F468759
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 362 | 603 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300004798|Ga0058859_11486220|Ga0058859_114862201 |
| Length | 105 |
| Sequence | VLAITLQVLYLLLYVFFLTLIARFIMGYVLTFGRRWQPGRGAAAAMEVVWSVTDPPLKALRRVIPPLRLGTVSLDLSSLVLLVILFVLMDFVVRPLITSVALAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 3 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 4 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 5 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 6 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 215 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 216 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 217 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 252 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 255 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 256 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 257 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 258 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 259 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 260 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 261 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 262 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 263 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 264 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 265 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 266 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 312 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 313 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 316 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.7 |
| Metatranscriptomes | 14.47 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.8 |
| Nodule | 0 |
| Rhizoplane | 3.45 |
| Rhizosphere | 90.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1013115 | 3300000549 | Bacteria | 977 |
| 2 | JGI24743J22301_10025346 | 3300001991 | Bacteria | 1149 |
| 3 | JGI24745J21846_1015638 | 3300002073 | Bacteria | 878 |
| 4 | JGI24033J26618_1012900 | 3300002155 | Bacteria | 1010 |
| 5 | JGI24751J29686_10007576 | 3300002459 | Bacteria | 2218 |
| 6 | JGI25160J50197_1034560 | 3300003354 | Bacteria | 1254 |
| 7 | JGI25160J50197_1039529 | 3300003354 | Bacteria | 1103 |
| 8 | Ga0007409J51694_1045481 | 3300003575 | Bacteria | 790 |
| 9 | Ga0007429J51699_1153713 | 3300003579 | Bacteria | 536 |
| 10 | Ga0032354_1074863 | 3300003693 | Bacteria | 619 |
| 11 | Ga0032354_1110810 | 3300003693 | Bacteria | 542 |
| 12 | Ga0058859_11373918 | 3300004798 | Bacteria | 798 |
| 13 | Ga0058859_11486220 | 3300004798 | Bacteria | 612 |
| 14 | Ga0058863_11972618 | 3300004799 | Bacteria | 1420 |
| 15 | Ga0058861_10042331 | 3300004800 | Bacteria | 1021 |
| 16 | Ga0058861_12063929 | 3300004800 | Bacteria | 1668 |
| 17 | Ga0058861_12067567 | 3300004800 | Bacteria | 1419 |
| 18 | Ga0058860_10026024 | 3300004801 | Bacteria | 766 |
| 19 | Ga0058860_11635538 | 3300004801 | Bacteria | 711 |
| 20 | Ga0058860_12229073 | 3300004801 | Bacteria | 752 |
| 21 | Ga0058862_10093961 | 3300004803 | Bacteria | 794 |
| 22 | Ga0058862_12888595 | 3300004803 | Bacteria | 1773 |
| 23 | Ga0070658_10131350 | 3300005327 | Bacteria | 2087 |
| 24 | Ga0070676_10011402 | 3300005328 | Bacteria | 4834 |
| 25 | Ga0070676_10378285 | 3300005328 | Bacteria | 980 |
| 26 | Ga0070683_100004355 | 3300005329 | Bacteria | 11650 |
| 27 | Ga0070683_100066754 | 3300005329 | Bacteria | 3351 |
| 28 | Ga0070683_100264596 | 3300005329 | Bacteria | 1636 |
| 29 | Ga0070683_100322614 | 3300005329 | Bacteria | 1470 |
| 30 | Ga0070690_100047860 | 3300005330 | Bacteria | 2721 |
| 31 | Ga0070670_100055930 | 3300005331 | Bacteria | 3386 |
| 32 | Ga0070670_100089256 | 3300005331 | Bacteria | 2650 |
| 33 | Ga0070670_100164881 | 3300005331 | Bacteria | 1921 |
| 34 | Ga0070670_100996519 | 3300005331 | Bacteria | 762 |
| 35 | Ga0068869_100005028 | 3300005334 | Bacteria | 8284 |
| 36 | Ga0068869_101454434 | 3300005334 | Bacteria | 608 |
| 37 | Ga0070666_10073850 | 3300005335 | Bacteria | 2323 |
| 38 | Ga0070680_100007324 | 3300005336 | Bacteria | 8415 |
| 39 | Ga0070682_100006130 | 3300005337 | Bacteria | 6734 |
| 40 | Ga0070682_101344187 | 3300005337 | Bacteria | 609 |
| 41 | Ga0070682_101668963 | 3300005337 | Bacteria | 553 |
| 42 | Ga0068868_100034447 | 3300005338 | Bacteria | 3909 |
| 43 | Ga0068868_100088880 | 3300005338 | Bacteria | 2487 |
| 44 | Ga0070660_100069503 | 3300005339 | Bacteria | 2746 |
| 45 | Ga0070660_100316086 | 3300005339 | Bacteria | 1282 |
| 46 | Ga0070689_100027775 | 3300005340 | Bacteria | 4269 |
| 47 | Ga0070689_100195991 | 3300005340 | Bacteria | 1647 |
| 48 | Ga0070689_102147115 | 3300005340 | Bacteria | 512 |
| 49 | Ga0070691_10001280 | 3300005341 | Bacteria | 10635 |
| 50 | Ga0070691_10268408 | 3300005341 | Bacteria | 921 |
| 51 | Ga0070687_100055004 | 3300005343 | Bacteria | 2076 |
| 52 | Ga0070687_100725161 | 3300005343 | Bacteria | 697 |
| 53 | Ga0070661_100129772 | 3300005344 | Bacteria | 1892 |
| 54 | Ga0070661_100138050 | 3300005344 | Bacteria | 1836 |
| 55 | Ga0070661_101113932 | 3300005344 | Bacteria | 658 |
| 56 | Ga0070692_10042533 | 3300005345 | Bacteria | 2333 |
| 57 | Ga0070692_10079679 | 3300005345 | Bacteria | 1761 |
| 58 | Ga0070668_100251629 | 3300005347 | Bacteria | 1467 |
| 59 | Ga0070668_100445157 | 3300005347 | Bacteria | 1113 |
| 60 | Ga0070668_101733383 | 3300005347 | Bacteria | 574 |
| 61 | Ga0070669_100369001 | 3300005353 | Bacteria | 1169 |
| 62 | Ga0070675_100001206 | 3300005354 | Bacteria | 18804 |
| 63 | Ga0070675_100084219 | 3300005354 | Bacteria | 2655 |
| 64 | Ga0070671_100034998 | 3300005355 | Bacteria | 4159 |
| 65 | Ga0070671_101591268 | 3300005355 | Bacteria | 579 |
| 66 | Ga0070674_100279202 | 3300005356 | Bacteria | 1323 |
| 67 | Ga0070673_100102151 | 3300005364 | Bacteria | 2363 |
| 68 | Ga0070673_100745257 | 3300005364 | Bacteria | 902 |
| 69 | Ga0070688_100127502 | 3300005365 | Bacteria | 1712 |
| 70 | Ga0070659_100027291 | 3300005366 | Bacteria | 4398 |
| 71 | Ga0070659_100032754 | 3300005366 | Bacteria | 4033 |
| 72 | Ga0070659_101049263 | 3300005366 | Bacteria | 717 |
| 73 | Ga0070659_101269643 | 3300005366 | Bacteria | 652 |
| 74 | Ga0070667_100209129 | 3300005367 | Bacteria | 1734 |
| 75 | Ga0070703_10469316 | 3300005406 | Bacteria | 561 |
| 76 | Ga0070709_10012683 | 3300005434 | Bacteria | 4720 |
| 77 | Ga0070714_100021156 | 3300005435 | Bacteria | 5319 |
| 78 | Ga0070713_100020612 | 3300005436 | Bacteria | 5058 |
| 79 | Ga0070710_10064268 | 3300005437 | Bacteria | 2098 |
| 80 | Ga0070701_10415330 | 3300005438 | Bacteria | 856 |
| 81 | Ga0070701_10924436 | 3300005438 | Bacteria | 604 |
| 82 | Ga0070711_100045757 | 3300005439 | Bacteria | 2979 |
| 83 | Ga0070700_100010220 | 3300005441 | Bacteria | 5177 |
| 84 | Ga0070700_100016103 | 3300005441 | Bacteria | 4253 |
| 85 | Ga0070700_100656531 | 3300005441 | Bacteria | 829 |
| 86 | Ga0070694_100541311 | 3300005444 | Bacteria | 931 |
| 87 | Ga0070663_100006877 | 3300005455 | Bacteria | 6884 |
| 88 | Ga0070663_100009250 | 3300005455 | Bacteria | 6094 |
| 89 | Ga0070663_101355465 | 3300005455 | Bacteria | 629 |
| 90 | Ga0070678_100015294 | 3300005456 | Bacteria | 4873 |
| 91 | Ga0070678_100380879 | 3300005456 | Bacteria | 1220 |
| 92 | Ga0070662_100059912 | 3300005457 | Bacteria | 2774 |
| 93 | Ga0070662_100097077 | 3300005457 | Bacteria | 2224 |
| 94 | Ga0070662_101440308 | 3300005457 | Bacteria | 594 |
| 95 | Ga0070681_10029986 | 3300005458 | Bacteria | 5459 |
| 96 | Ga0068867_100099277 | 3300005459 | Bacteria | 2221 |
| 97 | Ga0070685_10054517 | 3300005466 | Bacteria | 2320 |
| 98 | Ga0070685_10298067 | 3300005466 | Bacteria | 1086 |
| 99 | Ga0070679_100026996 | 3300005530 | Bacteria | 5647 |
| 100 | Ga0070679_101267404 | 3300005530 | Bacteria | 683 |
| 101 | Ga0070684_100251975 | 3300005535 | Bacteria | 1614 |
| 102 | Ga0070684_101276863 | 3300005535 | Bacteria | 691 |
| 103 | Ga0070684_101412545 | 3300005535 | Bacteria | 655 |
| 104 | Ga0070684_101812912 | 3300005535 | Bacteria | 576 |
| 105 | Ga0068853_100020817 | 3300005539 | Bacteria | 5456 |
| 106 | Ga0070672_100074450 | 3300005543 | Bacteria | 2709 |
| 107 | Ga0070672_100905976 | 3300005543 | Bacteria | 779 |
| 108 | Ga0070672_101589459 | 3300005543 | Bacteria | 586 |
| 109 | Ga0070686_100143278 | 3300005544 | Bacteria | 1666 |
| 110 | Ga0070686_100622504 | 3300005544 | Bacteria | 853 |
| 111 | Ga0070686_101506756 | 3300005544 | Bacteria | 567 |
| 112 | Ga0070695_100048619 | 3300005545 | Bacteria | 2713 |
| 113 | Ga0070693_100008461 | 3300005547 | Bacteria | 5076 |
| 114 | Ga0070693_101048760 | 3300005547 | Bacteria | 619 |
| 115 | Ga0070665_100050708 | 3300005548 | Bacteria | 4165 |
| 116 | Ga0068855_100414840 | 3300005563 | Bacteria | 1474 |
| 117 | Ga0070664_100000690 | 3300005564 | Bacteria | 25782 |
| 118 | Ga0070664_100086877 | 3300005564 | Bacteria | 2702 |
| 119 | Ga0070664_100241888 | 3300005564 | Bacteria | 1620 |
| 120 | Ga0068857_100101428 | 3300005577 | Bacteria | 2583 |
| 121 | Ga0068857_100109175 | 3300005577 | Bacteria | 2486 |
| 122 | Ga0068857_100321271 | 3300005577 | Bacteria | 1430 |
| 123 | Ga0068857_100533179 | 3300005577 | Bacteria | 1104 |
| 124 | Ga0068857_101259728 | 3300005577 | Bacteria | 717 |
| 125 | Ga0068857_102256387 | 3300005577 | Unclassified | 534 |
| 126 | Ga0068854_100159807 | 3300005578 | Bacteria | 1744 |
| 127 | Ga0068854_100519361 | 3300005578 | Bacteria | 1006 |
| 128 | Ga0068856_100002544 | 3300005614 | Bacteria | 18785 |
| 129 | Ga0068856_100136829 | 3300005614 | Bacteria | 2455 |
| 130 | Ga0070702_100001607 | 3300005615 | Bacteria | 9342 |
| 131 | Ga0068852_100024929 | 3300005616 | Bacteria | 4840 |
| 132 | Ga0068852_101108374 | 3300005616 | Bacteria | 812 |
| 133 | Ga0068852_101869030 | 3300005616 | Bacteria | 623 |
| 134 | Ga0068859_100333109 | 3300005617 | Bacteria | 1612 |
| 135 | Ga0068859_100385679 | 3300005617 | Bacteria | 1497 |
| 136 | Ga0068864_100014265 | 3300005618 | Bacteria | 6599 |
| 137 | Ga0068864_100101208 | 3300005618 | Bacteria | 2555 |
| 138 | Ga0068864_100162000 | 3300005618 | Bacteria | 2034 |
| 139 | Ga0068864_101588084 | 3300005618 | Bacteria | 658 |
| 140 | Ga0068866_11308658 | 3300005718 | Bacteria | 527 |
| 141 | Ga0068861_100046078 | 3300005719 | Bacteria | 3287 |
| 142 | Ga0068861_100102170 | 3300005719 | Bacteria | 2282 |
| 143 | Ga0068870_10000398 | 3300005840 | Bacteria | 16349 |
| 144 | Ga0068863_100004122 | 3300005841 | Bacteria | 14368 |
| 145 | Ga0068863_100068954 | 3300005841 | Bacteria | 3345 |
| 146 | Ga0068863_100349375 | 3300005841 | Bacteria | 1440 |
| 147 | Ga0068858_100011915 | 3300005842 | Bacteria | 8195 |
| 148 | Ga0068858_100354082 | 3300005842 | Bacteria | 1406 |
| 149 | Ga0068858_100907509 | 3300005842 | Bacteria | 862 |
| 150 | Ga0068860_100089056 | 3300005843 | Bacteria | 2938 |
| 151 | Ga0068860_100424306 | 3300005843 | Bacteria | 1319 |
| 152 | Ga0068862_100044918 | 3300005844 | Bacteria | 3769 |
| 153 | Ga0068862_100718950 | 3300005844 | Bacteria | 969 |
| 154 | Ga0068862_101856935 | 3300005844 | Bacteria | 612 |
| 155 | Ga0081455_10185127 | 3300005937 | Bacteria | 1573 |
| 156 | Ga0081540_1033333 | 3300005983 | Bacteria | 2799 |
| 157 | Ga0075365_10150638 | 3300006038 | Bacteria | 1618 |
| 158 | Ga0075432_10018558 | 3300006058 | Bacteria | 2373 |
| 159 | Ga0070716_100272535 | 3300006173 | Bacteria | 1164 |
| 160 | Ga0070712_100099572 | 3300006175 | Bacteria | 2146 |
| 161 | Ga0075367_11037579 | 3300006178 | Bacteria | 524 |
| 162 | Ga0097621_100020834 | 3300006237 | Bacteria | 5059 |
| 163 | Ga0068871_100057136 | 3300006358 | Bacteria | 3174 |
| 164 | Ga0075428_100000182 | 3300006844 | Bacteria | 58871 |
| 165 | Ga0075428_100048038 | 3300006844 | Bacteria | 4685 |
| 166 | Ga0075428_100204933 | 3300006844 | Bacteria | 2132 |
| 167 | Ga0075428_102202173 | 3300006844 | Bacteria | 569 |
| 168 | Ga0075430_100317226 | 3300006846 | Bacteria | 1289 |
| 169 | Ga0075431_100083893 | 3300006847 | Bacteria | 3289 |
| 170 | Ga0075431_100966354 | 3300006847 | Bacteria | 820 |
| 171 | Ga0075431_101015528 | 3300006847 | Bacteria | 796 |
| 172 | Ga0075431_101717039 | 3300006847 | Bacteria | 584 |
| 173 | Ga0075433_10001267 | 3300006852 | Bacteria | 18447 |
| 174 | Ga0075433_10801766 | 3300006852 | Bacteria | 823 |
| 175 | Ga0075433_11269025 | 3300006852 | Bacteria | 639 |
| 176 | Ga0075434_100027893 | 3300006871 | Bacteria | 5543 |
| 177 | Ga0075434_102570325 | 3300006871 | Bacteria | 510 |
| 178 | Ga0075429_100049388 | 3300006880 | Bacteria | 3658 |
| 179 | Ga0075429_100241139 | 3300006880 | Bacteria | 1583 |
| 180 | Ga0075429_100356979 | 3300006880 | Bacteria | 1280 |
| 181 | Ga0075429_100519882 | 3300006880 | Bacteria | 1043 |
| 182 | Ga0068865_100220713 | 3300006881 | Bacteria | 1482 |
| 183 | Ga0068865_100346074 | 3300006881 | Bacteria | 1203 |
| 184 | Ga0075436_100031906 | 3300006914 | Bacteria | 3629 |
| 185 | Ga0097620_100333145 | 3300006931 | Bacteria | 1612 |
| 186 | Ga0097620_100385658 | 3300006931 | Bacteria | 1497 |
| 187 | Ga0075435_100149566 | 3300007076 | Bacteria | 1962 |
| 188 | Ga0105251_10009517 | 3300009011 | Bacteria | 5730 |
| 189 | Ga0105244_10137102 | 3300009036 | Bacteria | 1179 |
| 190 | Ga0105240_10210368 | 3300009093 | Bacteria | 2273 |
| 191 | Ga0111539_10009710 | 3300009094 | Bacteria | 12145 |
| 192 | Ga0111539_10057516 | 3300009094 | Bacteria | 4618 |
| 193 | Ga0111539_10794641 | 3300009094 | Bacteria | 1101 |
| 194 | Ga0111539_10807059 | 3300009094 | Bacteria | 1092 |
| 195 | Ga0105245_10007354 | 3300009098 | Bacteria | 9643 |
| 196 | Ga0105245_10049551 | 3300009098 | Bacteria | 3762 |
| 197 | Ga0105245_12566034 | 3300009098 | Bacteria | 563 |
| 198 | Ga0105247_10056427 | 3300009101 | Bacteria | 2425 |
| 199 | Ga0114129_10029013 | 3300009147 | Bacteria | 7837 |
| 200 | Ga0114129_10172664 | 3300009147 | Bacteria | 2946 |
| 201 | Ga0114129_10403857 | 3300009147 | Bacteria | 1800 |
| 202 | Ga0114129_10606568 | 3300009147 | Bacteria | 1418 |
| 203 | Ga0114129_11283213 | 3300009147 | Bacteria | 908 |
| 204 | Ga0114129_12315031 | 3300009147 | Bacteria | 645 |
| 205 | Ga0105243_10047873 | 3300009148 | Bacteria | 3368 |
| 206 | Ga0105243_11119963 | 3300009148 | Bacteria | 796 |
| 207 | Ga0105243_12158859 | 3300009148 | Bacteria | 593 |
| 208 | Ga0105241_10038274 | 3300009174 | Bacteria | 3615 |
| 209 | Ga0105241_10255123 | 3300009174 | Bacteria | 1488 |
| 210 | Ga0105241_10620006 | 3300009174 | Bacteria | 979 |
| 211 | Ga0105242_10523922 | 3300009176 | Bacteria | 1131 |
| 212 | Ga0105242_11351181 | 3300009176 | Bacteria | 738 |
| 213 | Ga0105248_10173700 | 3300009177 | Bacteria | 2429 |
| 214 | Ga0105248_13394863 | 3300009177 | Bacteria | 506 |
| 215 | Ga0105237_10170077 | 3300009545 | Bacteria | 2179 |
| 216 | Ga0105237_10330358 | 3300009545 | Bacteria | 1529 |
| 217 | Ga0105237_10535854 | 3300009545 | Bacteria | 1177 |
| 218 | Ga0105238_10053895 | 3300009551 | Bacteria | 4041 |
| 219 | Ga0105238_10813264 | 3300009551 | Bacteria | 950 |
| 220 | Ga0105238_11134663 | 3300009551 | Bacteria | 805 |
| 221 | Ga0105238_11935938 | 3300009551 | Bacteria | 623 |
| 222 | Ga0105249_10045189 | 3300009553 | Bacteria | 4005 |
| 223 | Ga0105249_10164646 | 3300009553 | Bacteria | 2146 |
| 224 | Ga0105249_10224343 | 3300009553 | Bacteria | 1851 |
| 225 | Ga0105249_10643457 | 3300009553 | Bacteria | 1118 |
| 226 | Ga0105239_10042350 | 3300010375 | Bacteria | 4990 |
| 227 | Ga0105239_10047187 | 3300010375 | Bacteria | 4720 |
| 228 | Ga0105239_10216047 | 3300010375 | Bacteria | 2150 |
| 229 | Ga0105246_10001558 | 3300011119 | Bacteria | 13631 |
| 230 | Ga0105246_12520294 | 3300011119 | Bacteria | 507 |
| 231 | Ga0154019_129167 | 3300013044 | Bacteria | 1145 |
| 232 | Ga0154010_153672 | 3300013062 | Bacteria | 764 |
| 233 | Ga0157373_10059871 | 3300013100 | Bacteria | 2698 |
| 234 | Ga0157371_10010033 | 3300013102 | Bacteria | 7406 |
| 235 | Ga0157370_10290396 | 3300013104 | Bacteria | 1510 |
| 236 | Ga0157369_10490442 | 3300013105 | Bacteria | 1271 |
| 237 | Ga0157369_10769761 | 3300013105 | Bacteria | 990 |
| 238 | Ga0157374_10026833 | 3300013296 | Bacteria | 5187 |
| 239 | Ga0157374_11800245 | 3300013296 | Bacteria | 638 |
| 240 | Ga0157378_10535169 | 3300013297 | Bacteria | 1175 |
| 241 | Ga0157378_11300763 | 3300013297 | Bacteria | 768 |
| 242 | Ga0163162_10620883 | 3300013306 | Bacteria | 1206 |
| 243 | Ga0163162_11960990 | 3300013306 | Bacteria | 671 |
| 244 | Ga0157372_10392986 | 3300013307 | Bacteria | 1616 |
| 245 | Ga0157375_10182075 | 3300013308 | Bacteria | 2253 |
| 246 | Ga0163163_10412540 | 3300014325 | Bacteria | 1409 |
| 247 | Ga0163163_10419522 | 3300014325 | Bacteria | 1397 |
| 248 | Ga0163163_11819650 | 3300014325 | Bacteria | 669 |
| 249 | Ga0163163_12192914 | 3300014325 | Bacteria | 612 |
| 250 | Ga0157380_10707333 | 3300014326 | Bacteria | 1013 |
| 251 | Ga0157380_13318085 | 3300014326 | Bacteria | 515 |
| 252 | Ga0182008_10055864 | 3300014497 | Bacteria | 1952 |
| 253 | Ga0157377_10019775 | 3300014745 | Bacteria | 3521 |
| 254 | Ga0157377_10022949 | 3300014745 | Bacteria | 3301 |
| 255 | Ga0157377_10599468 | 3300014745 | Bacteria | 785 |
| 256 | Ga0157377_11422890 | 3300014745 | Bacteria | 548 |
| 257 | Ga0157379_10033665 | 3300014968 | Bacteria | 4569 |
| 258 | Ga0157379_10137330 | 3300014968 | Bacteria | 2203 |
| 259 | Ga0157379_10554677 | 3300014968 | Bacteria | 1069 |
| 260 | Ga0157376_10040153 | 3300014969 | Bacteria | 3823 |
| 261 | Ga0157376_10480737 | 3300014969 | Bacteria | 1217 |
| 262 | Ga0163161_10634386 | 3300017792 | Bacteria | 884 |
| 263 | Ga0197907_10890035 | 3300020069 | Bacteria | 1473 |
| 264 | Ga0197907_11016600 | 3300020069 | Bacteria | 754 |
| 265 | Ga0206356_10889166 | 3300020070 | Bacteria | 1583 |
| 266 | Ga0206356_11432754 | 3300020070 | Bacteria | 1537 |
| 267 | Ga0206349_1095474 | 3300020075 | Bacteria | 1403 |
| 268 | Ga0206349_1740722 | 3300020075 | Bacteria | 1628 |
| 269 | Ga0206355_1355011 | 3300020076 | Bacteria | 629 |
| 270 | Ga0206351_10308496 | 3300020077 | Bacteria | 1691 |
| 271 | Ga0206351_10485341 | 3300020077 | Bacteria | 1360 |
| 272 | Ga0206352_10121977 | 3300020078 | Bacteria | 1415 |
| 273 | Ga0206352_10284584 | 3300020078 | Bacteria | 674 |
| 274 | Ga0206350_10182640 | 3300020080 | Bacteria | 651 |
| 275 | Ga0206350_10199377 | 3300020080 | Bacteria | 1391 |
| 276 | Ga0206354_10245380 | 3300020081 | Bacteria | 1997 |
| 277 | Ga0206354_10357178 | 3300020081 | Bacteria | 1707 |
| 278 | Ga0206354_10790405 | 3300020081 | Bacteria | 1683 |
| 279 | Ga0206353_11417608 | 3300020082 | Bacteria | 1222 |
| 280 | Ga0154015_1264589 | 3300020610 | Bacteria | 1358 |
| 281 | Ga0154015_1376280 | 3300020610 | Bacteria | 897 |
| 282 | Ga0154015_1646162 | 3300020610 | Bacteria | 665 |
| 283 | Ga0213876_10742456 | 3300021384 | Bacteria | 522 |
| 284 | Ga0213875_10284505 | 3300021388 | Bacteria | 781 |
| 285 | Ga0224712_10063749 | 3300022467 | Bacteria | 1476 |
| 286 | Ga0224712_10400556 | 3300022467 | Bacteria | 654 |
| 287 | Ga0207426_1008130 | 3300025302 | Bacteria | 4286 |
| 288 | Ga0207426_1011991 | 3300025302 | Bacteria | 3275 |
| 289 | Ga0207713_1040095 | 3300025735 | Bacteria | 1969 |
| 290 | Ga0207642_11109052 | 3300025899 | Bacteria | 512 |
| 291 | Ga0207710_10138624 | 3300025900 | Bacteria | 1173 |
| 292 | Ga0207688_10009899 | 3300025901 | Bacteria | 5190 |
| 293 | Ga0207688_10088217 | 3300025901 | Bacteria | 1779 |
| 294 | Ga0207688_10179190 | 3300025901 | Bacteria | 1263 |
| 295 | Ga0207680_10100006 | 3300025903 | Bacteria | 1861 |
| 296 | Ga0207647_10063599 | 3300025904 | Bacteria | 2244 |
| 297 | Ga0207699_10320428 | 3300025906 | Bacteria | 1087 |
| 298 | Ga0207645_10169000 | 3300025907 | Bacteria | 1432 |
| 299 | Ga0207643_10000829 | 3300025908 | Bacteria | 18766 |
| 300 | Ga0207643_10088314 | 3300025908 | Bacteria | 1804 |
| 301 | Ga0207705_10009805 | 3300025909 | Bacteria | 6971 |
| 302 | Ga0207654_10054785 | 3300025911 | Bacteria | 2306 |
| 303 | Ga0207707_10330919 | 3300025912 | Bacteria | 1314 |
| 304 | Ga0207695_10200993 | 3300025913 | Bacteria | 1907 |
| 305 | Ga0207671_10104428 | 3300025914 | Bacteria | 2149 |
| 306 | Ga0207671_10302606 | 3300025914 | Bacteria | 1263 |
| 307 | Ga0207693_10105668 | 3300025915 | Bacteria | 2208 |
| 308 | Ga0207663_10012134 | 3300025916 | Bacteria | 4648 |
| 309 | Ga0207660_10074004 | 3300025917 | Bacteria | 2485 |
| 310 | Ga0207662_10055771 | 3300025918 | Bacteria | 2358 |
| 311 | Ga0207662_10139838 | 3300025918 | Bacteria | 1533 |
| 312 | Ga0207662_10890282 | 3300025918 | Bacteria | 630 |
| 313 | Ga0207657_10012901 | 3300025919 | Bacteria | 8217 |
| 314 | Ga0207657_10235462 | 3300025919 | Bacteria | 1463 |
| 315 | Ga0207657_10286186 | 3300025919 | Bacteria | 1308 |
| 316 | Ga0207649_10020772 | 3300025920 | Bacteria | 3770 |
| 317 | Ga0207649_10379938 | 3300025920 | Bacteria | 1053 |
| 318 | Ga0207649_10446554 | 3300025920 | Bacteria | 975 |
| 319 | Ga0207652_10036582 | 3300025921 | Bacteria | 4150 |
| 320 | Ga0207652_10126186 | 3300025921 | Bacteria | 2280 |
| 321 | Ga0207681_10268712 | 3300025923 | Bacteria | 1338 |
| 322 | Ga0207681_10979925 | 3300025923 | Bacteria | 709 |
| 323 | Ga0207694_10663830 | 3300025924 | Bacteria | 879 |
| 324 | Ga0207694_10776213 | 3300025924 | Bacteria | 809 |
| 325 | Ga0207694_11392500 | 3300025924 | Bacteria | 593 |
| 326 | Ga0207650_10006119 | 3300025925 | Bacteria | 8199 |
| 327 | Ga0207650_10402673 | 3300025925 | Bacteria | 1133 |
| 328 | Ga0207659_10004453 | 3300025926 | Bacteria | 8479 |
| 329 | Ga0207659_10008161 | 3300025926 | Bacteria | 6482 |
| 330 | Ga0207687_10009481 | 3300025927 | Bacteria | 6366 |
| 331 | Ga0207687_10014662 | 3300025927 | Bacteria | 5132 |
| 332 | Ga0207700_10021793 | 3300025928 | Bacteria | 4382 |
| 333 | Ga0207644_10058628 | 3300025931 | Bacteria | 2783 |
| 334 | Ga0207644_10885715 | 3300025931 | Bacteria | 748 |
| 335 | Ga0207690_10428755 | 3300025932 | Bacteria | 1059 |
| 336 | Ga0207690_10923001 | 3300025932 | Bacteria | 725 |
| 337 | Ga0207706_10015936 | 3300025933 | Bacteria | 6793 |
| 338 | Ga0207706_10045943 | 3300025933 | Bacteria | 3867 |
| 339 | Ga0207706_10459716 | 3300025933 | Bacteria | 1100 |
| 340 | Ga0207686_11218794 | 3300025934 | Bacteria | 616 |
| 341 | Ga0207709_10185818 | 3300025935 | Bacteria | 1472 |
| 342 | Ga0207670_10150336 | 3300025936 | Bacteria | 1727 |
| 343 | Ga0207670_11810693 | 3300025936 | Bacteria | 519 |
| 344 | Ga0207704_10243456 | 3300025938 | Bacteria | 1345 |
| 345 | Ga0207704_10968048 | 3300025938 | Bacteria | 718 |
| 346 | Ga0207665_11096061 | 3300025939 | Bacteria | 635 |
| 347 | Ga0207691_10014578 | 3300025940 | Bacteria | 7492 |
| 348 | Ga0207711_10196148 | 3300025941 | Bacteria | 1841 |
| 349 | Ga0207711_12102920 | 3300025941 | Bacteria | 507 |
| 350 | Ga0207689_10004110 | 3300025942 | Bacteria | 13237 |
| 351 | Ga0207689_10465654 | 3300025942 | Bacteria | 1057 |
| 352 | Ga0207661_10004749 | 3300025944 | Bacteria | 9516 |
| 353 | Ga0207661_10004995 | 3300025944 | Bacteria | 9300 |
| 354 | Ga0207661_10084137 | 3300025944 | Bacteria | 2634 |
| 355 | Ga0207661_10666640 | 3300025944 | Bacteria | 956 |
| 356 | Ga0207679_10019570 | 3300025945 | Bacteria | 4550 |
| 357 | Ga0207679_10048271 | 3300025945 | Bacteria | 3098 |
| 358 | Ga0207679_10218531 | 3300025945 | Bacteria | 1602 |
| 359 | Ga0207679_10569270 | 3300025945 | Bacteria | 1018 |
| 360 | Ga0207667_10445673 | 3300025949 | Bacteria | 1316 |
| 361 | Ga0207651_10163528 | 3300025960 | Bacteria | 1747 |
| 362 | Ga0207712_10115014 | 3300025961 | Bacteria | 2025 |
| 363 | Ga0207712_10203610 | 3300025961 | Bacteria | 1571 |
| 364 | Ga0207668_10212052 | 3300025972 | Bacteria | 1550 |
| 365 | Ga0207668_10923927 | 3300025972 | Bacteria | 777 |
| 366 | Ga0207640_10216743 | 3300025981 | Bacteria | 1462 |
| 367 | Ga0207658_10716328 | 3300025986 | Bacteria | 905 |
| 368 | Ga0207677_10022459 | 3300026023 | Bacteria | 3878 |
| 369 | Ga0207677_10074383 | 3300026023 | Bacteria | 2410 |
| 370 | Ga0207703_10099149 | 3300026035 | Bacteria | 2465 |
| 371 | Ga0207703_10384895 | 3300026035 | Bacteria | 1298 |
| 372 | Ga0207639_10019296 | 3300026041 | Bacteria | 4861 |
| 373 | Ga0207678_10000537 | 3300026067 | Bacteria | 34608 |
| 374 | Ga0207678_10042979 | 3300026067 | Bacteria | 3911 |
| 375 | Ga0207678_10263050 | 3300026067 | Bacteria | 1479 |
| 376 | Ga0207678_11473416 | 3300026067 | Bacteria | 601 |
| 377 | Ga0207708_10004306 | 3300026075 | Bacteria | 10479 |
| 378 | Ga0207708_10010011 | 3300026075 | Bacteria | 7041 |
| 379 | Ga0207708_10309410 | 3300026075 | Bacteria | 1287 |
| 380 | Ga0207702_10015790 | 3300026078 | Bacteria | 6253 |
| 381 | Ga0207702_10053400 | 3300026078 | Bacteria | 3421 |
| 382 | Ga0207641_10014896 | 3300026088 | Bacteria | 6375 |
| 383 | Ga0207641_10256958 | 3300026088 | Bacteria | 1634 |
| 384 | Ga0207648_10048745 | 3300026089 | Bacteria | 3708 |
| 385 | Ga0207648_11609874 | 3300026089 | Bacteria | 610 |
| 386 | Ga0207676_10001429 | 3300026095 | Bacteria | 17746 |
| 387 | Ga0207676_10136758 | 3300026095 | Bacteria | 2092 |
| 388 | Ga0207676_10292713 | 3300026095 | Bacteria | 1483 |
| 389 | Ga0207674_10104397 | 3300026116 | Bacteria | 2812 |
| 390 | Ga0207674_10138753 | 3300026116 | Bacteria | 2392 |
| 391 | Ga0207674_10203011 | 3300026116 | Bacteria | 1932 |
| 392 | Ga0207674_11175391 | 3300026116 | Bacteria | 737 |
| 393 | Ga0207675_100023096 | 3300026118 | Bacteria | 5784 |
| 394 | Ga0207675_100055589 | 3300026118 | Bacteria | 3693 |
| 395 | Ga0207675_102002950 | 3300026118 | Bacteria | 597 |
| 396 | Ga0207683_10005024 | 3300026121 | Bacteria | 11362 |
| 397 | Ga0207683_10189249 | 3300026121 | Bacteria | 1868 |
| 398 | Ga0207698_10016381 | 3300026142 | Bacteria | 4993 |
| 399 | Ga0207698_12187385 | 3300026142 | Bacteria | 566 |
| 400 | Ga0207428_10017467 | 3300027907 | Bacteria | 6156 |
| 401 | Ga0207428_10018395 | 3300027907 | Bacteria | 5970 |
| 402 | Ga0268266_10020837 | 3300028379 | Bacteria | 5591 |
| 403 | Ga0268265_10011922 | 3300028380 | Bacteria | 5881 |
| 404 | Ga0268264_10191897 | 3300028381 | Bacteria | 1863 |
| 405 | Ga0268264_10896059 | 3300028381 | Bacteria | 890 |
| 406 | Ga0307511_10029063 | 3300030521 | Bacteria | 5002 |
| 407 | Ga0316176_1169306 | 3300030732 | Bacteria | 792 |
| 408 | Ga0316183_1078238 | 3300030742 | Bacteria | 784 |
| 409 | Ga0316181_1215123 | 3300030744 | Bacteria | 2547 |
| 410 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 411 | Ga0307408_100015080 | 3300031548 | Bacteria | 5143 |
| 412 | Ga0307408_100236260 | 3300031548 | Bacteria | 1500 |
| 413 | Ga0307508_10019446 | 3300031616 | Bacteria | 6173 |
| 414 | Ga0307516_10231934 | 3300031730 | Bacteria | 1549 |
| 415 | Ga0307405_10006197 | 3300031731 | Bacteria | 5861 |
| 416 | Ga0307405_10489287 | 3300031731 | Bacteria | 984 |
| 417 | Ga0307413_10062430 | 3300031824 | Bacteria | 2305 |
| 418 | Ga0307413_10291321 | 3300031824 | Bacteria | 1233 |
| 419 | Ga0307410_10027735 | 3300031852 | Bacteria | 3582 |
| 420 | Ga0307410_10253570 | 3300031852 | Bacteria | 1369 |
| 421 | Ga0326468_10055121 | 3300031889 | Bacteria | 615 |
| 422 | Ga0307406_10001387 | 3300031901 | Bacteria | 13488 |
| 423 | Ga0307406_10132359 | 3300031901 | Bacteria | 1753 |
| 424 | Ga0307406_11403290 | 3300031901 | Bacteria | 612 |
| 425 | Ga0307406_11460256 | 3300031901 | Bacteria | 601 |
| 426 | Ga0307407_10094597 | 3300031903 | Bacteria | 1840 |
| 427 | Ga0307407_10142451 | 3300031903 | Bacteria | 1548 |
| 428 | Ga0307407_10488321 | 3300031903 | Bacteria | 901 |
| 429 | Ga0307409_100000427 | 3300031995 | Bacteria | 17841 |
| 430 | Ga0307409_100009939 | 3300031995 | Bacteria | 5877 |
| 431 | Ga0307409_100629303 | 3300031995 | Bacteria | 1064 |
| 432 | Ga0307416_100000122 | 3300032002 | Bacteria | 46669 |
| 433 | Ga0307416_100205811 | 3300032002 | Bacteria | 1872 |
| 434 | Ga0307416_100999681 | 3300032002 | Bacteria | 939 |
| 435 | Ga0307416_101956310 | 3300032002 | Bacteria | 689 |
| 436 | Ga0307416_103730249 | 3300032002 | Bacteria | 510 |
| 437 | Ga0307411_10315688 | 3300032005 | Bacteria | 1260 |
| 438 | Ga0307415_100000011 | 3300032126 | Bacteria | 84750 |
| 439 | Ga0307415_100008317 | 3300032126 | Bacteria | 5743 |
| 440 | Ga0307415_100033356 | 3300032126 | Bacteria | 3342 |
| 441 | Ga0307415_100214911 | 3300032126 | Bacteria | 1537 |
| 442 | Ga0307415_101294266 | 3300032126 | Bacteria | 690 |
| 443 | Ga0373940_0354719 | 3300035088 | Bacteria | 515 |
| 444 | Ga0373953_0038209 | 3300035117 | Bacteria | 1898 |
| 445 | Ga0373943_0359239 | 3300035170 | Bacteria | 836 |
| 446 | Ga0373961_0073859 | 3300035241 | Bacteria | 1060 |
| 447 | Ga0373931_0075985 | 3300035691 | Bacteria | 1844 |
| 448 | Ga0373937_0015793 | 3300036401 | Bacteria | 6691 |
| 449 | Ga0373925_0287612 | 3300037068 | Bacteria | 1325 |
| 450 | Ga0395898_0637116 | 3300037466 | Bacteria | 1008 |
| 451 | Ga0395905_0876356 | 3300037471 | Bacteria | 801 |
| 452 | Ga0436364_0014016 | 3300037853 | Bacteria | 3517 |
| 453 | Ga0436365_1200322 | 3300039437 | Bacteria | 577 |
| 454 | Ga0439436_0032479 | 3300041404 | Bacteria | 1513 |
| 455 | Ga0439438_141187 | 3300041405 | Bacteria | 576 |
| 456 | Ga0439439_0001943 | 3300041406 | Bacteria | 4279 |
| 457 | Ga0439466_0015325 | 3300041411 | Bacteria | 2785 |
| 458 | Ga0451793_1229364 | 3300041452 | Bacteria | 1101 |
| 459 | Ga0451800_0386293 | 3300041459 | Bacteria | 657 |
| 460 | Ga0451807_0348738 | 3300041486 | Bacteria | 580 |
| 461 | Ga0451807_1144640 | 3300041486 | Bacteria | 541 |
| 462 | Ga0451833_1410919 | 3300041491 | Bacteria | 672 |
| 463 | Ga0451839_0228385 | 3300041496 | Bacteria | 626 |
| 464 | Ga0451843_0706615 | 3300041509 | Bacteria | 791 |
| 465 | Ga0451853_0287085 | 3300041512 | Bacteria | 542 |
| 466 | Ga0451853_2966803 | 3300041512 | Bacteria | 537 |
| 467 | Ga0439433_0028060 | 3300041999 | Bacteria | 1279 |
| 468 | Ga0439442_044183 | 3300042002 | Bacteria | 939 |
| 469 | Ga0439449_0002649 | 3300042007 | Bacteria | 6969 |
| 470 | Ga0439449_0145072 | 3300042007 | Bacteria | 885 |
| 471 | Ga0439450_016675 | 3300042008 | Bacteria | 1522 |
| 472 | Ga0439455_0009452 | 3300042012 | Bacteria | 2117 |
| 473 | Ga0439457_003005 | 3300042014 | Bacteria | 4686 |
| 474 | Ga0439462_0235512 | 3300042015 | Bacteria | 525 |
| 475 | Ga0439463_005904 | 3300042016 | Bacteria | 3040 |
| 476 | Ga0450902_012516 | 3300042137 | Bacteria | 1358 |
| 477 | Ga0450906_045237 | 3300042145 | Bacteria | 777 |
| 478 | Ga0439459_0008932 | 3300042438 | Bacteria | 1724 |
| 479 | Ga0439460_0256764 | 3300042461 | Bacteria | 605 |
| 480 | Ga0439440_0119617 | 3300042993 | Bacteria | 732 |
| 481 | Ga0495641_0476020 | 3300046461 | Bacteria | 569 |
| 482 | Ga0495663_0124559 | 3300046525 | Bacteria | 865 |
| 483 | Ga0495586_0600117 | 3300046535 | Bacteria | 636 |
| 484 | Ga0495635_0136886 | 3300046663 | Bacteria | 1669 |
| 485 | Ga0495635_0380402 | 3300046663 | Bacteria | 939 |
| 486 | Ga0495647_0186851 | 3300046681 | Bacteria | 904 |
| 487 | Ga0495674_0587904 | 3300047319 | Bacteria | 883 |
| 488 | Ga0495676_0810459 | 3300047321 | Bacteria | 602 |
| 489 | Ga0495680_0763649 | 3300047322 | Bacteria | 634 |
| 490 | Ga0495685_139930 | 3300047447 | Bacteria | 789 |
| 491 | Ga0496100_0090837 | 3300048903 | Bacteria | 2083 |
| 492 | Ga0496101_0038633 | 3300048904 | Bacteria | 3391 |
| 493 | Ga0496102_0159357 | 3300048905 | Bacteria | 2122 |
| 494 | Ga0496103_0174375 | 3300048906 | Bacteria | 1381 |
| 495 | Ga0496104_0004988 | 3300048907 | Bacteria | 11586 |
| 496 | Ga0496105_0003583 | 3300048908 | Bacteria | 11527 |
| 497 | Ga0496106_0039841 | 3300048909 | Bacteria | 3518 |
| 498 | Ga0496107_0127614 | 3300048910 | Bacteria | 1876 |
| 499 | Ga0496108_0013727 | 3300048911 | Bacteria | 6609 |
| 500 | Ga0496109_0044670 | 3300048912 | Bacteria | 4019 |
| 501 | Ga0496109_1402696 | 3300048912 | Bacteria | 634 |
| 502 | Ga0496110_0011897 | 3300048913 | Bacteria | 7147 |
| 503 | Ga0496111_0016588 | 3300048914 | Bacteria | 5078 |
| 504 | Ga0496112_0060270 | 3300048915 | Bacteria | 3739 |
| 505 | Ga0496112_1280497 | 3300048915 | Bacteria | 649 |
| 506 | Ga0496113_0004453 | 3300048916 | Bacteria | 8618 |
| 507 | Ga0496114_0437981 | 3300048917 | Bacteria | 1158 |
| 508 | Ga0501040_0898483 | 3300049576 | Bacteria | 642 |
| 509 | Ga0501048_0388604 | 3300049582 | Bacteria | 997 |
| 510 | Ga0501069_0676059 | 3300049585 | Bacteria | 622 |
| 511 | Ga0501072_0716293 | 3300049588 | Bacteria | 786 |
| 512 | nmdc:mga0yw44_439676_c1 | 3300050492 | Bacteria | 884 |
| 513 | nmdc:mga06z11_124724_c1 | 3300050494 | Bacteria | 1440 |
| 514 | nmdc:mga06z11_922275_c1 | 3300050494 | Bacteria | 532 |
| 515 | nmdc:mga04h51_212679_c1 | 3300050495 | Bacteria | 763 |
| 516 | nmdc:mga05p37_1185110_c1 | 3300050507 | Bacteria | 791 |
| 517 | nmdc:mga05p37_1332361_c1 | 3300050507 | Bacteria | 729 |
| 518 | nmdc:mga05p37_1347784_c1 | 3300050507 | Bacteria | 723 |
| 519 | nmdc:mga05p37_177905_c1 | 3300050507 | Bacteria | 2591 |
| 520 | nmdc:mga05p37_335288_c1 | 3300050507 | Bacteria | 1785 |
| 521 | nmdc:mga09592_119342_c1 | 3300050508 | Bacteria | 2264 |
| 522 | nmdc:mga09592_196479_c1 | 3300050508 | Bacteria | 1746 |
| 523 | nmdc:mga09592_30910_c1 | 3300050508 | Bacteria | 4459 |
| 524 | nmdc:mga09592_321515_c1 | 3300050508 | Bacteria | 1340 |
| 525 | nmdc:mga09592_354690_c1 | 3300050508 | Bacteria | 1269 |
| 526 | nmdc:mga0qj67_135961_c1 | 3300050509 | Bacteria | 1992 |
| 527 | nmdc:mga0qj67_639664_c1 | 3300050509 | Bacteria | 849 |
| 528 | nmdc:mga06r32_102611_c1 | 3300050510 | Bacteria | 2808 |
| 529 | nmdc:mga06r32_1374992_c1 | 3300050510 | Bacteria | 648 |
| 530 | nmdc:mga06r32_1904491_c1 | 3300050510 | Bacteria | 529 |
| 531 | nmdc:mga06r32_47282_c1 | 3300050510 | Bacteria | 4109 |
| 532 | nmdc:mga06r32_953819_c1 | 3300050510 | Bacteria | 812 |
| 533 | nmdc:mga08y16_24750_c1 | 3300050511 | Bacteria | 6335 |
| 534 | nmdc:mga08y16_262814_c1 | 3300050511 | Bacteria | 1782 |
| 535 | nmdc:mga08y16_4311_c1 | 3300050511 | Bacteria | 14857 |
| 536 | nmdc:mga0n895_28274_c1 | 3300050512 | Bacteria | 5334 |
| 537 | nmdc:mga0rr50_14643_c1 | 3300050513 | Bacteria | 5151 |
| 538 | nmdc:mga08x19_69079_c1 | 3300050514 | Bacteria | 2301 |
| 539 | nmdc:mga0a205_59073_c1 | 3300050515 | Bacteria | 3705 |
| 540 | Ga0495601_0227693 | 3300053077 | Bacteria | 1218 |
| 541 | Ga0495595_0233331 | 3300053084 | Bacteria | 920 |
| 542 | Ga0495619_0065824 | 3300053085 | Bacteria | 2418 |
| 543 | Ga0495619_0549099 | 3300053085 | Bacteria | 793 |
| 544 | Ga0500644_0331766 | 3300053088 | Bacteria | 655 |
| 545 | Ga0500646_0296000 | 3300053090 | Bacteria | 579 |
| 546 | Ga0500583_0053284 | 3300053092 | Bacteria | 1885 |
| 547 | Ga0500641_0019150 | 3300053096 | Bacteria | 2585 |
| 548 | Ga0500594_0306509 | 3300053118 | Bacteria | 532 |
| 549 | Ga0500588_0001778 | 3300053146 | Bacteria | 4195 |
| 550 | Ga0500633_0033521 | 3300053160 | Bacteria | 1676 |
| 551 | Ga0501084_1427531 | 3300054114 | Bacteria | 580 |
| 552 | Ga0587084_062644 | 3300059477 | Bacteria | 685 |
| 553 | Ga0587093_030920 | 3300059478 | Bacteria | 770 |
| 554 | Ga0587066_056272 | 3300059490 | Bacteria | 790 |
| 555 | Ga0587070_022496 | 3300059491 | Bacteria | 1074 |
| 556 | Ga0587077_047432 | 3300059493 | Bacteria | 886 |
| 557 | Ga0587080_036047 | 3300059503 | Bacteria | 883 |
| 558 | Ga0587082_033175 | 3300059504 | Bacteria | 911 |
| 559 | Ga0587083_0087287 | 3300059505 | Bacteria | 754 |
| 560 | Ga0587083_0110316 | 3300059505 | Bacteria | 698 |
| 561 | Ga0587085_032436 | 3300059506 | Bacteria | 867 |
| 562 | Ga0587086_023465 | 3300059507 | Bacteria | 860 |
| 563 | Ga0587088_020662 | 3300059508 | Bacteria | 1094 |
| 564 | Ga0587091_068752 | 3300059511 | Bacteria | 770 |
| 565 | Ga0587091_075996 | 3300059511 | Bacteria | 744 |
| 566 | Ga0587092_029478 | 3300059512 | Bacteria | 899 |
| 567 | Ga0587092_106995 | 3300059512 | Bacteria | 583 |
| 568 | Ga0587094_022270 | 3300059513 | Bacteria | 929 |
| 569 | Ga0587095_022033 | 3300059514 | Bacteria | 618 |
| 570 | Ga0587106_041245 | 3300059605 | Bacteria | 784 |
| 571 | Ga0587125_041881 | 3300059607 | Bacteria | 621 |
| 572 | Ga0587129_019024 | 3300059608 | Bacteria | 597 |
| 573 | Ga0587099_026618 | 3300059622 | Bacteria | 683 |
| 574 | Ga0587101_150085 | 3300059623 | Bacteria | 504 |
| 575 | Ga0587109_064437 | 3300059624 | Bacteria | 779 |
| 576 | Ga0587113_029707 | 3300059625 | Bacteria | 615 |
| 577 | Ga0587115_027984 | 3300059626 | Bacteria | 823 |
| 578 | Ga0587122_013518 | 3300059628 | Bacteria | 812 |
| 579 | Ga0587127_005001 | 3300059629 | Bacteria | 899 |
| 580 | Ga0587128_062444 | 3300059630 | Bacteria | 707 |
| 581 | Ga0587062_079760 | 3300059639 | Bacteria | 606 |
| 582 | Ga0587067_045105 | 3300059640 | Bacteria | 871 |
| 583 | Ga0587067_191296 | 3300059640 | Bacteria | 539 |
| 584 | Ga0587068_048223 | 3300059641 | Bacteria | 790 |
| 585 | Ga0587069_068879 | 3300059642 | Bacteria | 668 |
| 586 | Ga0587075_027885 | 3300059644 | Bacteria | 882 |
| 587 | Ga0587075_140480 | 3300059644 | Bacteria | 515 |
| 588 | Ga0587076_041161 | 3300059645 | Bacteria | 864 |
| 589 | Ga0587078_016868 | 3300059646 | Bacteria | 893 |
| 590 | Ga0587078_028657 | 3300059646 | Bacteria | 741 |
| 591 | Ga0587079_059945 | 3300059647 | Bacteria | 822 |
| 592 | Ga0587100_009137 | 3300059648 | Bacteria | 814 |
| 593 | Ga0587102_016841 | 3300059649 | Bacteria | 790 |
| 594 | Ga0587105_011794 | 3300059651 | Bacteria | 679 |
| 595 | Ga0587107_028288 | 3300059652 | Bacteria | 836 |
| 596 | Ga0587114_027619 | 3300059655 | Bacteria | 847 |
| 597 | Ga0587116_11448 | 3300059656 | Bacteria | 605 |
| 598 | Ga0587119_019641 | 3300059658 | Bacteria | 853 |
| 599 | Ga0587071_044510 | 3300060344 | Bacteria | 900 |
| 600 | Ga0587111_0049893 | 3300060346 | Bacteria | 920 |
| 601 | Ga0501082_0811847 | 3300060353 | Bacteria | 818 |
| 602 | Ga0501082_1178175 | 3300060353 | Bacteria | 670 |
| 603 | Ga0530510_0116045 | 3300061734 | Bacteria | 1963 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100279202 | Ga0070674_1002792022 | 78 |
| 2 | 3300009148 | Ga0105243_11119963 | Ga0105243_111199632 | 78 |
| 3 | 3300026089 | Ga0207648_11609874 | Ga0207648_116098742 | 78 |
| 4 | 3300031852 | Ga0307410_10253570 | Ga0307410_102535702 | 78 |
| 5 | 3300031901 | Ga0307406_11403290 | Ga0307406_114032901 | 78 |
| 6 | 3300032002 | Ga0307416_101956310 | Ga0307416_1019563102 | 78 |
| 7 | 3300032126 | Ga0307415_101294266 | Ga0307415_1012942662 | 78 |
| 8 | 3300041459 | Ga0451800_0386293 | Ga0451800_0386293_11_295 | 78 |
| 9 | 3300041496 | Ga0451839_0228385 | Ga0451839_0228385_160_444 | 78 |
| 10 | 3300031731 | Ga0307405_10489287 | Ga0307405_104892871 | 79 |
| 11 | 3300041512 | Ga0451853_0287085 | Ga0451853_0287085_107_391 | 79 |
| 12 | 3300041452 | Ga0451793_1229364 | Ga0451793_1229364_556_840 | 81 |
| 13 | 3300041486 | Ga0451807_1144640 | Ga0451807_1144640_26_310 | 81 |
| 14 | 3300041491 | Ga0451833_1410919 | Ga0451833_1410919_225_509 | 81 |
| 15 | 3300041509 | Ga0451843_0706615 | Ga0451843_0706615_333_617 | 81 |
| 16 | 3300004801 | Ga0058860_10026024 | Ga0058860_100260241 | 82 |
| 17 | 3300006844 | Ga0075428_102202173 | Ga0075428_1022021732 | 82 |
| 18 | 3300046525 | Ga0495663_0124559 | Ga0495663_0124559_273_551 | 83 |
| 19 | 3300047447 | Ga0495685_139930 | Ga0495685_139930_453_731 | 83 |
| 20 | 3300050495 | nmdc:mga04h51_212679_c1 | nmdc:mga04h51_212679_c1_31_336 | 83 |
| 21 | 3300050507 | nmdc:mga05p37_1332361_c1 | nmdc:mga05p37_1332361_c1_94_402 | 83 |
| 22 | 3300059512 | Ga0587092_106995 | Ga0587092_106995_170_487 | 83 |
| 23 | 3300059646 | Ga0587078_028657 | Ga0587078_028657_182_490 | 83 |
| 24 | 3300003575 | Ga0007409J51694_1045481 | Ga0007409J51694_10454811 | 84 |
| 25 | 3300003693 | Ga0032354_1110810 | Ga0032354_11108101 | 84 |
| 26 | 3300005334 | Ga0068869_101454434 | Ga0068869_1014544341 | 84 |
| 27 | 3300061734 | Ga0530510_0116045 | Ga0530510_0116045_1438_1743 | 85 |
| 28 | 3300014325 | Ga0163163_12192914 | Ga0163163_121929141 | 86 |
| 29 | 3300005441 | Ga0070700_100656531 | Ga0070700_1006565311 | 87 |
| 30 | 3300026075 | Ga0207708_10309410 | Ga0207708_103094102 | 87 |
| 31 | 3300031903 | Ga0307407_10488321 | Ga0307407_104883212 | 87 |
| 32 | 3300032126 | Ga0307415_100214911 | Ga0307415_1002149112 | 87 |
| 33 | 3300006846 | Ga0075430_100317226 | Ga0075430_1003172262 | 88 |
| 34 | 3300006880 | Ga0075429_100241139 | Ga0075429_1002411392 | 88 |
| 35 | 3300009094 | Ga0111539_10807059 | Ga0111539_108070592 | 88 |
| 36 | 3300009147 | Ga0114129_10403857 | Ga0114129_104038572 | 88 |
| 37 | 3300050507 | nmdc:mga05p37_1185110_c1 | nmdc:mga05p37_1185110_c1_84_392 | 88 |
| 38 | 3300050508 | nmdc:mga09592_196479_c1 | nmdc:mga09592_196479_c1_1107_1415 | 88 |
| 39 | 3300050511 | nmdc:mga08y16_262814_c1 | nmdc:mga08y16_262814_c1_322_630 | 88 |
| 40 | 3300025899 | Ga0207642_11109052 | Ga0207642_111090522 | 89 |
| 41 | 3300009036 | Ga0105244_10137102 | Ga0105244_101371022 | 90 |
| 42 | 3300009093 | Ga0105240_10210368 | Ga0105240_102103683 | 90 |
| 43 | 3300009094 | Ga0111539_10057516 | Ga0111539_100575164 | 90 |
| 44 | 3300009147 | Ga0114129_11283213 | Ga0114129_112832131 | 90 |
| 45 | 3300009148 | Ga0105243_10047873 | Ga0105243_100478735 | 90 |
| 46 | 3300009174 | Ga0105241_10038274 | Ga0105241_100382743 | 90 |
| 47 | 3300009176 | Ga0105242_10523922 | Ga0105242_105239222 | 90 |
| 48 | 3300009177 | Ga0105248_10173700 | Ga0105248_101737003 | 90 |
| 49 | 3300009551 | Ga0105238_10053895 | Ga0105238_100538953 | 90 |
| 50 | 3300009553 | Ga0105249_10164646 | Ga0105249_101646462 | 90 |
| 51 | 3300011119 | Ga0105246_10001558 | Ga0105246_100015584 | 90 |
| 52 | 3300013062 | Ga0154010_153672 | Ga0154010_1536722 | 90 |
| 53 | 3300013102 | Ga0157371_10010033 | Ga0157371_100100332 | 90 |
| 54 | 3300013105 | Ga0157369_10490442 | Ga0157369_104904422 | 90 |
| 55 | 3300013296 | Ga0157374_10026833 | Ga0157374_100268333 | 90 |
| 56 | 3300013297 | Ga0157378_11300763 | Ga0157378_113007632 | 90 |
| 57 | 3300013306 | Ga0163162_11960990 | Ga0163162_119609902 | 90 |
| 58 | 3300013307 | Ga0157372_10392986 | Ga0157372_103929862 | 90 |
| 59 | 3300014325 | Ga0163163_10419522 | Ga0163163_104195223 | 90 |
| 60 | 3300014326 | Ga0157380_10707333 | Ga0157380_107073332 | 90 |
| 61 | 3300014497 | Ga0182008_10055864 | Ga0182008_100558642 | 90 |
| 62 | 3300014745 | Ga0157377_10019775 | Ga0157377_100197753 | 90 |
| 63 | 3300035241 | Ga0373961_0073859 | Ga0373961_0073859_373_645 | 90 |
| 64 | 3300035691 | Ga0373931_0075985 | Ga0373931_0075985_1088_1360 | 90 |
| 65 | 3300037068 | Ga0373925_0287612 | Ga0373925_0287612_1020_1292 | 90 |
| 66 | 3300037466 | Ga0395898_0637116 | Ga0395898_0637116_289_561 | 90 |
| 67 | 3300041512 | Ga0451853_2966803 | Ga0451853_2966803_176_448 | 90 |
| 68 | 3300042008 | Ga0439450_016675 | Ga0439450_016675_242_514 | 90 |
| 69 | 3300042137 | Ga0450902_012516 | Ga0450902_012516_1000_1272 | 90 |
| 70 | 3300042438 | Ga0439459_0008932 | Ga0439459_0008932_1385_1657 | 90 |
| 71 | 3300046681 | Ga0495647_0186851 | Ga0495647_0186851_130_402 | 90 |
| 72 | 3300047321 | Ga0495676_0810459 | Ga0495676_0810459_207_479 | 90 |
| 73 | 3300048903 | Ga0496100_0090837 | Ga0496100_0090837_596_868 | 90 |
| 74 | 3300048904 | Ga0496101_0038633 | Ga0496101_0038633_1776_2048 | 90 |
| 75 | 3300048905 | Ga0496102_0159357 | Ga0496102_0159357_431_703 | 90 |
| 76 | 3300048906 | Ga0496103_0174375 | Ga0496103_0174375_914_1186 | 90 |
| 77 | 3300048907 | Ga0496104_0004988 | Ga0496104_0004988_1546_1818 | 90 |
| 78 | 3300048908 | Ga0496105_0003583 | Ga0496105_0003583_2667_2939 | 90 |
| 79 | 3300048909 | Ga0496106_0039841 | Ga0496106_0039841_1459_1731 | 90 |
| 80 | 3300048910 | Ga0496107_0127614 | Ga0496107_0127614_61_333 | 90 |
| 81 | 3300048911 | Ga0496108_0013727 | Ga0496108_0013727_4961_5233 | 90 |
| 82 | 3300048912 | Ga0496109_0044670 | Ga0496109_0044670_1010_1282 | 90 |
| 83 | 3300048913 | Ga0496110_0011897 | Ga0496110_0011897_2528_2800 | 90 |
| 84 | 3300048914 | Ga0496111_0016588 | Ga0496111_0016588_1461_1733 | 90 |
| 85 | 3300048915 | Ga0496112_0060270 | Ga0496112_0060270_122_394 | 90 |
| 86 | 3300048916 | Ga0496113_0004453 | Ga0496113_0004453_2738_3010 | 90 |
| 87 | 3300048917 | Ga0496114_0437981 | Ga0496114_0437981_754_1026 | 90 |
| 88 | 3300049585 | Ga0501069_0676059 | Ga0501069_0676059_117_389 | 90 |
| 89 | 3300050507 | nmdc:mga05p37_335288_c1 | nmdc:mga05p37_335288_c1_699_971 | 90 |
| 90 | 3300050508 | nmdc:mga09592_119342_c1 | nmdc:mga09592_119342_c1_1863_2135 | 90 |
| 91 | 3300050509 | nmdc:mga0qj67_639664_c1 | nmdc:mga0qj67_639664_c1_242_514 | 90 |
| 92 | 3300050510 | nmdc:mga06r32_102611_c1 | nmdc:mga06r32_102611_c1_780_1052 | 90 |
| 93 | 3300050510 | nmdc:mga06r32_1904491_c1 | nmdc:mga06r32_1904491_c1_143_445 | 90 |
| 94 | 3300050511 | nmdc:mga08y16_24750_c1 | nmdc:mga08y16_24750_c1_2705_2977 | 90 |
| 95 | 3300050512 | nmdc:mga0n895_28274_c1 | nmdc:mga0n895_28274_c1_1377_1649 | 90 |
| 96 | 3300050513 | nmdc:mga0rr50_14643_c1 | nmdc:mga0rr50_14643_c1_882_1154 | 90 |
| 97 | 3300050514 | nmdc:mga08x19_69079_c1 | nmdc:mga08x19_69079_c1_1166_1438 | 90 |
| 98 | 3300050515 | nmdc:mga0a205_59073_c1 | nmdc:mga0a205_59073_c1_1727_1999 | 90 |
| 99 | iso_pu_bacteria | 2643221694 | 2644526606 | 90 |
| 100 | iso_pu_bacteria | 2643221722 | 2644671272 | 90 |
| 101 | 3300025941 | Ga0207711_12102920 | Ga0207711_121029202 | 91 |
| 102 | 3300032002 | Ga0307416_100999681 | Ga0307416_1009996812 | 91 |
| 103 | 3300013105 | Ga0157369_10769761 | Ga0157369_107697612 | 92 |
| 104 | 3300020081 | Ga0206354_10790405 | Ga0206354_107904051 | 92 |
| 105 | 3300013296 | Ga0157374_11800245 | Ga0157374_118002452 | 93 |
| 106 | 3300042016 | Ga0439463_005904 | Ga0439463_005904_1239_1520 | 93 |
| 107 | 3300053088 | Ga0500644_0331766 | Ga0500644_0331766_96_380 | 93 |
| 108 | iso_pu_bacteria | 2515154155 | 2515850834 | 93 |
| 109 | iso_pu_bacteria | 2675903058 | 2676476809 | 93 |
| 110 | iso_pu_bacteria | 2827628540 | 2827630101 | 93 |
| 111 | 3300009147 | Ga0114129_10172664 | Ga0114129_101726644 | 94 |
| 112 | 3300005577 | Ga0068857_101259728 | Ga0068857_1012597282 | 95 |
| 113 | 3300005617 | Ga0068859_100333109 | Ga0068859_1003331092 | 95 |
| 114 | 3300006847 | Ga0075431_101717039 | Ga0075431_1017170391 | 95 |
| 115 | 3300006852 | Ga0075433_10801766 | Ga0075433_108017662 | 95 |
| 116 | 3300006871 | Ga0075434_102570325 | Ga0075434_1025703251 | 95 |
| 117 | 3300006931 | Ga0097620_100333145 | Ga0097620_1003331452 | 95 |
| 118 | 3300009094 | Ga0111539_10794641 | Ga0111539_107946411 | 95 |
| 119 | 3300009553 | Ga0105249_10224343 | Ga0105249_102243433 | 95 |
| 120 | 3300050509 | nmdc:mga0qj67_135961_c1 | nmdc:mga0qj67_135961_c1_671_964 | 95 |
| 121 | 3300050510 | nmdc:mga06r32_47282_c1 | nmdc:mga06r32_47282_c1_2658_2948 | 95 |
| 122 | 3300001991 | JGI24743J22301_10025346 | JGI24743J22301_100253462 | 96 |
| 123 | 3300002073 | JGI24745J21846_1015638 | JGI24745J21846_10156382 | 96 |
| 124 | 3300002155 | JGI24033J26618_1012900 | JGI24033J26618_10129002 | 96 |
| 125 | 3300002459 | JGI24751J29686_10007576 | JGI24751J29686_100075763 | 96 |
| 126 | 3300003693 | Ga0032354_1074863 | Ga0032354_10748631 | 96 |
| 127 | 3300004798 | Ga0058859_11373918 | Ga0058859_113739182 | 96 |
| 128 | 3300004799 | Ga0058863_11972618 | Ga0058863_119726182 | 96 |
| 129 | 3300004800 | Ga0058861_12063929 | Ga0058861_120639292 | 96 |
| 130 | 3300004800 | Ga0058861_12067567 | Ga0058861_120675672 | 96 |
| 131 | 3300004801 | Ga0058860_11635538 | Ga0058860_116355382 | 96 |
| 132 | 3300004803 | Ga0058862_12888595 | Ga0058862_128885952 | 96 |
| 133 | 3300005327 | Ga0070658_10131350 | Ga0070658_101313504 | 96 |
| 134 | 3300005328 | Ga0070676_10378285 | Ga0070676_103782851 | 96 |
| 135 | 3300005329 | Ga0070683_100066754 | Ga0070683_1000667544 | 96 |
| 136 | 3300005329 | Ga0070683_100322614 | Ga0070683_1003226142 | 96 |
| 137 | 3300005330 | Ga0070690_100047860 | Ga0070690_1000478603 | 96 |
| 138 | 3300005331 | Ga0070670_100055930 | Ga0070670_1000559302 | 96 |
| 139 | 3300005334 | Ga0068869_100005028 | Ga0068869_1000050282 | 96 |
| 140 | 3300005335 | Ga0070666_10073850 | Ga0070666_100738503 | 96 |
| 141 | 3300005336 | Ga0070680_100007324 | Ga0070680_1000073245 | 96 |
| 142 | 3300005337 | Ga0070682_100006130 | Ga0070682_1000061306 | 96 |
| 143 | 3300005337 | Ga0070682_101344187 | Ga0070682_1013441872 | 96 |
| 144 | 3300005338 | Ga0068868_100034447 | Ga0068868_1000344475 | 96 |
| 145 | 3300005339 | Ga0070660_100069503 | Ga0070660_1000695034 | 96 |
| 146 | 3300005340 | Ga0070689_100027775 | Ga0070689_1000277753 | 96 |
| 147 | 3300005341 | Ga0070691_10001280 | Ga0070691_100012804 | 96 |
| 148 | 3300005343 | Ga0070687_100055004 | Ga0070687_1000550043 | 96 |
| 149 | 3300005344 | Ga0070661_100129772 | Ga0070661_1001297722 | 96 |
| 150 | 3300005345 | Ga0070692_10042533 | Ga0070692_100425334 | 96 |
| 151 | 3300005347 | Ga0070668_100251629 | Ga0070668_1002516292 | 96 |
| 152 | 3300005353 | Ga0070669_100369001 | Ga0070669_1003690012 | 96 |
| 153 | 3300005354 | Ga0070675_100084219 | Ga0070675_1000842193 | 96 |
| 154 | 3300005355 | Ga0070671_100034998 | Ga0070671_1000349984 | 96 |
| 155 | 3300005364 | Ga0070673_100102151 | Ga0070673_1001021513 | 96 |
| 156 | 3300005365 | Ga0070688_100127502 | Ga0070688_1001275022 | 96 |
| 157 | 3300005366 | Ga0070659_100032754 | Ga0070659_1000327544 | 96 |
| 158 | 3300005366 | Ga0070659_101269643 | Ga0070659_1012696431 | 96 |
| 159 | 3300005367 | Ga0070667_100209129 | Ga0070667_1002091292 | 96 |
| 160 | 3300005406 | Ga0070703_10469316 | Ga0070703_104693162 | 96 |
| 161 | 3300005434 | Ga0070709_10012683 | Ga0070709_100126834 | 96 |
| 162 | 3300005435 | Ga0070714_100021156 | Ga0070714_1000211563 | 96 |
| 163 | 3300005436 | Ga0070713_100020612 | Ga0070713_1000206125 | 96 |
| 164 | 3300005437 | Ga0070710_10064268 | Ga0070710_100642682 | 96 |
| 165 | 3300005439 | Ga0070711_100045757 | Ga0070711_1000457575 | 96 |
| 166 | 3300005441 | Ga0070700_100016103 | Ga0070700_1000161032 | 96 |
| 167 | 3300005444 | Ga0070694_100541311 | Ga0070694_1005413112 | 96 |
| 168 | 3300005455 | Ga0070663_100009250 | Ga0070663_1000092504 | 96 |
| 169 | 3300005455 | Ga0070663_101355465 | Ga0070663_1013554651 | 96 |
| 170 | 3300005456 | Ga0070678_100015294 | Ga0070678_1000152945 | 96 |
| 171 | 3300005457 | Ga0070662_100059912 | Ga0070662_1000599122 | 96 |
| 172 | 3300005458 | Ga0070681_10029986 | Ga0070681_100299866 | 96 |
| 173 | 3300005459 | Ga0068867_100099277 | Ga0068867_1000992773 | 96 |
| 174 | 3300005466 | Ga0070685_10054517 | Ga0070685_100545174 | 96 |
| 175 | 3300005530 | Ga0070679_100026996 | Ga0070679_1000269964 | 96 |
| 176 | 3300005535 | Ga0070684_101412545 | Ga0070684_1014125451 | 96 |
| 177 | 3300005535 | Ga0070684_101812912 | Ga0070684_1018129121 | 96 |
| 178 | 3300005539 | Ga0068853_100020817 | Ga0068853_1000208173 | 96 |
| 179 | 3300005543 | Ga0070672_100074450 | Ga0070672_1000744502 | 96 |
| 180 | 3300005544 | Ga0070686_100143278 | Ga0070686_1001432782 | 96 |
| 181 | 3300005545 | Ga0070695_100048619 | Ga0070695_1000486194 | 96 |
| 182 | 3300005547 | Ga0070693_100008461 | Ga0070693_1000084613 | 96 |
| 183 | 3300005548 | Ga0070665_100050708 | Ga0070665_1000507084 | 96 |
| 184 | 3300005563 | Ga0068855_100414840 | Ga0068855_1004148402 | 96 |
| 185 | 3300005564 | Ga0070664_100086877 | Ga0070664_1000868773 | 96 |
| 186 | 3300005577 | Ga0068857_100533179 | Ga0068857_1005331792 | 96 |
| 187 | 3300005577 | Ga0068857_102256387 | Ga0068857_1022563872 | 96 |
| 188 | 3300005578 | Ga0068854_100519361 | Ga0068854_1005193612 | 96 |
| 189 | 3300005614 | Ga0068856_100002544 | Ga0068856_1000025444 | 96 |
| 190 | 3300005614 | Ga0068856_100136829 | Ga0068856_1001368292 | 96 |
| 191 | 3300005615 | Ga0070702_100001607 | Ga0070702_1000016078 | 96 |
| 192 | 3300005616 | Ga0068852_100024929 | Ga0068852_1000249295 | 96 |
| 193 | 3300005617 | Ga0068859_100385679 | Ga0068859_1003856792 | 96 |
| 194 | 3300005618 | Ga0068864_100014265 | Ga0068864_1000142653 | 96 |
| 195 | 3300005618 | Ga0068864_101588084 | Ga0068864_1015880842 | 96 |
| 196 | 3300005718 | Ga0068866_11308658 | Ga0068866_113086582 | 96 |
| 197 | 3300005719 | Ga0068861_100046078 | Ga0068861_1000460784 | 96 |
| 198 | 3300005840 | Ga0068870_10000398 | Ga0068870_1000039810 | 96 |
| 199 | 3300005841 | Ga0068863_100004122 | Ga0068863_1000041223 | 96 |
| 200 | 3300005842 | Ga0068858_100011915 | Ga0068858_1000119155 | 96 |
| 201 | 3300005843 | Ga0068860_100089056 | Ga0068860_1000890563 | 96 |
| 202 | 3300005844 | Ga0068862_100718950 | Ga0068862_1007189502 | 96 |
| 203 | 3300005937 | Ga0081455_10185127 | Ga0081455_101851273 | 96 |
| 204 | 3300005983 | Ga0081540_1033333 | Ga0081540_10333333 | 96 |
| 205 | 3300006038 | Ga0075365_10150638 | Ga0075365_101506382 | 96 |
| 206 | 3300006058 | Ga0075432_10018558 | Ga0075432_100185583 | 96 |
| 207 | 3300006173 | Ga0070716_100272535 | Ga0070716_1002725352 | 96 |
| 208 | 3300006175 | Ga0070712_100099572 | Ga0070712_1000995722 | 96 |
| 209 | 3300006178 | Ga0075367_11037579 | Ga0075367_110375792 | 96 |
| 210 | 3300006237 | Ga0097621_100020834 | Ga0097621_1000208344 | 96 |
| 211 | 3300006358 | Ga0068871_100057136 | Ga0068871_1000571364 | 96 |
| 212 | 3300006844 | Ga0075428_100000182 | Ga0075428_1000001822 | 96 |
| 213 | 3300006844 | Ga0075428_100048038 | Ga0075428_1000480382 | 96 |
| 214 | 3300006847 | Ga0075431_100083893 | Ga0075431_1000838933 | 96 |
| 215 | 3300006852 | Ga0075433_10001267 | Ga0075433_100012677 | 96 |
| 216 | 3300006871 | Ga0075434_100027893 | Ga0075434_1000278936 | 96 |
| 217 | 3300006880 | Ga0075429_100519882 | Ga0075429_1005198822 | 96 |
| 218 | 3300006881 | Ga0068865_100220713 | Ga0068865_1002207133 | 96 |
| 219 | 3300006914 | Ga0075436_100031906 | Ga0075436_1000319064 | 96 |
| 220 | 3300006931 | Ga0097620_100385658 | Ga0097620_1003856582 | 96 |
| 221 | 3300007076 | Ga0075435_100149566 | Ga0075435_1001495663 | 96 |
| 222 | 3300009011 | Ga0105251_10009517 | Ga0105251_100095176 | 96 |
| 223 | 3300009098 | Ga0105245_10049551 | Ga0105245_100495513 | 96 |
| 224 | 3300009098 | Ga0105245_12566034 | Ga0105245_125660341 | 96 |
| 225 | 3300009101 | Ga0105247_10056427 | Ga0105247_100564273 | 96 |
| 226 | 3300009148 | Ga0105243_12158859 | Ga0105243_121588591 | 96 |
| 227 | 3300009174 | Ga0105241_10255123 | Ga0105241_102551233 | 96 |
| 228 | 3300009176 | Ga0105242_11351181 | Ga0105242_113511811 | 96 |
| 229 | 3300009545 | Ga0105237_10170077 | Ga0105237_101700773 | 96 |
| 230 | 3300009545 | Ga0105237_10535854 | Ga0105237_105358542 | 96 |
| 231 | 3300009551 | Ga0105238_10813264 | Ga0105238_108132642 | 96 |
| 232 | 3300009551 | Ga0105238_11134663 | Ga0105238_111346632 | 96 |
| 233 | 3300009551 | Ga0105238_11935938 | Ga0105238_119359382 | 96 |
| 234 | 3300010375 | Ga0105239_10042350 | Ga0105239_100423507 | 96 |
| 235 | 3300010375 | Ga0105239_10047187 | Ga0105239_100471874 | 96 |
| 236 | 3300013044 | Ga0154019_129167 | Ga0154019_1291672 | 96 |
| 237 | 3300013100 | Ga0157373_10059871 | Ga0157373_100598713 | 96 |
| 238 | 3300013104 | Ga0157370_10290396 | Ga0157370_102903962 | 96 |
| 239 | 3300013308 | Ga0157375_10182075 | Ga0157375_101820754 | 96 |
| 240 | 3300014968 | Ga0157379_10033665 | Ga0157379_100336653 | 96 |
| 241 | 3300014968 | Ga0157379_10554677 | Ga0157379_105546772 | 96 |
| 242 | 3300014969 | Ga0157376_10040153 | Ga0157376_100401533 | 96 |
| 243 | 3300017792 | Ga0163161_10634386 | Ga0163161_106343862 | 96 |
| 244 | 3300020069 | Ga0197907_10890035 | Ga0197907_108900352 | 96 |
| 245 | 3300020069 | Ga0197907_11016600 | Ga0197907_110166002 | 96 |
| 246 | 3300020070 | Ga0206356_10889166 | Ga0206356_108891662 | 96 |
| 247 | 3300020070 | Ga0206356_11432754 | Ga0206356_114327542 | 96 |
| 248 | 3300020075 | Ga0206349_1095474 | Ga0206349_10954742 | 96 |
| 249 | 3300020075 | Ga0206349_1740722 | Ga0206349_17407223 | 96 |
| 250 | 3300020076 | Ga0206355_1355011 | Ga0206355_13550112 | 96 |
| 251 | 3300020077 | Ga0206351_10308496 | Ga0206351_103084962 | 96 |
| 252 | 3300020077 | Ga0206351_10485341 | Ga0206351_104853412 | 96 |
| 253 | 3300020078 | Ga0206352_10121977 | Ga0206352_101219772 | 96 |
| 254 | 3300020080 | Ga0206350_10182640 | Ga0206350_101826402 | 96 |
| 255 | 3300020080 | Ga0206350_10199377 | Ga0206350_101993772 | 96 |
| 256 | 3300020081 | Ga0206354_10245380 | Ga0206354_102453803 | 96 |
| 257 | 3300020081 | Ga0206354_10357178 | Ga0206354_103571782 | 96 |
| 258 | 3300020082 | Ga0206353_11417608 | Ga0206353_114176082 | 96 |
| 259 | 3300020610 | Ga0154015_1264589 | Ga0154015_12645892 | 96 |
| 260 | 3300020610 | Ga0154015_1376280 | Ga0154015_13762802 | 96 |
| 261 | 3300020610 | Ga0154015_1646162 | Ga0154015_16461622 | 96 |
| 262 | 3300021384 | Ga0213876_10742456 | Ga0213876_107424561 | 96 |
| 263 | 3300022467 | Ga0224712_10063749 | Ga0224712_100637492 | 96 |
| 264 | 3300022467 | Ga0224712_10400556 | Ga0224712_104005561 | 96 |
| 265 | 3300025735 | Ga0207713_1040095 | Ga0207713_10400953 | 96 |
| 266 | 3300025900 | Ga0207710_10138624 | Ga0207710_101386242 | 96 |
| 267 | 3300025901 | Ga0207688_10009899 | Ga0207688_100098993 | 96 |
| 268 | 3300025901 | Ga0207688_10179190 | Ga0207688_101791901 | 96 |
| 269 | 3300025903 | Ga0207680_10100006 | Ga0207680_101000062 | 96 |
| 270 | 3300025904 | Ga0207647_10063599 | Ga0207647_100635993 | 96 |
| 271 | 3300025906 | Ga0207699_10320428 | Ga0207699_103204283 | 96 |
| 272 | 3300025908 | Ga0207643_10000829 | Ga0207643_1000082914 | 96 |
| 273 | 3300025909 | Ga0207705_10009805 | Ga0207705_100098053 | 96 |
| 274 | 3300025911 | Ga0207654_10054785 | Ga0207654_100547853 | 96 |
| 275 | 3300025912 | Ga0207707_10330919 | Ga0207707_103309192 | 96 |
| 276 | 3300025913 | Ga0207695_10200993 | Ga0207695_102009932 | 96 |
| 277 | 3300025914 | Ga0207671_10104428 | Ga0207671_101044283 | 96 |
| 278 | 3300025915 | Ga0207693_10105668 | Ga0207693_101056683 | 96 |
| 279 | 3300025916 | Ga0207663_10012134 | Ga0207663_100121342 | 96 |
| 280 | 3300025917 | Ga0207660_10074004 | Ga0207660_100740042 | 96 |
| 281 | 3300025918 | Ga0207662_10055771 | Ga0207662_100557713 | 96 |
| 282 | 3300025918 | Ga0207662_10890282 | Ga0207662_108902821 | 96 |
| 283 | 3300025919 | Ga0207657_10012901 | Ga0207657_100129014 | 96 |
| 284 | 3300025919 | Ga0207657_10286186 | Ga0207657_102861862 | 96 |
| 285 | 3300025920 | Ga0207649_10020772 | Ga0207649_100207724 | 96 |
| 286 | 3300025921 | Ga0207652_10036582 | Ga0207652_100365825 | 96 |
| 287 | 3300025921 | Ga0207652_10126186 | Ga0207652_101261863 | 96 |
| 288 | 3300025923 | Ga0207681_10268712 | Ga0207681_102687122 | 96 |
| 289 | 3300025924 | Ga0207694_10663830 | Ga0207694_106638302 | 96 |
| 290 | 3300025924 | Ga0207694_10776213 | Ga0207694_107762132 | 96 |
| 291 | 3300025924 | Ga0207694_11392500 | Ga0207694_113925001 | 96 |
| 292 | 3300025925 | Ga0207650_10006119 | Ga0207650_100061196 | 96 |
| 293 | 3300025926 | Ga0207659_10008161 | Ga0207659_100081618 | 96 |
| 294 | 3300025927 | Ga0207687_10014662 | Ga0207687_100146623 | 96 |
| 295 | 3300025928 | Ga0207700_10021793 | Ga0207700_100217934 | 96 |
| 296 | 3300025931 | Ga0207644_10058628 | Ga0207644_100586284 | 96 |
| 297 | 3300025932 | Ga0207690_10428755 | Ga0207690_104287553 | 96 |
| 298 | 3300025932 | Ga0207690_10923001 | Ga0207690_109230012 | 96 |
| 299 | 3300025933 | Ga0207706_10045943 | Ga0207706_100459432 | 96 |
| 300 | 3300025933 | Ga0207706_10459716 | Ga0207706_104597162 | 96 |
| 301 | 3300025934 | Ga0207686_11218794 | Ga0207686_112187941 | 96 |
| 302 | 3300025935 | Ga0207709_10185818 | Ga0207709_101858182 | 96 |
| 303 | 3300025936 | Ga0207670_10150336 | Ga0207670_101503363 | 96 |
| 304 | 3300025938 | Ga0207704_10243456 | Ga0207704_102434563 | 96 |
| 305 | 3300025939 | Ga0207665_11096061 | Ga0207665_110960611 | 96 |
| 306 | 3300025940 | Ga0207691_10014578 | Ga0207691_100145782 | 96 |
| 307 | 3300025941 | Ga0207711_10196148 | Ga0207711_101961483 | 96 |
| 308 | 3300025942 | Ga0207689_10004110 | Ga0207689_100041108 | 96 |
| 309 | 3300025944 | Ga0207661_10004749 | Ga0207661_100047499 | 96 |
| 310 | 3300025944 | Ga0207661_10084137 | Ga0207661_100841373 | 96 |
| 311 | 3300025944 | Ga0207661_10666640 | Ga0207661_106666402 | 96 |
| 312 | 3300025945 | Ga0207679_10019570 | Ga0207679_100195703 | 96 |
| 313 | 3300025949 | Ga0207667_10445673 | Ga0207667_104456732 | 96 |
| 314 | 3300025960 | Ga0207651_10163528 | Ga0207651_101635283 | 96 |
| 315 | 3300025961 | Ga0207712_10203610 | Ga0207712_102036102 | 96 |
| 316 | 3300025972 | Ga0207668_10212052 | Ga0207668_102120522 | 96 |
| 317 | 3300025981 | Ga0207640_10216743 | Ga0207640_102167432 | 96 |
| 318 | 3300025986 | Ga0207658_10716328 | Ga0207658_107163282 | 96 |
| 319 | 3300026023 | Ga0207677_10074383 | Ga0207677_100743832 | 96 |
| 320 | 3300026035 | Ga0207703_10099149 | Ga0207703_100991492 | 96 |
| 321 | 3300026041 | Ga0207639_10019296 | Ga0207639_100192963 | 96 |
| 322 | 3300026067 | Ga0207678_10000537 | Ga0207678_1000053714 | 96 |
| 323 | 3300026067 | Ga0207678_10263050 | Ga0207678_102630502 | 96 |
| 324 | 3300026075 | Ga0207708_10004306 | Ga0207708_100043062 | 96 |
| 325 | 3300026078 | Ga0207702_10015790 | Ga0207702_100157906 | 96 |
| 326 | 3300026078 | Ga0207702_10053400 | Ga0207702_100534004 | 96 |
| 327 | 3300026088 | Ga0207641_10014896 | Ga0207641_100148963 | 96 |
| 328 | 3300026089 | Ga0207648_10048745 | Ga0207648_100487453 | 96 |
| 329 | 3300026095 | Ga0207676_10001429 | Ga0207676_100014293 | 96 |
| 330 | 3300026116 | Ga0207674_10203011 | Ga0207674_102030112 | 96 |
| 331 | 3300026116 | Ga0207674_11175391 | Ga0207674_111753912 | 96 |
| 332 | 3300026118 | Ga0207675_100023096 | Ga0207675_1000230965 | 96 |
| 333 | 3300026121 | Ga0207683_10005024 | Ga0207683_100050243 | 96 |
| 334 | 3300026142 | Ga0207698_10016381 | Ga0207698_100163814 | 96 |
| 335 | 3300027907 | Ga0207428_10017467 | Ga0207428_100174673 | 96 |
| 336 | 3300028379 | Ga0268266_10020837 | Ga0268266_100208373 | 96 |
| 337 | 3300028381 | Ga0268264_10191897 | Ga0268264_101918972 | 96 |
| 338 | 3300030521 | Ga0307511_10029063 | Ga0307511_100290633 | 96 |
| 339 | 3300030742 | Ga0316183_1078238 | Ga0316183_10782382 | 96 |
| 340 | 3300035170 | Ga0373943_0359239 | Ga0373943_0359239_503_793 | 96 |
| 341 | 3300037471 | Ga0395905_0876356 | Ga0395905_0876356_437_727 | 96 |
| 342 | 3300039437 | Ga0436365_1200322 | Ga0436365_1200322_214_504 | 96 |
| 343 | 3300041404 | Ga0439436_0032479 | Ga0439436_0032479_782_1072 | 96 |
| 344 | 3300041406 | Ga0439439_0001943 | Ga0439439_0001943_2318_2608 | 96 |
| 345 | 3300041411 | Ga0439466_0015325 | Ga0439466_0015325_330_620 | 96 |
| 346 | 3300041999 | Ga0439433_0028060 | Ga0439433_0028060_632_922 | 96 |
| 347 | 3300042002 | Ga0439442_044183 | Ga0439442_044183_113_403 | 96 |
| 348 | 3300042007 | Ga0439449_0002649 | Ga0439449_0002649_2288_2578 | 96 |
| 349 | 3300042012 | Ga0439455_0009452 | Ga0439455_0009452_415_705 | 96 |
| 350 | 3300042014 | Ga0439457_003005 | Ga0439457_003005_3219_3509 | 96 |
| 351 | 3300042461 | Ga0439460_0256764 | Ga0439460_0256764_256_546 | 96 |
| 352 | 3300042993 | Ga0439440_0119617 | Ga0439440_0119617_291_581 | 96 |
| 353 | 3300046461 | Ga0495641_0476020 | Ga0495641_0476020_196_486 | 96 |
| 354 | 3300046535 | Ga0495586_0600117 | Ga0495586_0600117_333_623 | 96 |
| 355 | 3300046663 | Ga0495635_0136886 | Ga0495635_0136886_739_1029 | 96 |
| 356 | 3300047319 | Ga0495674_0587904 | Ga0495674_0587904_371_661 | 96 |
| 357 | 3300050492 | nmdc:mga0yw44_439676_c1 | nmdc:mga0yw44_439676_c1_330_620 | 96 |
| 358 | 3300050494 | nmdc:mga06z11_124724_c1 | nmdc:mga06z11_124724_c1_816_1106 | 96 |
| 359 | 3300050494 | nmdc:mga06z11_922275_c1 | nmdc:mga06z11_922275_c1_141_431 | 96 |
| 360 | 3300053077 | Ga0495601_0227693 | Ga0495601_0227693_403_693 | 96 |
| 361 | 3300053084 | Ga0495595_0233331 | Ga0495595_0233331_583_873 | 96 |
| 362 | 3300059477 | Ga0587084_062644 | Ga0587084_062644_294_584 | 96 |
| 363 | 3300059478 | Ga0587093_030920 | Ga0587093_030920_204_494 | 96 |
| 364 | 3300059490 | Ga0587066_056272 | Ga0587066_056272_308_598 | 96 |
| 365 | 3300059491 | Ga0587070_022496 | Ga0587070_022496_588_878 | 96 |
| 366 | 3300059493 | Ga0587077_047432 | Ga0587077_047432_287_577 | 96 |
| 367 | 3300059503 | Ga0587080_036047 | Ga0587080_036047_282_572 | 96 |
| 368 | 3300059504 | Ga0587082_033175 | Ga0587082_033175_277_567 | 96 |
| 369 | 3300059505 | Ga0587083_0087287 | Ga0587083_0087287_58_348 | 96 |
| 370 | 3300059505 | Ga0587083_0110316 | Ga0587083_0110316_346_636 | 96 |
| 371 | 3300059506 | Ga0587085_032436 | Ga0587085_032436_314_604 | 96 |
| 372 | 3300059507 | Ga0587086_023465 | Ga0587086_023465_292_582 | 96 |
| 373 | 3300059508 | Ga0587088_020662 | Ga0587088_020662_133_423 | 96 |
| 374 | 3300059511 | Ga0587091_068752 | Ga0587091_068752_129_419 | 96 |
| 375 | 3300059512 | Ga0587092_029478 | Ga0587092_029478_324_614 | 96 |
| 376 | 3300059513 | Ga0587094_022270 | Ga0587094_022270_268_558 | 96 |
| 377 | 3300059514 | Ga0587095_022033 | Ga0587095_022033_94_384 | 96 |
| 378 | 3300059607 | Ga0587125_041881 | Ga0587125_041881_231_521 | 96 |
| 379 | 3300059608 | Ga0587129_019024 | Ga0587129_019024_105_395 | 96 |
| 380 | 3300059622 | Ga0587099_026618 | Ga0587099_026618_101_391 | 96 |
| 381 | 3300059624 | Ga0587109_064437 | Ga0587109_064437_166_456 | 96 |
| 382 | 3300059625 | Ga0587113_029707 | Ga0587113_029707_100_390 | 96 |
| 383 | 3300059626 | Ga0587115_027984 | Ga0587115_027984_248_538 | 96 |
| 384 | 3300059628 | Ga0587122_013518 | Ga0587122_013518_181_471 | 96 |
| 385 | 3300059629 | Ga0587127_005001 | Ga0587127_005001_206_496 | 96 |
| 386 | 3300059630 | Ga0587128_062444 | Ga0587128_062444_313_603 | 96 |
| 387 | 3300059639 | Ga0587062_079760 | Ga0587062_079760_103_393 | 96 |
| 388 | 3300059640 | Ga0587067_045105 | Ga0587067_045105_286_576 | 96 |
| 389 | 3300059641 | Ga0587068_048223 | Ga0587068_048223_213_503 | 96 |
| 390 | 3300059642 | Ga0587069_068879 | Ga0587069_068879_111_401 | 96 |
| 391 | 3300059644 | Ga0587075_027885 | Ga0587075_027885_291_581 | 96 |
| 392 | 3300059645 | Ga0587076_041161 | Ga0587076_041161_288_578 | 96 |
| 393 | 3300059646 | Ga0587078_016868 | Ga0587078_016868_281_571 | 96 |
| 394 | 3300059647 | Ga0587079_059945 | Ga0587079_059945_159_449 | 96 |
| 395 | 3300059648 | Ga0587100_009137 | Ga0587100_009137_246_536 | 96 |
| 396 | 3300059649 | Ga0587102_016841 | Ga0587102_016841_206_496 | 96 |
| 397 | 3300059651 | Ga0587105_011794 | Ga0587105_011794_101_391 | 96 |
| 398 | 3300059652 | Ga0587107_028288 | Ga0587107_028288_336_626 | 96 |
| 399 | 3300059655 | Ga0587114_027619 | Ga0587114_027619_238_528 | 96 |
| 400 | 3300059656 | Ga0587116_11448 | Ga0587116_11448_94_384 | 96 |
| 401 | 3300059658 | Ga0587119_019641 | Ga0587119_019641_250_540 | 96 |
| 402 | 3300060344 | Ga0587071_044510 | Ga0587071_044510_280_570 | 96 |
| 403 | 3300060346 | Ga0587111_0049893 | Ga0587111_0049893_246_536 | 96 |
| 404 | 3300000549 | LJQas_1013115 | LJQas_10131152 | 97 |
| 405 | 3300003354 | JGI25160J50197_1034560 | JGI25160J50197_10345603 | 97 |
| 406 | 3300003354 | JGI25160J50197_1039529 | JGI25160J50197_10395293 | 97 |
| 407 | 3300003579 | Ga0007429J51699_1153713 | Ga0007429J51699_11537131 | 97 |
| 408 | 3300004798 | Ga0058859_11486220 | Ga0058859_114862201 | 97 |
| 409 | 3300004800 | Ga0058861_10042331 | Ga0058861_100423312 | 97 |
| 410 | 3300004801 | Ga0058860_12229073 | Ga0058860_122290732 | 97 |
| 411 | 3300004803 | Ga0058862_10093961 | Ga0058862_100939612 | 97 |
| 412 | 3300005328 | Ga0070676_10011402 | Ga0070676_100114022 | 97 |
| 413 | 3300005329 | Ga0070683_100004355 | Ga0070683_1000043556 | 97 |
| 414 | 3300005329 | Ga0070683_100264596 | Ga0070683_1002645962 | 97 |
| 415 | 3300005331 | Ga0070670_100089256 | Ga0070670_1000892562 | 97 |
| 416 | 3300005331 | Ga0070670_100164881 | Ga0070670_1001648813 | 97 |
| 417 | 3300005331 | Ga0070670_100996519 | Ga0070670_1009965192 | 97 |
| 418 | 3300005337 | Ga0070682_101668963 | Ga0070682_1016689632 | 97 |
| 419 | 3300005338 | Ga0068868_100088880 | Ga0068868_1000888801 | 97 |
| 420 | 3300005339 | Ga0070660_100316086 | Ga0070660_1003160861 | 97 |
| 421 | 3300005340 | Ga0070689_100195991 | Ga0070689_1001959912 | 97 |
| 422 | 3300005340 | Ga0070689_102147115 | Ga0070689_1021471151 | 97 |
| 423 | 3300005341 | Ga0070691_10268408 | Ga0070691_102684082 | 97 |
| 424 | 3300005343 | Ga0070687_100725161 | Ga0070687_1007251612 | 97 |
| 425 | 3300005344 | Ga0070661_100138050 | Ga0070661_1001380503 | 97 |
| 426 | 3300005344 | Ga0070661_101113932 | Ga0070661_1011139321 | 97 |
| 427 | 3300005345 | Ga0070692_10079679 | Ga0070692_100796792 | 97 |
| 428 | 3300005347 | Ga0070668_100445157 | Ga0070668_1004451572 | 97 |
| 429 | 3300005347 | Ga0070668_101733383 | Ga0070668_1017333831 | 97 |
| 430 | 3300005354 | Ga0070675_100001206 | Ga0070675_10000120615 | 97 |
| 431 | 3300005355 | Ga0070671_101591268 | Ga0070671_1015912682 | 97 |
| 432 | 3300005364 | Ga0070673_100745257 | Ga0070673_1007452572 | 97 |
| 433 | 3300005366 | Ga0070659_100027291 | Ga0070659_1000272911 | 97 |
| 434 | 3300005366 | Ga0070659_101049263 | Ga0070659_1010492631 | 97 |
| 435 | 3300005438 | Ga0070701_10415330 | Ga0070701_104153302 | 97 |
| 436 | 3300005438 | Ga0070701_10924436 | Ga0070701_109244361 | 97 |
| 437 | 3300005441 | Ga0070700_100010220 | Ga0070700_1000102204 | 97 |
| 438 | 3300005455 | Ga0070663_100006877 | Ga0070663_1000068774 | 97 |
| 439 | 3300005456 | Ga0070678_100380879 | Ga0070678_1003808792 | 97 |
| 440 | 3300005457 | Ga0070662_100097077 | Ga0070662_1000970773 | 97 |
| 441 | 3300005457 | Ga0070662_101440308 | Ga0070662_1014403081 | 97 |
| 442 | 3300005466 | Ga0070685_10298067 | Ga0070685_102980672 | 97 |
| 443 | 3300005530 | Ga0070679_101267404 | Ga0070679_1012674042 | 97 |
| 444 | 3300005535 | Ga0070684_100251975 | Ga0070684_1002519753 | 97 |
| 445 | 3300005535 | Ga0070684_101276863 | Ga0070684_1012768631 | 97 |
| 446 | 3300005543 | Ga0070672_100905976 | Ga0070672_1009059762 | 97 |
| 447 | 3300005543 | Ga0070672_101589459 | Ga0070672_1015894591 | 97 |
| 448 | 3300005544 | Ga0070686_100622504 | Ga0070686_1006225042 | 97 |
| 449 | 3300005544 | Ga0070686_101506756 | Ga0070686_1015067561 | 97 |
| 450 | 3300005547 | Ga0070693_101048760 | Ga0070693_1010487602 | 97 |
| 451 | 3300005564 | Ga0070664_100000690 | Ga0070664_1000006906 | 97 |
| 452 | 3300005564 | Ga0070664_100241888 | Ga0070664_1002418881 | 97 |
| 453 | 3300005577 | Ga0068857_100101428 | Ga0068857_1001014284 | 97 |
| 454 | 3300005577 | Ga0068857_100109175 | Ga0068857_1001091753 | 97 |
| 455 | 3300005577 | Ga0068857_100321271 | Ga0068857_1003212712 | 97 |
| 456 | 3300005578 | Ga0068854_100159807 | Ga0068854_1001598071 | 97 |
| 457 | 3300005616 | Ga0068852_101108374 | Ga0068852_1011083742 | 97 |
| 458 | 3300005616 | Ga0068852_101869030 | Ga0068852_1018690302 | 97 |
| 459 | 3300005618 | Ga0068864_100101208 | Ga0068864_1001012084 | 97 |
| 460 | 3300005618 | Ga0068864_100162000 | Ga0068864_1001620003 | 97 |
| 461 | 3300005719 | Ga0068861_100102170 | Ga0068861_1001021702 | 97 |
| 462 | 3300005841 | Ga0068863_100068954 | Ga0068863_1000689544 | 97 |
| 463 | 3300005841 | Ga0068863_100349375 | Ga0068863_1003493753 | 97 |
| 464 | 3300005842 | Ga0068858_100354082 | Ga0068858_1003540822 | 97 |
| 465 | 3300005842 | Ga0068858_100907509 | Ga0068858_1009075091 | 97 |
| 466 | 3300005843 | Ga0068860_100424306 | Ga0068860_1004243062 | 97 |
| 467 | 3300005844 | Ga0068862_100044918 | Ga0068862_1000449183 | 97 |
| 468 | 3300005844 | Ga0068862_101856935 | Ga0068862_1018569352 | 97 |
| 469 | 3300006844 | Ga0075428_100204933 | Ga0075428_1002049331 | 97 |
| 470 | 3300006847 | Ga0075431_100966354 | Ga0075431_1009663542 | 97 |
| 471 | 3300006847 | Ga0075431_101015528 | Ga0075431_1010155282 | 97 |
| 472 | 3300006852 | Ga0075433_11269025 | Ga0075433_112690251 | 97 |
| 473 | 3300006880 | Ga0075429_100049388 | Ga0075429_1000493882 | 97 |
| 474 | 3300006880 | Ga0075429_100356979 | Ga0075429_1003569792 | 97 |
| 475 | 3300006881 | Ga0068865_100346074 | Ga0068865_1003460742 | 97 |
| 476 | 3300009094 | Ga0111539_10009710 | Ga0111539_100097109 | 97 |
| 477 | 3300009098 | Ga0105245_10007354 | Ga0105245_100073545 | 97 |
| 478 | 3300009147 | Ga0114129_10029013 | Ga0114129_100290133 | 97 |
| 479 | 3300009147 | Ga0114129_10606568 | Ga0114129_106065681 | 97 |
| 480 | 3300009147 | Ga0114129_12315031 | Ga0114129_123150312 | 97 |
| 481 | 3300009174 | Ga0105241_10620006 | Ga0105241_106200062 | 97 |
| 482 | 3300009177 | Ga0105248_13394863 | Ga0105248_133948632 | 97 |
| 483 | 3300009545 | Ga0105237_10330358 | Ga0105237_103303582 | 97 |
| 484 | 3300009553 | Ga0105249_10045189 | Ga0105249_100451895 | 97 |
| 485 | 3300009553 | Ga0105249_10643457 | Ga0105249_106434572 | 97 |
| 486 | 3300010375 | Ga0105239_10216047 | Ga0105239_102160474 | 97 |
| 487 | 3300011119 | Ga0105246_12520294 | Ga0105246_125202942 | 97 |
| 488 | 3300013297 | Ga0157378_10535169 | Ga0157378_105351692 | 97 |
| 489 | 3300013306 | Ga0163162_10620883 | Ga0163162_106208832 | 97 |
| 490 | 3300014325 | Ga0163163_10412540 | Ga0163163_104125403 | 97 |
| 491 | 3300014325 | Ga0163163_11819650 | Ga0163163_118196501 | 97 |
| 492 | 3300014326 | Ga0157380_13318085 | Ga0157380_133180851 | 97 |
| 493 | 3300014745 | Ga0157377_10022949 | Ga0157377_100229494 | 97 |
| 494 | 3300014745 | Ga0157377_10599468 | Ga0157377_105994682 | 97 |
| 495 | 3300014745 | Ga0157377_11422890 | Ga0157377_114228901 | 97 |
| 496 | 3300014968 | Ga0157379_10137330 | Ga0157379_101373303 | 97 |
| 497 | 3300014969 | Ga0157376_10480737 | Ga0157376_104807372 | 97 |
| 498 | 3300020078 | Ga0206352_10284584 | Ga0206352_102845842 | 97 |
| 499 | 3300021388 | Ga0213875_10284505 | Ga0213875_102845052 | 97 |
| 500 | 3300025302 | Ga0207426_1008130 | Ga0207426_10081305 | 97 |
| 501 | 3300025302 | Ga0207426_1011991 | Ga0207426_10119915 | 97 |
| 502 | 3300025901 | Ga0207688_10088217 | Ga0207688_100882172 | 97 |
| 503 | 3300025907 | Ga0207645_10169000 | Ga0207645_101690002 | 97 |
| 504 | 3300025908 | Ga0207643_10088314 | Ga0207643_100883142 | 97 |
| 505 | 3300025914 | Ga0207671_10302606 | Ga0207671_103026062 | 97 |
| 506 | 3300025918 | Ga0207662_10139838 | Ga0207662_101398382 | 97 |
| 507 | 3300025919 | Ga0207657_10235462 | Ga0207657_102354623 | 97 |
| 508 | 3300025920 | Ga0207649_10379938 | Ga0207649_103799382 | 97 |
| 509 | 3300025920 | Ga0207649_10446554 | Ga0207649_104465542 | 97 |
| 510 | 3300025923 | Ga0207681_10979925 | Ga0207681_109799252 | 97 |
| 511 | 3300025925 | Ga0207650_10402673 | Ga0207650_104026732 | 97 |
| 512 | 3300025926 | Ga0207659_10004453 | Ga0207659_100044536 | 97 |
| 513 | 3300025927 | Ga0207687_10009481 | Ga0207687_100094813 | 97 |
| 514 | 3300025931 | Ga0207644_10885715 | Ga0207644_108857151 | 97 |
| 515 | 3300025933 | Ga0207706_10015936 | Ga0207706_100159363 | 97 |
| 516 | 3300025936 | Ga0207670_11810693 | Ga0207670_118106932 | 97 |
| 517 | 3300025938 | Ga0207704_10968048 | Ga0207704_109680481 | 97 |
| 518 | 3300025942 | Ga0207689_10465654 | Ga0207689_104656542 | 97 |
| 519 | 3300025944 | Ga0207661_10004995 | Ga0207661_100049957 | 97 |
| 520 | 3300025945 | Ga0207679_10048271 | Ga0207679_100482712 | 97 |
| 521 | 3300025945 | Ga0207679_10218531 | Ga0207679_102185312 | 97 |
| 522 | 3300025945 | Ga0207679_10569270 | Ga0207679_105692702 | 97 |
| 523 | 3300025961 | Ga0207712_10115014 | Ga0207712_101150143 | 97 |
| 524 | 3300025972 | Ga0207668_10923927 | Ga0207668_109239272 | 97 |
| 525 | 3300026023 | Ga0207677_10022459 | Ga0207677_100224594 | 97 |
| 526 | 3300026035 | Ga0207703_10384895 | Ga0207703_103848952 | 97 |
| 527 | 3300026067 | Ga0207678_10042979 | Ga0207678_100429794 | 97 |
| 528 | 3300026067 | Ga0207678_11473416 | Ga0207678_114734161 | 97 |
| 529 | 3300026075 | Ga0207708_10010011 | Ga0207708_100100116 | 97 |
| 530 | 3300026088 | Ga0207641_10256958 | Ga0207641_102569582 | 97 |
| 531 | 3300026095 | Ga0207676_10136758 | Ga0207676_101367582 | 97 |
| 532 | 3300026095 | Ga0207676_10292713 | Ga0207676_102927133 | 97 |
| 533 | 3300026116 | Ga0207674_10104397 | Ga0207674_101043973 | 97 |
| 534 | 3300026116 | Ga0207674_10138753 | Ga0207674_101387532 | 97 |
| 535 | 3300026118 | Ga0207675_100055589 | Ga0207675_1000555893 | 97 |
| 536 | 3300026118 | Ga0207675_102002950 | Ga0207675_1020029501 | 97 |
| 537 | 3300026121 | Ga0207683_10189249 | Ga0207683_101892492 | 97 |
| 538 | 3300026142 | Ga0207698_12187385 | Ga0207698_121873851 | 97 |
| 539 | 3300027907 | Ga0207428_10018395 | Ga0207428_100183955 | 97 |
| 540 | 3300028380 | Ga0268265_10011922 | Ga0268265_100119224 | 97 |
| 541 | 3300028381 | Ga0268264_10896059 | Ga0268264_108960591 | 97 |
| 542 | 3300030732 | Ga0316176_1169306 | Ga0316176_11693062 | 97 |
| 543 | 3300030744 | Ga0316181_1215123 | Ga0316181_12151234 | 97 |
| 544 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011286 | 97 |
| 545 | 3300031548 | Ga0307408_100015080 | Ga0307408_1000150803 | 97 |
| 546 | 3300031548 | Ga0307408_100236260 | Ga0307408_1002362601 | 97 |
| 547 | 3300031616 | Ga0307508_10019446 | Ga0307508_100194462 | 97 |
| 548 | 3300031730 | Ga0307516_10231934 | Ga0307516_102319343 | 97 |
| 549 | 3300031731 | Ga0307405_10006197 | Ga0307405_100061976 | 97 |
| 550 | 3300031824 | Ga0307413_10062430 | Ga0307413_100624302 | 97 |
| 551 | 3300031824 | Ga0307413_10291321 | Ga0307413_102913212 | 97 |
| 552 | 3300031852 | Ga0307410_10027735 | Ga0307410_100277352 | 97 |
| 553 | 3300031889 | Ga0326468_10055121 | Ga0326468_100551212 | 97 |
| 554 | 3300031901 | Ga0307406_10001387 | Ga0307406_100013874 | 97 |
| 555 | 3300031901 | Ga0307406_10132359 | Ga0307406_101323594 | 97 |
| 556 | 3300031901 | Ga0307406_11460256 | Ga0307406_114602561 | 97 |
| 557 | 3300031903 | Ga0307407_10094597 | Ga0307407_100945973 | 97 |
| 558 | 3300031903 | Ga0307407_10142451 | Ga0307407_101424512 | 97 |
| 559 | 3300031995 | Ga0307409_100000427 | Ga0307409_1000004275 | 97 |
| 560 | 3300031995 | Ga0307409_100009939 | Ga0307409_1000099393 | 97 |
| 561 | 3300031995 | Ga0307409_100629303 | Ga0307409_1006293032 | 97 |
| 562 | 3300032002 | Ga0307416_100000122 | Ga0307416_1000001229 | 97 |
| 563 | 3300032002 | Ga0307416_100205811 | Ga0307416_1002058112 | 97 |
| 564 | 3300032002 | Ga0307416_103730249 | Ga0307416_1037302491 | 97 |
| 565 | 3300032005 | Ga0307411_10315688 | Ga0307411_103156882 | 97 |
| 566 | 3300032126 | Ga0307415_100000011 | Ga0307415_10000001140 | 97 |
| 567 | 3300032126 | Ga0307415_100008317 | Ga0307415_1000083176 | 97 |
| 568 | 3300032126 | Ga0307415_100033356 | Ga0307415_1000333563 | 97 |
| 569 | 3300035088 | Ga0373940_0354719 | Ga0373940_0354719_27_344 | 97 |
| 570 | 3300035117 | Ga0373953_0038209 | Ga0373953_0038209_760_1065 | 97 |
| 571 | 3300036401 | Ga0373937_0015793 | Ga0373937_0015793_58_363 | 97 |
| 572 | 3300037853 | Ga0436364_0014016 | Ga0436364_0014016_2970_3266 | 97 |
| 573 | 3300041405 | Ga0439438_141187 | Ga0439438_141187_159_452 | 97 |
| 574 | 3300041486 | Ga0451807_0348738 | Ga0451807_0348738_138_431 | 97 |
| 575 | 3300042007 | Ga0439449_0145072 | Ga0439449_0145072_131_424 | 97 |
| 576 | 3300042015 | Ga0439462_0235512 | Ga0439462_0235512_147_440 | 97 |
| 577 | 3300042145 | Ga0450906_045237 | Ga0450906_045237_207_500 | 97 |
| 578 | 3300046663 | Ga0495635_0380402 | Ga0495635_0380402_615_920 | 97 |
| 579 | 3300047322 | Ga0495680_0763649 | Ga0495680_0763649_275_580 | 97 |
| 580 | 3300048912 | Ga0496109_1402696 | Ga0496109_1402696_273_575 | 97 |
| 581 | 3300048915 | Ga0496112_1280497 | Ga0496112_1280497_232_528 | 97 |
| 582 | 3300049576 | Ga0501040_0898483 | Ga0501040_0898483_280_582 | 97 |
| 583 | 3300049582 | Ga0501048_0388604 | Ga0501048_0388604_587_904 | 97 |
| 584 | 3300049588 | Ga0501072_0716293 | Ga0501072_0716293_373_690 | 97 |
| 585 | 3300050507 | nmdc:mga05p37_1347784_c1 | nmdc:mga05p37_1347784_c1_339_647 | 97 |
| 586 | 3300050507 | nmdc:mga05p37_177905_c1 | nmdc:mga05p37_177905_c1_448_756 | 97 |
| 587 | 3300050508 | nmdc:mga09592_30910_c1 | nmdc:mga09592_30910_c1_436_744 | 97 |
| 588 | 3300050508 | nmdc:mga09592_321515_c1 | nmdc:mga09592_321515_c1_899_1201 | 97 |
| 589 | 3300050508 | nmdc:mga09592_354690_c1 | nmdc:mga09592_354690_c1_683_1000 | 97 |
| 590 | 3300050510 | nmdc:mga06r32_1374992_c1 | nmdc:mga06r32_1374992_c1_282_590 | 97 |
| 591 | 3300050510 | nmdc:mga06r32_953819_c1 | nmdc:mga06r32_953819_c1_139_450 | 97 |
| 592 | 3300050511 | nmdc:mga08y16_4311_c1 | nmdc:mga08y16_4311_c1_10316_10633 | 97 |
| 593 | 3300053085 | Ga0495619_0065824 | Ga0495619_0065824_677_982 | 97 |
| 594 | 3300053085 | Ga0495619_0549099 | Ga0495619_0549099_303_596 | 97 |
| 595 | 3300053090 | Ga0500646_0296000 | Ga0500646_0296000_55_357 | 97 |
| 596 | 3300053092 | Ga0500583_0053284 | Ga0500583_0053284_1341_1655 | 97 |
| 597 | 3300053096 | Ga0500641_0019150 | Ga0500641_0019150_1145_1459 | 97 |
| 598 | 3300053118 | Ga0500594_0306509 | Ga0500594_0306509_124_438 | 97 |
| 599 | 3300053146 | Ga0500588_0001778 | Ga0500588_0001778_3176_3490 | 97 |
| 600 | 3300053160 | Ga0500633_0033521 | Ga0500633_0033521_866_1180 | 97 |
| 601 | 3300054114 | Ga0501084_1427531 | Ga0501084_1427531_183_500 | 97 |
| 602 | 3300059511 | Ga0587091_075996 | Ga0587091_075996_334_651 | 97 |
| 603 | 3300059605 | Ga0587106_041245 | Ga0587106_041245_390_683 | 97 |
| 604 | 3300059623 | Ga0587101_150085 | Ga0587101_150085_120_422 | 97 |
| 605 | 3300059640 | Ga0587067_191296 | Ga0587067_191296_181_498 | 97 |
| 606 | 3300059644 | Ga0587075_140480 | Ga0587075_140480_28_345 | 97 |
| 607 | 3300060353 | Ga0501082_0811847 | Ga0501082_0811847_313_618 | 97 |
| 608 | 3300060353 | Ga0501082_1178175 | Ga0501082_1178175_266_583 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xzi-assembly1.cif.gz_D | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.8187 | 1 | 91 |
| 7xzi-assembly1.cif.gz_D | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.6914 | 1 | 91 |
| 6ek4-assembly3.cif.gz_C | paxb from photorhabdus luminescens | 0.52 | 2 | 93 |
| 6ek4-assembly3.cif.gz_C | paxb from photorhabdus luminescens | 0.4919 | 2 | 93 |
| 7v35-assembly1.cif.gz_R | cryo-em structure of the gipr/glp-1r/gcgr triagonist peptide 20-bound human gcgr-gs complex | 0.2877 | 5 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q12235_49_254_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4686 | 5 | 91 | 1.20.1250.20 |
| af_Q12235_49_254_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4239 | 5 | 91 | 1.20.1250.20 |
| af_Q5ADN9_136_257_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.4204 | 2 | 91 | 3.30.40.10 |
| af_A0A0R4IY33_196_297_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3907 | 5 | 93 | 1.20.58.160 |
| af_Q9ULU8_836_940_1.20.1310.10 | Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats | 0.3821 | 3 | 88 | 1.20.1310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I1G3P3-F1-model_v4 | YggT family protein | 0.9952 | 1 | 93 |
GO:0016020
|
| AF-S2VS64-F1-model_v4 | deleted | 0.995 | 3 | 93 |
|
| AF-V7LEN3-F1-model_v4 | deleted | 0.9937 | 2 | 91 |
|
| AF-A0A5B9G201-F1-model_v4 | YggT family protein | 0.9925 | 2 | 92 |
GO:0016020
|
| AF-U5E7E9-F1-model_v4 | YggT family protein | 0.9924 | 2 | 93 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar