
| 44 | 3300014968 | Ga0157379_10036808 | Ga0157379_100368083 | 294 |
| 45 | 3300025935 | Ga0207709_10038576 | Ga0207709_100385763 | 294 |
| 46 | 3300025938 | Ga0207704_10391481 | Ga0207704_103914812 | 294 |
| 47 | 3300025941 | Ga0207711_10008095 | Ga0207711_100080953 | 294 |
| 48 | 3300026118 | Ga0207675_100000147 | Ga0207675_1000001474 | 294 |
| 49 | 3300046660 | Ga0495625_0082012 | Ga0495625_0082012_980_1933 | 295 |
| 50 | 3300049513 | Ga0501290_000084 | Ga0501290_000084_4751_5716 | 295 |
| 51 | 3300049515 | Ga0501292_000041 | Ga0501292_000041_11272_12237 | 295 |
| 52 | 3300049517 | Ga0501294_000202 | Ga0501294_000202_3967_4932 | 295 |
| 53 | 3300049653 | Ga0501206_000705 | Ga0501206_000705_2469_3434 | 295 |
| 54 | 3300049663 | Ga0501223_000315 | Ga0501223_000315_4751_5716 | 295 |
| 55 | 3300049664 | Ga0501224_005679 | Ga0501224_005679_605_1570 | 295 |
| 56 | 3300049665 | Ga0501227_014021 | Ga0501227_014021_611_1576 | 295 |
| 57 | 3300049668 | Ga0501233_014942 | Ga0501233_014942_601_1566 | 295 |
| 58 | 3300049669 | Ga0501235_002024 | Ga0501235_002024_2676_3641 | 295 |
| 59 | 3300049686 | Ga0501257_018640 | Ga0501257_018640_77_1042 | 295 |
| 60 | 3300049688 | Ga0501259_000419 | Ga0501259_000419_2890_3855 | 295 |
| 61 | 3300049690 | Ga0501261_000157 | Ga0501261_000157_2177_3142 | 295 |
| 62 | 3300049705 | Ga0501225_0002958 | Ga0501225_0002958_624_1589 | 295 |
| 63 | 3300049708 | Ga0501245_000086 | Ga0501245_000086_2707_3672 | 295 |
| 64 | 3300049775 | Ga0501279_000086 | Ga0501279_000086_11256_12221 | 295 |
| 65 | 3300049776 | Ga0501280_000113 | Ga0501280_000113_13021_13986 | 295 |
| 66 | 3300049777 | Ga0501281_00396 | Ga0501281_00396_611_1576 | 295 |
| 67 | 3300049778 | Ga0501282_000040 | Ga0501282_000040_8531_9496 | 295 |
| 68 | 3300059493 | Ga0587077_001780 | Ga0587077_001780_1041_2006 | 295 |
| 69 | 3300048911 | Ga0496108_0326496 | Ga0496108_0326496_315_1280 | 297 |
| 70 | 3300048916 | Ga0496113_0064522 | Ga0496113_0064522_1773_2738 | 297 |
| 71 | 3300046616 | Ga0495668_0015112 | Ga0495668_0015112_1370_2338 | 298 |
| 72 | 3300053151 | Ga0500604_0009325 | Ga0500604_0009325_401_1369 | 298 |
| 73 | 3300002077 | JGI24744J21845_10022409 | JGI24744J21845_100224092 | 299 |
| 74 | 3300005354 | Ga0070675_100014931 | Ga0070675_1000149318 | 299 |
| 75 | 3300005355 | Ga0070671_100030576 | Ga0070671_1000305765 | 299 |
| 76 | 3300005356 | Ga0070674_100011647 | Ga0070674_1000116474 | 299 |
| 77 | 3300005457 | Ga0070662_100008232 | Ga0070662_1000082327 | 299 |
| 78 | 3300005539 | Ga0068853_100273547 | Ga0068853_1002735472 | 299 |
| 79 | 3300013306 | Ga0163162_10685138 | Ga0163162_106851382 | 299 |
| 80 | 3300025904 | Ga0207647_10008523 | Ga0207647_100085237 | 299 |
| 81 | 3300025931 | Ga0207644_10044438 | Ga0207644_100444382 | 299 |
| 82 | 3300025937 | Ga0207669_10175222 | Ga0207669_101752222 | 299 |
| 83 | 3300046660 | Ga0495625_0000460 | Ga0495625_0000460_26863_27831 | 299 |
| 84 | 3300005563 | Ga0068855_100001164 | Ga0068855_10000116425 | 300 |
| 85 | 3300005616 | Ga0068852_100001541 | Ga0068852_1000015418 | 300 |
| 86 | 3300025949 | Ga0207667_10000017 | Ga0207667_10000017285 | 300 |
| 87 | 3300026142 | Ga0207698_10001072 | Ga0207698_100010728 | 300 |
| 88 | 3300046691 | Ga0495670_0020432 | Ga0495670_0020432_144_1070 | 300 |
| 89 | 3300013307 | Ga0157372_10110927 | Ga0157372_101109273 | 301 |
| 90 | 3300017792 | Ga0163161_10275590 | Ga0163161_102755901 | 301 |
| 91 | 3300025981 | Ga0207640_10023945 | Ga0207640_100239452 | 301 |
| 92 | 3300041498 | Ga0451841_0951447 | Ga0451841_0951447_719_1636 | 301 |
| 93 | 3300005842 | Ga0068858_100006825 | Ga0068858_1000068254 | 302 |
| 94 | 3300026035 | Ga0207703_10000630 | Ga0207703_1000063021 | 302 |
| 95 | 3300037466 | Ga0395898_0250273 | Ga0395898_0250273_733_1665 | 302 |
| 96 | 3300053087 | Ga0500643_000139 | Ga0500643_000139_44067_45038 | 303 |
| 97 | 3300001990 | JGI24737J22298_10001009 | JGI24737J22298_100010094 | 304 |
| 98 | 3300005331 | Ga0070670_100250667 | Ga0070670_1002506672 | 304 |
| 99 | 3300005335 | Ga0070666_10004989 | Ga0070666_100049894 | 304 |
| 100 | 3300005347 | Ga0070668_100109352 | Ga0070668_1001093522 | 304 |
| 101 | 3300005353 | Ga0070669_100006890 | Ga0070669_1000068904 | 304 |
| 102 | 3300005355 | Ga0070671_100000034 | Ga0070671_1000000344 | 304 |
| 103 | 3300005367 | Ga0070667_100005856 | Ga0070667_1000058564 | 304 |
| 104 | 3300005440 | Ga0070705_100012769 | Ga0070705_1000127694 | 304 |
| 105 | 3300005548 | Ga0070665_100142939 | Ga0070665_1001429393 | 304 |
| 106 | 3300005577 | Ga0068857_100010757 | Ga0068857_1000107576 | 304 |
| 107 | 3300005618 | Ga0068864_100039341 | Ga0068864_1000393413 | 304 |
| 108 | 3300005719 | Ga0068861_100003012 | Ga0068861_1000030124 | 304 |
| 109 | 3300005841 | Ga0068863_100003894 | Ga0068863_1000038949 | 304 |
| 110 | 3300005842 | Ga0068858_100006275 | Ga0068858_1000062754 | 304 |
| 111 | 3300005843 | Ga0068860_100013681 | Ga0068860_1000136817 | 304 |
| 112 | 3300005844 | Ga0068862_100009271 | Ga0068862_1000092714 | 304 |
| 113 | 3300005844 | Ga0068862_100192460 | Ga0068862_1001924602 | 304 |
| 114 | 3300009011 | Ga0105251_10020882 | Ga0105251_100208824 | 304 |
| 115 | 3300009101 | Ga0105247_10004689 | Ga0105247_100046892 | 304 |
| 116 | 3300009177 | Ga0105248_10098411 | Ga0105248_100984112 | 304 |
| 117 | 3300011119 | Ga0105246_10034604 | Ga0105246_100346044 | 304 |
| 118 | 3300013306 | Ga0163162_10008224 | Ga0163162_100082247 | 304 |
| 119 | 3300014325 | Ga0163163_10012217 | Ga0163163_100122178 | 304 |
| 120 | 3300014325 | Ga0163163_10013315 | Ga0163163_100133152 | 304 |
| 121 | 3300014968 | Ga0157379_10027676 | Ga0157379_100276765 | 304 |
| 122 | 3300025315 | Ga0207697_10002475 | Ga0207697_100024754 | 304 |
| 123 | 3300025900 | Ga0207710_10004442 | Ga0207710_100044427 | 304 |
| 124 | 3300025903 | Ga0207680_10007925 | Ga0207680_100079254 | 304 |
| 125 | 3300025923 | Ga0207681_10000008 | Ga0207681_100000084 | 304 |
| 126 | 3300025925 | Ga0207650_10022933 | Ga0207650_100229334 | 304 |
| 127 | 3300025925 | Ga0207650_10267614 | Ga0207650_102676142 | 304 |
| 128 | 3300025931 | Ga0207644_10000033 | Ga0207644_1000003389 | 304 |
| 129 | 3300025932 | Ga0207690_10226345 | Ga0207690_102263452 | 304 |
| 130 | 3300025941 | Ga0207711_10062552 | Ga0207711_100625523 | 304 |
| 131 | 3300025961 | Ga0207712_10004665 | Ga0207712_100046653 | 304 |
| 132 | 3300025972 | Ga0207668_10002224 | Ga0207668_100022244 | 304 |
| 133 | 3300026035 | Ga0207703_10007341 | Ga0207703_100073413 | 304 |
| 134 | 3300026088 | Ga0207641_10023359 | Ga0207641_100233596 | 304 |
| 135 | 3300026088 | Ga0207641_10073932 | Ga0207641_100739322 | 304 |
| 136 | 3300026095 | Ga0207676_10000696 | Ga0207676_1000069618 | 304 |
| 137 | 3300026116 | Ga0207674_10000308 | Ga0207674_1000030810 | 304 |
| 138 | 3300026118 | Ga0207675_100011955 | Ga0207675_1000119556 | 304 |
| 139 | 3300028379 | Ga0268266_10113660 | Ga0268266_101136602 | 304 |
| 140 | 3300028380 | Ga0268265_10000357 | Ga0268265_1000035740 | 304 |
| 141 | 3300028380 | Ga0268265_10274487 | Ga0268265_102744872 | 304 |
| 142 | 3300028381 | Ga0268264_10004853 | Ga0268264_100048534 | 304 |
| 143 | 3300049571 | Ga0501034_0046201 | Ga0501034_0046201_1439_2365 | 304 |
| 144 | 3300005328 | Ga0070676_10005501 | Ga0070676_100055017 | 305 |
| 145 | 3300005334 | Ga0068869_100000031 | Ga0068869_1000000312 | 305 |
| 146 | 3300005338 | Ga0068868_100000060 | Ga0068868_10000006061 | 305 |
| 147 | 3300005364 | Ga0070673_100000009 | Ga0070673_10000000961 | 305 |
| 148 | 3300005459 | Ga0068867_100000002 | Ga0068867_100000002228 | 305 |
| 149 | 3300005543 | Ga0070672_100025226 | Ga0070672_1000252264 | 305 |
| 150 | 3300006881 | Ga0068865_100000014 | Ga0068865_10000001482 | 305 |
| 151 | 3300009098 | Ga0105245_10000160 | Ga0105245_100001605 | 305 |
| 152 | 3300009148 | Ga0105243_10000070 | Ga0105243_1000007061 | 305 |
| 153 | 3300009176 | Ga0105242_10001604 | Ga0105242_1000160410 | 305 |
| 154 | 3300009553 | Ga0105249_10015328 | Ga0105249_100153284 | 305 |
| 155 | 3300011119 | Ga0105246_10003501 | Ga0105246_100035012 | 305 |
| 156 | 3300013296 | Ga0157374_10000542 | Ga0157374_1000054240 | 305 |
| 157 | 3300013297 | Ga0157378_10000624 | Ga0157378_1000062440 | 305 |
| 158 | 3300013308 | Ga0157375_10031485 | Ga0157375_100314855 | 305 |
| 159 | 3300014745 | Ga0157377_10113948 | Ga0157377_101139482 | 305 |
| 160 | 3300014969 | Ga0157376_10000096 | Ga0157376_1000009661 | 305 |
| 161 | 3300025907 | Ga0207645_10008376 | Ga0207645_100083762 | 305 |
| 162 | 3300025927 | Ga0207687_10000252 | Ga0207687_1000025227 | 305 |
| 163 | 3300025934 | Ga0207686_10002334 | Ga0207686_100023342 | 305 |
| 164 | 3300025935 | Ga0207709_10000066 | Ga0207709_1000006639 | 305 |
| 165 | 3300025938 | Ga0207704_10000002 | Ga0207704_10000002159 | 305 |
| 166 | 3300025938 | Ga0207704_10000007 | Ga0207704_10000007159 | 305 |
| 167 | 3300025940 | Ga0207691_10022342 | Ga0207691_100223423 | 305 |
| 168 | 3300025942 | Ga0207689_10000060 | Ga0207689_1000006026 | 305 |
| 169 | 3300025960 | Ga0207651_10000004 | Ga0207651_10000004228 | 305 |
| 170 | 3300025961 | Ga0207712_10007169 | Ga0207712_100071695 | 305 |
| 171 | 3300026023 | Ga0207677_10000231 | Ga0207677_100002319 | 305 |
| 172 | 3300026089 | Ga0207648_10000003 | Ga0207648_1000000361 | 305 |
| 173 | 3300031911 | Ga0307412_10005555 | Ga0307412_100055555 | 305 |
| 174 | 3300049533 | Ga0501317_003229 | Ga0501317_003229_310_1275 | 305 |
| 175 | iso_pu_bacteria | 2775507255 | 2778123930 | 305 |
| 176 | 3300005335 | Ga0070666_10095505 | Ga0070666_100955052 | 306 |
| 177 | 3300005367 | Ga0070667_100000692 | Ga0070667_10000069214 | 306 |
| 178 | 3300005618 | Ga0068864_100049025 | Ga0068864_1000490252 | 306 |
| 179 | 3300005841 | Ga0068863_100000006 | Ga0068863_100000006210 | 306 |
| 180 | 3300005842 | Ga0068858_100015300 | Ga0068858_1000153005 | 306 |
| 181 | 3300005843 | Ga0068860_100000119 | Ga0068860_10000011928 | 306 |
| 182 | 3300009147 | Ga0114129_10096454 | Ga0114129_100964541 | 306 |
| 183 | 3300025986 | Ga0207658_10001289 | Ga0207658_1000128914 | 306 |
| 184 | 3300026035 | Ga0207703_10042209 | Ga0207703_100422094 | 306 |
| 185 | 3300026088 | Ga0207641_10000054 | Ga0207641_1000005449 | 306 |
| 186 | 3300026095 | Ga0207676_10014589 | Ga0207676_100145892 | 306 |
| 187 | 3300028379 | Ga0268266_10016659 | Ga0268266_100166592 | 306 |
| 188 | 3300028381 | Ga0268264_10000128 | Ga0268264_1000012870 | 306 |
| 189 | 3300048905 | Ga0496102_0065611 | Ga0496102_0065611_643_1611 | 306 |
| 190 | 3300048907 | Ga0496104_0050409 | Ga0496104_0050409_934_1902 | 306 |
| 191 | 3300048908 | Ga0496105_0103552 | Ga0496105_0103552_225_1193 | 306 |
| 192 | 3300048920 | Ga0496117_0045989 | Ga0496117_0045989_205_1173 | 306 |
| 193 | 3300048921 | Ga0496118_0004960 | Ga0496118_0004960_4428_5396 | 306 |
| 194 | 3300048922 | Ga0496119_0134661 | Ga0496119_0134661_275_1225 | 306 |
| 195 | 3300048924 | Ga0496121_0000222 | Ga0496121_0000222_95612_96580 | 306 |
| 196 | 3300048924 | Ga0496121_0022851 | Ga0496121_0022851_4425_5375 | 306 |
| 197 | 3300048925 | Ga0496122_0017693 | Ga0496122_0017693_3780_4730 | 306 |
| 198 | 3300048926 | Ga0496123_0025780 | Ga0496123_0025780_1604_2554 | 306 |
| 199 | 3300048927 | Ga0496124_0012517 | Ga0496124_0012517_1353_2303 | 306 |
| 200 | 3300048929 | Ga0496126_0058769 | Ga0496126_0058769_267_1217 | 306 |
| 201 | 3300005356 | Ga0070674_100215238 | Ga0070674_1002152382 | 307 |
| 202 | 3300046692 | Ga0495671_0018660 | Ga0495671_0018660_487_1443 | 307 |
| 203 | 3300053118 | Ga0500594_0001632 | Ga0500594_0001632_2070_3026 | 307 |
| 204 | 3300053156 | Ga0500622_0002615 | Ga0500622_0002615_2646_3572 | 307 |
| 205 | 3300001904 | JGI24736J21556_1000376 | JGI24736J21556_10003767 | 308 |
| 206 | 3300001915 | JGI24741J21665_1000325 | JGI24741J21665_100032513 | 308 |
| 207 | 3300001979 | JGI24740J21852_10000356 | JGI24740J21852_100003562 | 308 |
| 208 | 3300001989 | JGI24739J22299_10017157 | JGI24739J22299_100171572 | 308 |
| 209 | 3300001990 | JGI24737J22298_10005404 | JGI24737J22298_100054043 | 308 |
| 210 | 3300002067 | JGI24735J21928_10005899 | JGI24735J21928_100058993 | 308 |
| 211 | 3300002075 | JGI24738J21930_10003551 | JGI24738J21930_100035514 | 308 |
| 212 | 3300005340 | Ga0070689_100124649 | Ga0070689_1001246492 | 308 |
| 213 | 3300005344 | Ga0070661_100141800 | Ga0070661_1001418002 | 308 |
| 214 | 3300005353 | Ga0070669_100001143 | Ga0070669_10000114312 | 308 |
| 215 | 3300005355 | Ga0070671_100000040 | Ga0070671_10000004051 | 308 |
| 216 | 3300005366 | Ga0070659_100009830 | Ga0070659_1000098304 | 308 |
| 217 | 3300005455 | Ga0070663_100007749 | Ga0070663_1000077494 | 308 |
| 218 | 3300005544 | Ga0070686_100104625 | Ga0070686_1001046252 | 308 |
| 219 | 3300005548 | Ga0070665_100049328 | Ga0070665_1000493284 | 308 |
| 220 | 3300005563 | Ga0068855_100005469 | Ga0068855_1000054697 | 308 |
| 221 | 3300005563 | Ga0068855_100145237 | Ga0068855_1001452372 | 308 |
| 222 | 3300005564 | Ga0070664_100009350 | Ga0070664_1000093508 | 308 |
| 223 | 3300005614 | Ga0068856_100009439 | Ga0068856_1000094393 | 308 |
| 224 | 3300005616 | Ga0068852_100212228 | Ga0068852_1002122281 | 308 |
| 225 | 3300005617 | Ga0068859_100201774 | Ga0068859_1002017742 | 308 |
| 226 | 3300005841 | Ga0068863_100146767 | Ga0068863_1001467672 | 308 |
| 227 | 3300005842 | Ga0068858_100000352 | Ga0068858_10000035249 | 308 |
| 228 | 3300006931 | Ga0097620_100201770 | Ga0097620_1002017701 | 308 |
| 229 | 3300009177 | Ga0105248_10003764 | Ga0105248_100037646 | 308 |
| 230 | 3300009553 | Ga0105249_10351388 | Ga0105249_103513882 | 308 |
| 231 | 3300013306 | Ga0163162_10132289 | Ga0163162_101322892 | 308 |
| 232 | 3300025904 | Ga0207647_10035600 | Ga0207647_100356002 | 308 |
| 233 | 3300025911 | Ga0207654_10031228 | Ga0207654_100312283 | 308 |
| 234 | 3300025914 | Ga0207671_10023283 | Ga0207671_100232833 | 308 |
| 235 | 3300025919 | Ga0207657_10013142 | Ga0207657_100131425 | 308 |
| 236 | 3300025920 | Ga0207649_10049967 | Ga0207649_100499673 | 308 |
| 237 | 3300025923 | Ga0207681_10001400 | Ga0207681_1000140011 | 308 |
| 238 | 3300025924 | Ga0207694_10169129 | Ga0207694_101691292 | 308 |
| 239 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005397 | 308 |
| 240 | 3300025932 | Ga0207690_10085978 | Ga0207690_100859782 | 308 |
| 241 | 3300025933 | Ga0207706_10022176 | Ga0207706_100221762 | 308 |
| 242 | 3300025941 | Ga0207711_10034963 | Ga0207711_100349632 | 308 |
| 243 | 3300025949 | Ga0207667_10008884 | Ga0207667_100088847 | 308 |
| 244 | 3300025961 | Ga0207712_10234294 | Ga0207712_102342942 | 308 |
| 245 | 3300025972 | Ga0207668_10181195 | Ga0207668_101811952 | 308 |
| 246 | 3300025981 | Ga0207640_10011693 | Ga0207640_100116933 | 308 |
| 247 | 3300026035 | Ga0207703_10001574 | Ga0207703_1000157419 | 308 |
| 248 | 3300026041 | Ga0207639_10003463 | Ga0207639_100034632 | 308 |
| 249 | 3300026067 | Ga0207678_10000404 | Ga0207678_1000040420 | 308 |
| 250 | 3300026078 | Ga0207702_10005874 | Ga0207702_100058744 | 308 |
| 251 | 3300026095 | Ga0207676_10156766 | Ga0207676_101567662 | 308 |
| 252 | 3300026116 | Ga0207674_10019102 | Ga0207674_100191025 | 308 |
| 253 | 3300026142 | Ga0207698_10164486 | Ga0207698_101644861 | 308 |
| 254 | 3300031852 | Ga0307410_10170247 | Ga0307410_101702472 | 308 |
| 255 | 3300031995 | Ga0307409_100013246 | Ga0307409_1000132462 | 308 |
| 256 | 3300032002 | Ga0307416_100213642 | Ga0307416_1002136422 | 308 |
| 257 | 3300032004 | Ga0307414_10041862 | Ga0307414_100418622 | 308 |
| 258 | 3300032005 | Ga0307411_10275425 | Ga0307411_102754252 | 308 |
| 259 | 3300046460 | Ga0495638_0148361 | Ga0495638_0148361_313_1269 | 308 |
| 260 | 3300048904 | Ga0496101_0020678 | Ga0496101_0020678_2203_3159 | 308 |
| 261 | 3300048906 | Ga0496103_0018596 | Ga0496103_0018596_1680_2636 | 308 |
| 262 | 3300048908 | Ga0496105_0037080 | Ga0496105_0037080_2007_2963 | 308 |
| 263 | 3300048909 | Ga0496106_0002615 | Ga0496106_0002615_7570_8526 | 308 |
| 264 | 3300048910 | Ga0496107_0033143 | Ga0496107_0033143_748_1704 | 308 |
| 265 | 3300048910 | Ga0496107_0110159 | Ga0496107_0110159_1086_2012 | 308 |
| 266 | 3300048911 | Ga0496108_0152521 | Ga0496108_0152521_816_1772 | 308 |
| 267 | 3300048912 | Ga0496109_0115253 | Ga0496109_0115253_638_1594 | 308 |
| 268 | 3300048915 | Ga0496112_0502037 | Ga0496112_0502037_127_1083 | 308 |
| 269 | 3300048916 | Ga0496113_0002879 | Ga0496113_0002879_3576_4532 | 308 |
| 270 | 3300053104 | Ga0500556_0000040 | Ga0500556_0000040_76406_77362 | 308 |
| 271 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_204382_205338 | 308 |
| 272 | 3300053157 | Ga0500624_000051 | Ga0500624_000051_37432_38391 | 308 |
| 273 | 3300053177 | Ga0500636_0000838 | Ga0500636_0000838_1520_2479 | 308 |
| 274 | 3300053730 | Ga0500645_001009 | Ga0500645_001009_3248_4204 | 308 |
| 275 | 3300005289 | Ga0065704_10084088 | Ga0065704_100840884 | 309 |
| 276 | 3300005331 | Ga0070670_100068597 | Ga0070670_1000685972 | 309 |
| 277 | 3300005347 | Ga0070668_100039604 | Ga0070668_1000396042 | 309 |
| 278 | 3300005466 | Ga0070685_10080002 | Ga0070685_100800021 | 309 |
| 279 | 3300005539 | Ga0068853_100004448 | Ga0068853_1000044482 | 309 |
| 280 | 3300005563 | Ga0068855_100160958 | Ga0068855_1001609582 | 309 |
| 281 | 3300009093 | Ga0105240_10097192 | Ga0105240_100971922 | 309 |
| 282 | 3300009174 | Ga0105241_10002084 | Ga0105241_100020846 | 309 |
| 283 | 3300009177 | Ga0105248_10438920 | Ga0105248_104389202 | 309 |
| 284 | 3300009545 | Ga0105237_10132101 | Ga0105237_101321012 | 309 |
| 285 | 3300010375 | Ga0105239_10083094 | Ga0105239_100830942 | 309 |
| 286 | 3300013100 | Ga0157373_10029633 | Ga0157373_100296333 | 309 |
| 287 | 3300013102 | Ga0157371_10124823 | Ga0157371_101248232 | 309 |
| 288 | 3300013104 | Ga0157370_10130541 | Ga0157370_101305412 | 309 |
| 289 | 3300025941 | Ga0207711_10375462 | Ga0207711_103754621 | 309 |
| 290 | 3300026041 | Ga0207639_10003882 | Ga0207639_100038823 | 309 |
| 291 | 3300026078 | Ga0207702_10055754 | Ga0207702_100557542 | 309 |
| 292 | 3300026116 | Ga0207674_10011602 | Ga0207674_100116025 | 309 |
| 293 | 3300031852 | Ga0307410_10118174 | Ga0307410_101181742 | 309 |
| 294 | 3300031911 | Ga0307412_10037699 | Ga0307412_100376992 | 309 |
| 295 | 3300037418 | Ga0395900_0397970 | Ga0395900_0397970_75_1031 | 309 |
| 296 | 3300037471 | Ga0395905_0003291 | Ga0395905_0003291_13424_14380 | 309 |
| 297 | 3300037471 | Ga0395905_0016103 | Ga0395905_0016103_2414_3370 | 309 |
| 298 | 3300038443 | Ga0395901_0065408 | Ga0395901_0065408_1467_2423 | 309 |
| 299 | 3300048905 | Ga0496102_0087058 | Ga0496102_0087058_133_1098 | 309 |
| 300 | 3300048927 | Ga0496124_0051506 | Ga0496124_0051506_1629_2594 | 309 |
| 301 | 3300049663 | Ga0501223_000025 | Ga0501223_000025_33238_34197 | 309 |
| 302 | 3300049705 | Ga0501225_0000658 | Ga0501225_0000658_5713_6672 | 309 |
| 303 | 3300053148 | Ga0500590_042572 | Ga0500590_042572_20_991 | 309 |
| 304 | 3300005841 | Ga0068863_100006871 | Ga0068863_1000068713 | 310 |
| 305 | 3300026088 | Ga0207641_10009407 | Ga0207641_100094077 | 310 |
| 306 | 3300046660 | Ga0495625_0095936 | Ga0495625_0095936_393_1328 | 310 |
| 307 | 3300049670 | Ga0501236_005872 | Ga0501236_005872_119_1096 | 310 |
| 308 | 3300049705 | Ga0501225_0001833 | Ga0501225_0001833_4600_5577 | 310 |
| 309 | 3300049705 | Ga0501225_0009100 | Ga0501225_0009100_464_1441 | 310 |
| 310 | 3300005347 | Ga0070668_100000815 | Ga0070668_1000008156 | 311 |
| 311 | 3300005548 | Ga0070665_100327622 | Ga0070665_1003276222 | 311 |
| 312 | 3300005617 | Ga0068859_100086954 | Ga0068859_1000869543 | 311 |
| 313 | 3300006931 | Ga0097620_100086955 | Ga0097620_1000869553 | 311 |
| 314 | 3300025972 | Ga0207668_10000029 | Ga0207668_100000296 | 311 |
| 315 | 3300028379 | Ga0268266_10262887 | Ga0268266_102628872 | 311 |
| 316 | 3300028381 | Ga0268264_10002511 | Ga0268264_1000251111 | 311 |
| 317 | 3300053136 | Ga0500559_0130518 | Ga0500559_0130518_146_1144 | 311 |
| 318 | 3300005331 | Ga0070670_100014302 | Ga0070670_1000143027 | 313 |
| 319 | 3300005335 | Ga0070666_10061827 | Ga0070666_100618272 | 313 |
| 320 | 3300005347 | Ga0070668_100000026 | Ga0070668_10000002643 | 313 |
| 321 | 3300005355 | Ga0070671_100000470 | Ga0070671_1000004705 | 313 |
| 322 | 3300005367 | Ga0070667_100000019 | Ga0070667_100000019202 | 313 |
| 323 | 3300005367 | Ga0070667_100000076 | Ga0070667_10000007653 | 313 |
| 324 | 3300005617 | Ga0068859_100080679 | Ga0068859_1000806792 | 313 |
| 325 | 3300005841 | Ga0068863_100005111 | Ga0068863_1000051115 | 313 |
| 326 | 3300005841 | Ga0068863_100100122 | Ga0068863_1001001222 | 313 |
| 327 | 3300005842 | Ga0068858_100003305 | Ga0068858_1000033058 | 313 |
| 328 | 3300005843 | Ga0068860_100000036 | Ga0068860_100000036216 | 313 |
| 329 | 3300005843 | Ga0068860_100000131 | Ga0068860_10000013154 | 313 |
| 330 | 3300005844 | Ga0068862_100008677 | Ga0068862_1000086772 | 313 |
| 331 | 3300006931 | Ga0097620_100080678 | Ga0097620_1000806782 | 313 |
| 332 | 3300025903 | Ga0207680_10041387 | Ga0207680_100413872 | 313 |
| 333 | 3300025923 | Ga0207681_10034705 | Ga0207681_100347052 | 313 |
| 334 | 3300025925 | Ga0207650_10000657 | Ga0207650_1000065721 | 313 |
| 335 | 3300025931 | Ga0207644_10000067 | Ga0207644_1000006733 | 313 |
| 336 | 3300025972 | Ga0207668_10000081 | Ga0207668_1000008143 | 313 |
| 337 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002228 | 313 |
| 338 | 3300025986 | Ga0207658_10000094 | Ga0207658_1000009452 | 313 |
| 339 | 3300026035 | Ga0207703_10005308 | Ga0207703_100053088 | 313 |
| 340 | 3300026088 | Ga0207641_10002254 | Ga0207641_100022549 | 313 |
| 341 | 3300026088 | Ga0207641_10003954 | Ga0207641_100039542 | 313 |
| 342 | 3300028380 | Ga0268265_10004816 | Ga0268265_100048168 | 313 |
| 343 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001553 | 313 |
| 344 | 3300028381 | Ga0268264_10000204 | Ga0268264_1000020452 | 313 |
| 345 | iso_pu_bacteria | 2582581305 | 2585262188 | 313 |
| 346 | 3300002459 | JGI24751J29686_10000046 | JGI24751J29686_1000004612 | 314 |
| 347 | 3300005331 | Ga0070670_100000006 | Ga0070670_10000000662 | 314 |
| 348 | 3300005617 | Ga0068859_100234921 | Ga0068859_1002349211 | 314 |
| 349 | 3300005618 | Ga0068864_100000014 | Ga0068864_100000014253 | 314 |
| 350 | 3300006931 | Ga0097620_100234932 | Ga0097620_1002349321 | 314 |
| 351 | 3300025925 | Ga0207650_10000023 | Ga0207650_10000023249 | 314 |
| 352 | 3300025961 | Ga0207712_10066820 | Ga0207712_100668202 | 314 |
| 353 | 3300026095 | Ga0207676_10000017 | Ga0207676_10000017251 | 314 |
| 354 | 3300002076 | JGI24749J21850_1000033 | JGI24749J21850_10000339 | 315 |
| 355 | 3300003323 | rootH1_10040862 | rootH1_100408627 | 315 |
| 356 | 3300005295 | Ga0065707_10084013 | Ga0065707_100840132 | 315 |
| 357 | 3300005353 | Ga0070669_100000102 | Ga0070669_10000010220 | 315 |
| 358 | 3300005353 | Ga0070669_100204575 | Ga0070669_1002045752 | 315 |
| 359 | 3300005367 | Ga0070667_100003424 | Ga0070667_1000034247 | 315 |
| 360 | 3300005578 | Ga0068854_100037700 | Ga0068854_1000377003 | 315 |
| 361 | 3300005618 | Ga0068864_100000218 | Ga0068864_10000021823 | 315 |
| 362 | 3300005618 | Ga0068864_100004287 | Ga0068864_1000042872 | 315 |
| 363 | 3300005719 | Ga0068861_100061595 | Ga0068861_1000615952 | 315 |
| 364 | 3300005841 | Ga0068863_100063552 | Ga0068863_1000635522 | 315 |
| 365 | 3300005844 | Ga0068862_100000007 | Ga0068862_10000000750 | 315 |
| 366 | 3300009177 | Ga0105248_10000139 | Ga0105248_1000013913 | 315 |
| 367 | 3300014326 | Ga0157380_10000014 | Ga0157380_1000001436 | 315 |
| 368 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001247 | 315 |
| 369 | 3300025923 | Ga0207681_10277872 | Ga0207681_102778722 | 315 |
| 370 | 3300025941 | Ga0207711_10003786 | Ga0207711_100037867 | 315 |
| 371 | 3300025941 | Ga0207711_10108136 | Ga0207711_101081362 | 315 |
| 372 | 3300025981 | Ga0207640_10015659 | Ga0207640_100156593 | 315 |
| 373 | 3300025986 | Ga0207658_10011568 | Ga0207658_100115686 | 315 |
| 374 | 3300026088 | Ga0207641_10008512 | Ga0207641_100085123 | 315 |
| 375 | 3300026095 | Ga0207676_10000169 | Ga0207676_1000016923 | 315 |
| 376 | 3300026095 | Ga0207676_10012270 | Ga0207676_100122703 | 315 |
| 377 | 3300026118 | Ga0207675_100000891 | Ga0207675_10000089113 | 315 |
| 378 | 3300026142 | Ga0207698_10188365 | Ga0207698_101883652 | 315 |
| 379 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002252 | 315 |
| 380 | 3300033180 | Ga0307510_10016083 | Ga0307510_100160835 | 315 |
| 381 | 3300037312 | Ga0395899_0074705 | Ga0395899_0074705_1442_2413 | 315 |
| 382 | 3300037418 | Ga0395900_0002071 | Ga0395900_0002071_11437_12408 | 315 |
| 383 | 3300037418 | Ga0395900_0026267 | Ga0395900_0026267_709_1680 | 315 |
| 384 | 3300037471 | Ga0395905_0007105 | Ga0395905_0007105_8649_9620 | 315 |
| 385 | 3300037471 | Ga0395905_0044251 | Ga0395905_0044251_2945_3916 | 315 |
| 386 | 3300037471 | Ga0395905_0273449 | Ga0395905_0273449_254_1225 | 315 |
| 387 | 3300038443 | Ga0395901_0002697 | Ga0395901_0002697_14181_15152 | 315 |
| 388 | 3300053087 | Ga0500643_000544 | Ga0500643_000544_6868_7839 | 315 |
| 389 | 3300005327 | Ga0070658_10003723 | Ga0070658_100037239 | 316 |
| 390 | 3300005455 | Ga0070663_100004783 | Ga0070663_1000047835 | 316 |
| 391 | 3300005539 | Ga0068853_100014991 | Ga0068853_1000149916 | 316 |
| 392 | 3300005548 | Ga0070665_100404532 | Ga0070665_1004045322 | 316 |
| 393 | 3300005577 | Ga0068857_100005402 | Ga0068857_1000054028 | 316 |
| 394 | 3300005578 | Ga0068854_100003204 | Ga0068854_1000032045 | 316 |
| 395 | 3300005834 | Ga0068851_10062517 | Ga0068851_100625172 | 316 |
| 396 | 3300006237 | Ga0097621_100001876 | Ga0097621_10000187613 | 316 |
| 397 | 3300006358 | Ga0068871_100062791 | Ga0068871_1000627914 | 316 |
| 398 | 3300009177 | Ga0105248_10017214 | Ga0105248_100172142 | 316 |
| 399 | 3300010375 | Ga0105239_10084115 | Ga0105239_100841153 | 316 |
| 400 | 3300013100 | Ga0157373_10025286 | Ga0157373_100252862 | 316 |
| 401 | 3300025909 | Ga0207705_10000042 | Ga0207705_1000004288 | 316 |
| 402 | 3300025941 | Ga0207711_10014506 | Ga0207711_100145066 | 316 |
| 403 | 3300025981 | Ga0207640_10000695 | Ga0207640_1000069519 | 316 |
| 404 | 3300026041 | Ga0207639_10004222 | Ga0207639_1000422210 | 316 |
| 405 | 3300026116 | Ga0207674_10034252 | Ga0207674_100342522 | 316 |
| 406 | 3300031548 | Ga0307408_100087280 | Ga0307408_1000872802 | 316 |
| 407 | 3300031901 | Ga0307406_10045872 | Ga0307406_100458723 | 316 |
| 408 | 3300037418 | Ga0395900_0187559 | Ga0395900_0187559_682_1659 | 316 |
| 409 | 3300037471 | Ga0395905_0015849 | Ga0395905_0015849_3836_4813 | 316 |
| 410 | 3300037471 | Ga0395905_0137916 | Ga0395905_0137916_649_1605 | 316 |
| 411 | 3300038443 | Ga0395901_0283683 | Ga0395901_0283683_667_1644 | 316 |
| 412 | 3300042004 | Ga0439445_0000124 | Ga0439445_0000124_10325_11299 | 316 |
| 413 | 3300042157 | Ga0439458_0000482 | Ga0439458_0000482_3029_4006 | 316 |
| 414 | 3300044694 | Ga0466963_0003682 | Ga0466963_0003682_365_1321 | 316 |
| 415 | 3300044719 | Ga0466971_0006185 | Ga0466971_0006185_4191_5147 | 316 |
| 416 | 3300045836 | Ga0466958_0006700 | Ga0466958_0006700_1025_1981 | 316 |
| 417 | 3300045976 | Ga0466967_0046722 | Ga0466967_0046722_1058_2014 | 316 |
| 418 | 3300048905 | Ga0496102_0303373 | Ga0496102_0303373_202_1158 | 316 |
| 419 | 3300048928 | Ga0496125_0051862 | Ga0496125_0051862_2055_3008 | 316 |
| 420 | 3300061719 | Ga0466962_0008298 | Ga0466962_0008298_2796_3752 | 316 |
| 421 | 3300002239 | JGI24034J26672_10019022 | JGI24034J26672_100190221 | 317 |
| 422 | 3300003762 | Ga0055542_1001654 | Ga0055542_10016546 | 317 |
| 423 | 3300005335 | Ga0070666_10092046 | Ga0070666_100920462 | 317 |
| 424 | 3300005347 | Ga0070668_100214518 | Ga0070668_1002145182 | 317 |
| 425 | 3300005355 | Ga0070671_100096957 | Ga0070671_1000969574 | 317 |
| 426 | 3300005356 | Ga0070674_100074716 | Ga0070674_1000747163 | 317 |
| 427 | 3300005457 | Ga0070662_100044512 | Ga0070662_1000445124 | 317 |
| 428 | 3300006846 | Ga0075430_100036204 | Ga0075430_1000362044 | 317 |
| 429 | 3300011119 | Ga0105246_10159649 | Ga0105246_101596492 | 317 |
| 430 | 3300025931 | Ga0207644_10010698 | Ga0207644_100106984 | 317 |
| 431 | 3300025933 | Ga0207706_10139817 | Ga0207706_101398172 | 317 |
| 432 | 3300037312 | Ga0395899_0080799 | Ga0395899_0080799_656_1645 | 317 |
| 433 | 3300037466 | Ga0395898_0030947 | Ga0395898_0030947_3708_4697 | 317 |
| 434 | 3300038443 | Ga0395901_0006189 | Ga0395901_0006189_1487_2476 | 317 |
| 435 | 3300042005 | Ga0439448_0000114 | Ga0439448_0000114_1866_2828 | 317 |
| 436 | 3300042005 | Ga0439448_0009599 | Ga0439448_0009599_642_1601 | 317 |
| 437 | 3300042012 | Ga0439455_0000039 | Ga0439455_0000039_8779_9741 | 317 |
| 438 | 3300042157 | Ga0439458_0000037 | Ga0439458_0000037_1961_2923 | 317 |
| 439 | 3300042157 | Ga0439458_0001251 | Ga0439458_0001251_3245_4204 | 317 |
| 440 | 3300046542 | Ga0495597_0002879 | Ga0495597_0002879_663_1619 | 317 |
| 441 | 3300046616 | Ga0495668_0016112 | Ga0495668_0016112_1069_2025 | 317 |
| 442 | 3300047470 | Ga0495681_0087104 | Ga0495681_0087104_297_1253 | 317 |
| 443 | 3300050509 | nmdc:mga0qj67_12348_c1 | nmdc:mga0qj67_12348_c1_3854_4828 | 317 |
| 444 | 3300053087 | Ga0500643_001645 | Ga0500643_001645_9280_10236 | 317 |
| 445 | 3300053093 | Ga0500651_0003722 | Ga0500651_0003722_4243_5199 | 317 |
| 446 | 3300053096 | Ga0500641_0007726 | Ga0500641_0007726_2500_3456 | 317 |
| 447 | 3300053133 | Ga0500655_000091 | Ga0500655_000091_9987_10943 | 317 |
| 448 | 3300053136 | Ga0500559_0031708 | Ga0500559_0031708_222_1178 | 317 |
| 449 | 3300053148 | Ga0500590_000125 | Ga0500590_000125_10704_11660 | 317 |
| 450 | 3300001989 | JGI24739J22299_10002707 | JGI24739J22299_100027072 | 318 |
| 451 | 3300001990 | JGI24737J22298_10001181 | JGI24737J22298_1000118113 | 318 |
| 452 | 3300001990 | JGI24737J22298_10019798 | JGI24737J22298_100197982 | 318 |
| 453 | 3300002067 | JGI24735J21928_10010376 | JGI24735J21928_100103762 | 318 |
| 454 | 3300002075 | JGI24738J21930_10000327 | JGI24738J21930_1000032713 | 318 |
| 455 | 3300005457 | Ga0070662_100070971 | Ga0070662_1000709713 | 318 |
| 456 | 3300009176 | Ga0105242_10322425 | Ga0105242_103224251 | 318 |
| 457 | 3300009545 | Ga0105237_10194246 | Ga0105237_101942463 | 318 |
| 458 | 3300013307 | Ga0157372_10562976 | Ga0157372_105629762 | 318 |
| 459 | 3300025254 | Ga0209148_1000147 | Ga0209148_1000147105 | 318 |
| 460 | 3300025904 | Ga0207647_10005017 | Ga0207647_100050175 | 318 |
| 461 | 3300025914 | Ga0207671_10122372 | Ga0207671_101223721 | 318 |
| 462 | 3300025933 | Ga0207706_10005304 | Ga0207706_100053047 | 318 |
| 463 | 3300025942 | Ga0207689_10165729 | Ga0207689_101657292 | 318 |
| 464 | 3300046694 | Ga0495649_0036870 | Ga0495649_0036870_449_1423 | 319 |
| 465 | 3300053116 | Ga0500592_000096 | Ga0500592_000096_7526_8497 | 319 |
| 466 | 3300053158 | Ga0500627_0000119 | Ga0500627_0000119_10917_11888 | 319 |
| 467 | 3300005355 | Ga0070671_100001027 | Ga0070671_1000010275 | 320 |
| 468 | 3300005445 | Ga0070708_100259127 | Ga0070708_1002591272 | 320 |
| 469 | 3300005841 | Ga0068863_100000131 | Ga0068863_10000013175 | 320 |
| 470 | 3300005843 | Ga0068860_100092971 | Ga0068860_1000929712 | 320 |
| 471 | 3300025315 | Ga0207697_10010476 | Ga0207697_100104763 | 320 |
| 472 | 3300025931 | Ga0207644_10000468 | Ga0207644_100004689 | 320 |
| 473 | 3300026088 | Ga0207641_10000004 | Ga0207641_10000004320 | 320 |
| 474 | 3300028380 | Ga0268265_10009732 | Ga0268265_100097323 | 320 |
| 475 | 3300005937 | Ga0081455_10000131 | Ga0081455_1000013111 | 321 |
| 476 | 3300001904 | JGI24736J21556_1000015 | JGI24736J21556_100001528 | 322 |
| 477 | 3300001976 | JGI24752J21851_1000049 | JGI24752J21851_10000497 | 322 |
| 478 | 3300001976 | JGI24752J21851_1000292 | JGI24752J21851_10002924 | 322 |
| 479 | 3300001979 | JGI24740J21852_10013955 | JGI24740J21852_100139553 | 322 |
| 480 | 3300001979 | JGI24740J21852_10037279 | JGI24740J21852_100372792 | 322 |
| 481 | 3300001989 | JGI24739J22299_10036742 | JGI24739J22299_100367421 | 322 |
| 482 | 3300001990 | JGI24737J22298_10002130 | JGI24737J22298_100021302 | 322 |
| 483 | 3300002070 | JGI24750J21931_1000468 | JGI24750J21931_10004684 | 322 |
| 484 | 3300002074 | JGI24748J21848_1000023 | JGI24748J21848_100002358 | 322 |
| 485 | 3300002076 | JGI24749J21850_1003108 | JGI24749J21850_10031082 | 322 |
| 486 | 3300002239 | JGI24034J26672_10000010 | JGI24034J26672_1000001050 | 322 |
| 487 | 3300002244 | JGI24742J22300_10000379 | JGI24742J22300_100003795 | 322 |
| 488 | 3300005289 | Ga0065704_10074031 | Ga0065704_100740313 | 322 |
| 489 | 3300005295 | Ga0065707_10000756 | Ga0065707_1000075611 | 322 |
| 490 | 3300005330 | Ga0070690_100000055 | Ga0070690_10000005538 | 322 |
| 491 | 3300005331 | Ga0070670_100003689 | Ga0070670_1000036896 | 322 |
| 492 | 3300005331 | Ga0070670_100019603 | Ga0070670_1000196033 | 322 |
| 493 | 3300005335 | Ga0070666_10000009 | Ga0070666_10000009208 | 322 |
| 494 | 3300005339 | Ga0070660_100225084 | Ga0070660_1002250842 | 322 |
| 495 | 3300005344 | Ga0070661_100081195 | Ga0070661_1000811951 | 322 |
| 496 | 3300005347 | Ga0070668_100254690 | Ga0070668_1002546902 | 322 |
| 497 | 3300005353 | Ga0070669_100000017 | Ga0070669_10000001776 | 322 |
| 498 | 3300005355 | Ga0070671_100008047 | Ga0070671_1000080473 | 322 |
| 499 | 3300005365 | Ga0070688_100001642 | Ga0070688_1000016428 | 322 |
| 500 | 3300005366 | Ga0070659_100377530 | Ga0070659_1003775301 | 322 |
| 501 | 3300005367 | Ga0070667_100005285 | Ga0070667_1000052856 | 322 |
| 502 | 3300005367 | Ga0070667_100016118 | Ga0070667_1000161183 | 322 |
| 503 | 3300005455 | Ga0070663_100128828 | Ga0070663_1001288282 | 322 |
| 504 | 3300005457 | Ga0070662_100026537 | Ga0070662_1000265373 | 322 |
| 505 | 3300005457 | Ga0070662_100072153 | Ga0070662_1000721532 | 322 |
| 506 | 3300005457 | Ga0070662_100280455 | Ga0070662_1002804552 | 322 |
| 507 | 3300005539 | Ga0068853_100017709 | Ga0068853_1000177098 | 322 |
| 508 | 3300005544 | Ga0070686_100000041 | Ga0070686_10000004146 | 322 |
| 509 | 3300005548 | Ga0070665_100000368 | Ga0070665_1000003688 | 322 |
| 510 | 3300005617 | Ga0068859_100018363 | Ga0068859_1000183635 | 322 |
| 511 | 3300005617 | Ga0068859_100060919 | Ga0068859_1000609191 | 322 |
| 512 | 3300005618 | Ga0068864_100003451 | Ga0068864_1000034516 | 322 |
| 513 | 3300005618 | Ga0068864_100053745 | Ga0068864_1000537453 | 322 |
| 514 | 3300005719 | Ga0068861_100000441 | Ga0068861_1000004414 | 322 |
| 515 | 3300005841 | Ga0068863_100000705 | Ga0068863_10000070510 | 322 |
| 516 | 3300005841 | Ga0068863_100005275 | Ga0068863_1000052756 | 322 |
| 517 | 3300005842 | Ga0068858_100000637 | Ga0068858_10000063733 | 322 |
| 518 | 3300005842 | Ga0068858_100400496 | Ga0068858_1004004962 | 322 |
| 519 | 3300005843 | Ga0068860_100000022 | Ga0068860_100000022208 | 322 |
| 520 | 3300005844 | Ga0068862_100000596 | Ga0068862_10000059615 | 322 |
| 521 | 3300005844 | Ga0068862_100003863 | Ga0068862_1000038636 | 322 |
| 522 | 3300006931 | Ga0097620_100018363 | Ga0097620_1000183635 | 322 |
| 523 | 3300006931 | Ga0097620_100060922 | Ga0097620_1000609221 | 322 |
| 524 | 3300009011 | Ga0105251_10002945 | Ga0105251_100029456 | 322 |
| 525 | 3300009101 | Ga0105247_10002517 | Ga0105247_1000251710 | 322 |
| 526 | 3300009174 | Ga0105241_10305683 | Ga0105241_103056832 | 322 |
| 527 | 3300009177 | Ga0105248_10000026 | Ga0105248_1000002620 | 322 |
| 528 | 3300009545 | Ga0105237_10194254 | Ga0105237_101942542 | 322 |
| 529 | 3300009551 | Ga0105238_10100915 | Ga0105238_101009151 | 322 |
| 530 | 3300009551 | Ga0105238_10197562 | Ga0105238_101975622 | 322 |
| 531 | 3300009553 | Ga0105249_10000123 | Ga0105249_100001234 | 322 |
| 532 | 3300010375 | Ga0105239_10780243 | Ga0105239_107802431 | 322 |
| 533 | 3300013297 | Ga0157378_10048869 | Ga0157378_100488693 | 322 |
| 534 | 3300013306 | Ga0163162_10015641 | Ga0163162_100156413 | 322 |
| 535 | 3300014325 | Ga0163163_10028778 | Ga0163163_100287785 | 322 |
| 536 | 3300014325 | Ga0163163_10301473 | Ga0163163_103014732 | 322 |
| 537 | 3300014326 | Ga0157380_10000063 | Ga0157380_1000006320 | 322 |
| 538 | 3300014326 | Ga0157380_10005568 | Ga0157380_100055685 | 322 |
| 539 | 3300014968 | Ga0157379_10010303 | Ga0157379_100103037 | 322 |
| 540 | 3300017792 | Ga0163161_10000057 | Ga0163161_10000057106 | 322 |
| 541 | 3300025223 | Ga0207672_1000345 | Ga0207672_10003453 | 322 |
| 542 | 3300025735 | Ga0207713_1001272 | Ga0207713_10012723 | 322 |
| 543 | 3300025900 | Ga0207710_10047475 | Ga0207710_100474752 | 322 |
| 544 | 3300025903 | Ga0207680_10000007 | Ga0207680_1000000770 | 322 |
| 545 | 3300025904 | Ga0207647_10024607 | Ga0207647_100246073 | 322 |
| 546 | 3300025911 | Ga0207654_10002475 | Ga0207654_100024753 | 322 |
| 547 | 3300025913 | Ga0207695_10004592 | Ga0207695_1000459220 | 322 |
| 548 | 3300025914 | Ga0207671_10001130 | Ga0207671_1000113010 | 322 |
| 549 | 3300025919 | Ga0207657_10124035 | Ga0207657_101240352 | 322 |
| 550 | 3300025919 | Ga0207657_10124092 | Ga0207657_101240922 | 322 |
| 551 | 3300025923 | Ga0207681_10000029 | Ga0207681_10000029117 | 322 |
| 552 | 3300025924 | Ga0207694_10000589 | Ga0207694_1000058929 | 322 |
| 553 | 3300025924 | Ga0207694_10115523 | Ga0207694_101155232 | 322 |
| 554 | 3300025925 | Ga0207650_10001245 | Ga0207650_100012453 | 322 |
| 555 | 3300025925 | Ga0207650_10015378 | Ga0207650_100153783 | 322 |
| 556 | 3300025931 | Ga0207644_10000121 | Ga0207644_100001216 | 322 |
| 557 | 3300025933 | Ga0207706_10032956 | Ga0207706_100329562 | 322 |
| 558 | 3300025933 | Ga0207706_10036849 | Ga0207706_100368493 | 322 |
| 559 | 3300025941 | Ga0207711_10000004 | Ga0207711_1000000434 | 322 |
| 560 | 3300025941 | Ga0207711_10034550 | Ga0207711_100345503 | 322 |
| 561 | 3300025944 | Ga0207661_10260147 | Ga0207661_102601472 | 322 |
| 562 | 3300025949 | Ga0207667_10041478 | Ga0207667_100414784 | 322 |
| 563 | 3300025961 | Ga0207712_10000004 | Ga0207712_1000000458 | 322 |
| 564 | 3300025961 | Ga0207712_10000102 | Ga0207712_100001024 | 322 |
| 565 | 3300025972 | Ga0207668_10228538 | Ga0207668_102285382 | 322 |
| 566 | 3300025981 | Ga0207640_10045130 | Ga0207640_100451302 | 322 |
| 567 | 3300025986 | Ga0207658_10000462 | Ga0207658_1000046215 | 322 |
| 568 | 3300025986 | Ga0207658_10002693 | Ga0207658_100026936 | 322 |
| 569 | 3300026035 | Ga0207703_10003457 | Ga0207703_1000345715 | 322 |
| 570 | 3300026035 | Ga0207703_10127394 | Ga0207703_101273942 | 322 |
| 571 | 3300026041 | Ga0207639_10004903 | Ga0207639_100049032 | 322 |
| 572 | 3300026041 | Ga0207639_10067713 | Ga0207639_100677132 | 322 |
| 573 | 3300026041 | Ga0207639_10352757 | Ga0207639_103527572 | 322 |
| 574 | 3300026067 | Ga0207678_10023713 | Ga0207678_100237132 | 322 |
| 575 | 3300026078 | Ga0207702_10006618 | Ga0207702_100066185 | 322 |
| 576 | 3300026078 | Ga0207702_10393948 | Ga0207702_103939482 | 322 |
| 577 | 3300026088 | Ga0207641_10000263 | Ga0207641_1000026320 | 322 |
| 578 | 3300026088 | Ga0207641_10001006 | Ga0207641_1000100621 | 322 |
| 579 | 3300026095 | Ga0207676_10002192 | Ga0207676_100021928 | 322 |
| 580 | 3300026095 | Ga0207676_10012220 | Ga0207676_100122203 | 322 |
| 581 | 3300026116 | Ga0207674_10160738 | Ga0207674_101607382 | 322 |
| 582 | 3300026116 | Ga0207674_10174914 | Ga0207674_101749142 | 322 |
| 583 | 3300026116 | Ga0207674_10416303 | Ga0207674_104163032 | 322 |
| 584 | 3300026118 | Ga0207675_100000131 | Ga0207675_10000013118 | 322 |
| 585 | 3300026142 | Ga0207698_10132403 | Ga0207698_101324032 | 322 |
| 586 | 3300028379 | Ga0268266_10000117 | Ga0268266_10000117156 | 322 |
| 587 | 3300028380 | Ga0268265_10000266 | Ga0268265_1000026639 | 322 |
| 588 | 3300028380 | Ga0268265_10002836 | Ga0268265_100028364 | 322 |
| 589 | 3300028381 | Ga0268264_10000003 | Ga0268264_1000000372 | 322 |
| 590 | 3300031911 | Ga0307412_10028705 | Ga0307412_100287052 | 322 |
| 591 | 3300046525 | Ga0495663_0004218 | Ga0495663_0004218_2662_3630 | 322 |
| 592 | 3300046530 | Ga0495654_0003096 | Ga0495654_0003096_8696_9664 | 322 |
| 593 | 3300046616 | Ga0495668_0000989 | Ga0495668_0000989_23631_24599 | 322 |
| 594 | 3300048904 | Ga0496101_0061575 | Ga0496101_0061575_890_1858 | 322 |
| 595 | 3300048905 | Ga0496102_0007301 | Ga0496102_0007301_4313_5287 | 322 |
| 596 | 3300048905 | Ga0496102_0279022 | Ga0496102_0279022_462_1430 | 322 |
| 597 | 3300048906 | Ga0496103_0039583 | Ga0496103_0039583_215_1183 | 322 |
| 598 | 3300048907 | Ga0496104_0010865 | Ga0496104_0010865_5880_6854 | 322 |
| 599 | 3300048908 | Ga0496105_0039921 | Ga0496105_0039921_2588_3562 | 322 |
| 600 | 3300048909 | Ga0496106_0054464 | Ga0496106_0054464_1996_2970 | 322 |
| 601 | 3300048913 | Ga0496110_0151791 | Ga0496110_0151791_315_1289 | 322 |
| 602 | 3300048919 | Ga0496116_0086824 | Ga0496116_0086824_510_1484 | 322 |
| 603 | 3300048920 | Ga0496117_0002856 | Ga0496117_0002856_18553_19527 | 322 |
| 604 | 3300048920 | Ga0496117_0015664 | Ga0496117_0015664_2019_2987 | 322 |
| 605 | 3300048921 | Ga0496118_0001042 | Ga0496118_0001042_33174_34142 | 322 |
| 606 | 3300048921 | Ga0496118_0089039 | Ga0496118_0089039_194_1168 | 322 |
| 607 | 3300048923 | Ga0496120_0146545 | Ga0496120_0146545_85_1059 | 322 |
| 608 | 3300048927 | Ga0496124_0092797 | Ga0496124_0092797_829_1803 | 322 |
| 609 | 3300053116 | Ga0500592_000854 | Ga0500592_000854_1381_2352 | 322 |
| 610 | 3300053158 | Ga0500627_0000371 | Ga0500627_0000371_9083_10051 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
158
329
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.8663 | 131 | 321 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7619 | 128 | 316 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.7583 | 128 | 318 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.739 | 131 | 321 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.7264 | 133 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9486 | 128 | 321 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9393 | 125 | 318 | 1.10.3720.10 |
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.937 | 133 | 317 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9326 | 128 | 316 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9316 | 131 | 317 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530M5U9-F1-model_v4 | deleted | 0.9738 | 143 | 287 |
|
| AF-A0A485EKB7-F1-model_v4 | deleted | 0.963 | 198 | 321 |
|
| AF-A0A530M5U9-F1-model_v4 | deleted | 0.9545 | 143 | 287 |
|
| AF-A0A531JBF7-F1-model_v4 | ABC transporter permease subunit | 0.953 | 193 | 321 |
GO:0005886
GO:0010438 GO:0055085 |
| AF-A0A090RDL0-F1-model_v4 | deleted | 0.9385 | 167 | 321 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar