F468759

General Info

Members Datasets Scaffolds Average Seq Length
608 362 603 97

Family's Representative Sequence

Representative Sequence 3300004798|Ga0058859_11486220|Ga0058859_114862201
Length 105
Sequence VLAITLQVLYLLLYVFFLTLIARFIMGYVLTFGRRWQPGRGAAAAMEVVWSVTDPPLKALRRVIPPLRLGTVSLDLSSLVLLVILFVLMDFVVRPLITSVALAGA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
3 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
4 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
5 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
216 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
217 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
252 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
255 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
256 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
257 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
258 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
263 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
264 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
265 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
266 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
315 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
316 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.7
Metatranscriptomes 14.47
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 3.45
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1013115 3300000549 Bacteria 977
2 JGI24743J22301_10025346 3300001991 Bacteria 1149
3 JGI24745J21846_1015638 3300002073 Bacteria 878
4 JGI24033J26618_1012900 3300002155 Bacteria 1010
5 JGI24751J29686_10007576 3300002459 Bacteria 2218
6 JGI25160J50197_1034560 3300003354 Bacteria 1254
7 JGI25160J50197_1039529 3300003354 Bacteria 1103
8 Ga0007409J51694_1045481 3300003575 Bacteria 790
9 Ga0007429J51699_1153713 3300003579 Bacteria 536
10 Ga0032354_1074863 3300003693 Bacteria 619
11 Ga0032354_1110810 3300003693 Bacteria 542
12 Ga0058859_11373918 3300004798 Bacteria 798
13 Ga0058859_11486220 3300004798 Bacteria 612
14 Ga0058863_11972618 3300004799 Bacteria 1420
15 Ga0058861_10042331 3300004800 Bacteria 1021
16 Ga0058861_12063929 3300004800 Bacteria 1668
17 Ga0058861_12067567 3300004800 Bacteria 1419
18 Ga0058860_10026024 3300004801 Bacteria 766
19 Ga0058860_11635538 3300004801 Bacteria 711
20 Ga0058860_12229073 3300004801 Bacteria 752
21 Ga0058862_10093961 3300004803 Bacteria 794
22 Ga0058862_12888595 3300004803 Bacteria 1773
23 Ga0070658_10131350 3300005327 Bacteria 2087
24 Ga0070676_10011402 3300005328 Bacteria 4834
25 Ga0070676_10378285 3300005328 Bacteria 980
26 Ga0070683_100004355 3300005329 Bacteria 11650
27 Ga0070683_100066754 3300005329 Bacteria 3351
28 Ga0070683_100264596 3300005329 Bacteria 1636
29 Ga0070683_100322614 3300005329 Bacteria 1470
30 Ga0070690_100047860 3300005330 Bacteria 2721
31 Ga0070670_100055930 3300005331 Bacteria 3386
32 Ga0070670_100089256 3300005331 Bacteria 2650
33 Ga0070670_100164881 3300005331 Bacteria 1921
34 Ga0070670_100996519 3300005331 Bacteria 762
35 Ga0068869_100005028 3300005334 Bacteria 8284
36 Ga0068869_101454434 3300005334 Bacteria 608
37 Ga0070666_10073850 3300005335 Bacteria 2323
38 Ga0070680_100007324 3300005336 Bacteria 8415
39 Ga0070682_100006130 3300005337 Bacteria 6734
40 Ga0070682_101344187 3300005337 Bacteria 609
41 Ga0070682_101668963 3300005337 Bacteria 553
42 Ga0068868_100034447 3300005338 Bacteria 3909
43 Ga0068868_100088880 3300005338 Bacteria 2487
44 Ga0070660_100069503 3300005339 Bacteria 2746
45 Ga0070660_100316086 3300005339 Bacteria 1282
46 Ga0070689_100027775 3300005340 Bacteria 4269
47 Ga0070689_100195991 3300005340 Bacteria 1647
48 Ga0070689_102147115 3300005340 Bacteria 512
49 Ga0070691_10001280 3300005341 Bacteria 10635
50 Ga0070691_10268408 3300005341 Bacteria 921
51 Ga0070687_100055004 3300005343 Bacteria 2076
52 Ga0070687_100725161 3300005343 Bacteria 697
53 Ga0070661_100129772 3300005344 Bacteria 1892
54 Ga0070661_100138050 3300005344 Bacteria 1836
55 Ga0070661_101113932 3300005344 Bacteria 658
56 Ga0070692_10042533 3300005345 Bacteria 2333
57 Ga0070692_10079679 3300005345 Bacteria 1761
58 Ga0070668_100251629 3300005347 Bacteria 1467
59 Ga0070668_100445157 3300005347 Bacteria 1113
60 Ga0070668_101733383 3300005347 Bacteria 574
61 Ga0070669_100369001 3300005353 Bacteria 1169
62 Ga0070675_100001206 3300005354 Bacteria 18804
63 Ga0070675_100084219 3300005354 Bacteria 2655
64 Ga0070671_100034998 3300005355 Bacteria 4159
65 Ga0070671_101591268 3300005355 Bacteria 579
66 Ga0070674_100279202 3300005356 Bacteria 1323
67 Ga0070673_100102151 3300005364 Bacteria 2363
68 Ga0070673_100745257 3300005364 Bacteria 902
69 Ga0070688_100127502 3300005365 Bacteria 1712
70 Ga0070659_100027291 3300005366 Bacteria 4398
71 Ga0070659_100032754 3300005366 Bacteria 4033
72 Ga0070659_101049263 3300005366 Bacteria 717
73 Ga0070659_101269643 3300005366 Bacteria 652
74 Ga0070667_100209129 3300005367 Bacteria 1734
75 Ga0070703_10469316 3300005406 Bacteria 561
76 Ga0070709_10012683 3300005434 Bacteria 4720
77 Ga0070714_100021156 3300005435 Bacteria 5319
78 Ga0070713_100020612 3300005436 Bacteria 5058
79 Ga0070710_10064268 3300005437 Bacteria 2098
80 Ga0070701_10415330 3300005438 Bacteria 856
81 Ga0070701_10924436 3300005438 Bacteria 604
82 Ga0070711_100045757 3300005439 Bacteria 2979
83 Ga0070700_100010220 3300005441 Bacteria 5177
84 Ga0070700_100016103 3300005441 Bacteria 4253
85 Ga0070700_100656531 3300005441 Bacteria 829
86 Ga0070694_100541311 3300005444 Bacteria 931
87 Ga0070663_100006877 3300005455 Bacteria 6884
88 Ga0070663_100009250 3300005455 Bacteria 6094
89 Ga0070663_101355465 3300005455 Bacteria 629
90 Ga0070678_100015294 3300005456 Bacteria 4873
91 Ga0070678_100380879 3300005456 Bacteria 1220
92 Ga0070662_100059912 3300005457 Bacteria 2774
93 Ga0070662_100097077 3300005457 Bacteria 2224
94 Ga0070662_101440308 3300005457 Bacteria 594
95 Ga0070681_10029986 3300005458 Bacteria 5459
96 Ga0068867_100099277 3300005459 Bacteria 2221
97 Ga0070685_10054517 3300005466 Bacteria 2320
98 Ga0070685_10298067 3300005466 Bacteria 1086
99 Ga0070679_100026996 3300005530 Bacteria 5647
100 Ga0070679_101267404 3300005530 Bacteria 683
101 Ga0070684_100251975 3300005535 Bacteria 1614
102 Ga0070684_101276863 3300005535 Bacteria 691
103 Ga0070684_101412545 3300005535 Bacteria 655
104 Ga0070684_101812912 3300005535 Bacteria 576
105 Ga0068853_100020817 3300005539 Bacteria 5456
106 Ga0070672_100074450 3300005543 Bacteria 2709
107 Ga0070672_100905976 3300005543 Bacteria 779
108 Ga0070672_101589459 3300005543 Bacteria 586
109 Ga0070686_100143278 3300005544 Bacteria 1666
110 Ga0070686_100622504 3300005544 Bacteria 853
111 Ga0070686_101506756 3300005544 Bacteria 567
112 Ga0070695_100048619 3300005545 Bacteria 2713
113 Ga0070693_100008461 3300005547 Bacteria 5076
114 Ga0070693_101048760 3300005547 Bacteria 619
115 Ga0070665_100050708 3300005548 Bacteria 4165
116 Ga0068855_100414840 3300005563 Bacteria 1474
117 Ga0070664_100000690 3300005564 Bacteria 25782
118 Ga0070664_100086877 3300005564 Bacteria 2702
119 Ga0070664_100241888 3300005564 Bacteria 1620
120 Ga0068857_100101428 3300005577 Bacteria 2583
121 Ga0068857_100109175 3300005577 Bacteria 2486
122 Ga0068857_100321271 3300005577 Bacteria 1430
123 Ga0068857_100533179 3300005577 Bacteria 1104
124 Ga0068857_101259728 3300005577 Bacteria 717
125 Ga0068857_102256387 3300005577 Unclassified 534
126 Ga0068854_100159807 3300005578 Bacteria 1744
127 Ga0068854_100519361 3300005578 Bacteria 1006
128 Ga0068856_100002544 3300005614 Bacteria 18785
129 Ga0068856_100136829 3300005614 Bacteria 2455
130 Ga0070702_100001607 3300005615 Bacteria 9342
131 Ga0068852_100024929 3300005616 Bacteria 4840
132 Ga0068852_101108374 3300005616 Bacteria 812
133 Ga0068852_101869030 3300005616 Bacteria 623
134 Ga0068859_100333109 3300005617 Bacteria 1612
135 Ga0068859_100385679 3300005617 Bacteria 1497
136 Ga0068864_100014265 3300005618 Bacteria 6599
137 Ga0068864_100101208 3300005618 Bacteria 2555
138 Ga0068864_100162000 3300005618 Bacteria 2034
139 Ga0068864_101588084 3300005618 Bacteria 658
140 Ga0068866_11308658 3300005718 Bacteria 527
141 Ga0068861_100046078 3300005719 Bacteria 3287
142 Ga0068861_100102170 3300005719 Bacteria 2282
143 Ga0068870_10000398 3300005840 Bacteria 16349
144 Ga0068863_100004122 3300005841 Bacteria 14368
145 Ga0068863_100068954 3300005841 Bacteria 3345
146 Ga0068863_100349375 3300005841 Bacteria 1440
147 Ga0068858_100011915 3300005842 Bacteria 8195
148 Ga0068858_100354082 3300005842 Bacteria 1406
149 Ga0068858_100907509 3300005842 Bacteria 862
150 Ga0068860_100089056 3300005843 Bacteria 2938
151 Ga0068860_100424306 3300005843 Bacteria 1319
152 Ga0068862_100044918 3300005844 Bacteria 3769
153 Ga0068862_100718950 3300005844 Bacteria 969
154 Ga0068862_101856935 3300005844 Bacteria 612
155 Ga0081455_10185127 3300005937 Bacteria 1573
156 Ga0081540_1033333 3300005983 Bacteria 2799
157 Ga0075365_10150638 3300006038 Bacteria 1618
158 Ga0075432_10018558 3300006058 Bacteria 2373
159 Ga0070716_100272535 3300006173 Bacteria 1164
160 Ga0070712_100099572 3300006175 Bacteria 2146
161 Ga0075367_11037579 3300006178 Bacteria 524
162 Ga0097621_100020834 3300006237 Bacteria 5059
163 Ga0068871_100057136 3300006358 Bacteria 3174
164 Ga0075428_100000182 3300006844 Bacteria 58871
165 Ga0075428_100048038 3300006844 Bacteria 4685
166 Ga0075428_100204933 3300006844 Bacteria 2132
167 Ga0075428_102202173 3300006844 Bacteria 569
168 Ga0075430_100317226 3300006846 Bacteria 1289
169 Ga0075431_100083893 3300006847 Bacteria 3289
170 Ga0075431_100966354 3300006847 Bacteria 820
171 Ga0075431_101015528 3300006847 Bacteria 796
172 Ga0075431_101717039 3300006847 Bacteria 584
173 Ga0075433_10001267 3300006852 Bacteria 18447
174 Ga0075433_10801766 3300006852 Bacteria 823
175 Ga0075433_11269025 3300006852 Bacteria 639
176 Ga0075434_100027893 3300006871 Bacteria 5543
177 Ga0075434_102570325 3300006871 Bacteria 510
178 Ga0075429_100049388 3300006880 Bacteria 3658
179 Ga0075429_100241139 3300006880 Bacteria 1583
180 Ga0075429_100356979 3300006880 Bacteria 1280
181 Ga0075429_100519882 3300006880 Bacteria 1043
182 Ga0068865_100220713 3300006881 Bacteria 1482
183 Ga0068865_100346074 3300006881 Bacteria 1203
184 Ga0075436_100031906 3300006914 Bacteria 3629
185 Ga0097620_100333145 3300006931 Bacteria 1612
186 Ga0097620_100385658 3300006931 Bacteria 1497
187 Ga0075435_100149566 3300007076 Bacteria 1962
188 Ga0105251_10009517 3300009011 Bacteria 5730
189 Ga0105244_10137102 3300009036 Bacteria 1179
190 Ga0105240_10210368 3300009093 Bacteria 2273
191 Ga0111539_10009710 3300009094 Bacteria 12145
192 Ga0111539_10057516 3300009094 Bacteria 4618
193 Ga0111539_10794641 3300009094 Bacteria 1101
194 Ga0111539_10807059 3300009094 Bacteria 1092
195 Ga0105245_10007354 3300009098 Bacteria 9643
196 Ga0105245_10049551 3300009098 Bacteria 3762
197 Ga0105245_12566034 3300009098 Bacteria 563
198 Ga0105247_10056427 3300009101 Bacteria 2425
199 Ga0114129_10029013 3300009147 Bacteria 7837
200 Ga0114129_10172664 3300009147 Bacteria 2946
201 Ga0114129_10403857 3300009147 Bacteria 1800
202 Ga0114129_10606568 3300009147 Bacteria 1418
203 Ga0114129_11283213 3300009147 Bacteria 908
204 Ga0114129_12315031 3300009147 Bacteria 645
205 Ga0105243_10047873 3300009148 Bacteria 3368
206 Ga0105243_11119963 3300009148 Bacteria 796
207 Ga0105243_12158859 3300009148 Bacteria 593
208 Ga0105241_10038274 3300009174 Bacteria 3615
209 Ga0105241_10255123 3300009174 Bacteria 1488
210 Ga0105241_10620006 3300009174 Bacteria 979
211 Ga0105242_10523922 3300009176 Bacteria 1131
212 Ga0105242_11351181 3300009176 Bacteria 738
213 Ga0105248_10173700 3300009177 Bacteria 2429
214 Ga0105248_13394863 3300009177 Bacteria 506
215 Ga0105237_10170077 3300009545 Bacteria 2179
216 Ga0105237_10330358 3300009545 Bacteria 1529
217 Ga0105237_10535854 3300009545 Bacteria 1177
218 Ga0105238_10053895 3300009551 Bacteria 4041
219 Ga0105238_10813264 3300009551 Bacteria 950
220 Ga0105238_11134663 3300009551 Bacteria 805
221 Ga0105238_11935938 3300009551 Bacteria 623
222 Ga0105249_10045189 3300009553 Bacteria 4005
223 Ga0105249_10164646 3300009553 Bacteria 2146
224 Ga0105249_10224343 3300009553 Bacteria 1851
225 Ga0105249_10643457 3300009553 Bacteria 1118
226 Ga0105239_10042350 3300010375 Bacteria 4990
227 Ga0105239_10047187 3300010375 Bacteria 4720
228 Ga0105239_10216047 3300010375 Bacteria 2150
229 Ga0105246_10001558 3300011119 Bacteria 13631
230 Ga0105246_12520294 3300011119 Bacteria 507
231 Ga0154019_129167 3300013044 Bacteria 1145
232 Ga0154010_153672 3300013062 Bacteria 764
233 Ga0157373_10059871 3300013100 Bacteria 2698
234 Ga0157371_10010033 3300013102 Bacteria 7406
235 Ga0157370_10290396 3300013104 Bacteria 1510
236 Ga0157369_10490442 3300013105 Bacteria 1271
237 Ga0157369_10769761 3300013105 Bacteria 990
238 Ga0157374_10026833 3300013296 Bacteria 5187
239 Ga0157374_11800245 3300013296 Bacteria 638
240 Ga0157378_10535169 3300013297 Bacteria 1175
241 Ga0157378_11300763 3300013297 Bacteria 768
242 Ga0163162_10620883 3300013306 Bacteria 1206
243 Ga0163162_11960990 3300013306 Bacteria 671
244 Ga0157372_10392986 3300013307 Bacteria 1616
245 Ga0157375_10182075 3300013308 Bacteria 2253
246 Ga0163163_10412540 3300014325 Bacteria 1409
247 Ga0163163_10419522 3300014325 Bacteria 1397
248 Ga0163163_11819650 3300014325 Bacteria 669
249 Ga0163163_12192914 3300014325 Bacteria 612
250 Ga0157380_10707333 3300014326 Bacteria 1013
251 Ga0157380_13318085 3300014326 Bacteria 515
252 Ga0182008_10055864 3300014497 Bacteria 1952
253 Ga0157377_10019775 3300014745 Bacteria 3521
254 Ga0157377_10022949 3300014745 Bacteria 3301
255 Ga0157377_10599468 3300014745 Bacteria 785
256 Ga0157377_11422890 3300014745 Bacteria 548
257 Ga0157379_10033665 3300014968 Bacteria 4569
258 Ga0157379_10137330 3300014968 Bacteria 2203
259 Ga0157379_10554677 3300014968 Bacteria 1069
260 Ga0157376_10040153 3300014969 Bacteria 3823
261 Ga0157376_10480737 3300014969 Bacteria 1217
262 Ga0163161_10634386 3300017792 Bacteria 884
263 Ga0197907_10890035 3300020069 Bacteria 1473
264 Ga0197907_11016600 3300020069 Bacteria 754
265 Ga0206356_10889166 3300020070 Bacteria 1583
266 Ga0206356_11432754 3300020070 Bacteria 1537
267 Ga0206349_1095474 3300020075 Bacteria 1403
268 Ga0206349_1740722 3300020075 Bacteria 1628
269 Ga0206355_1355011 3300020076 Bacteria 629
270 Ga0206351_10308496 3300020077 Bacteria 1691
271 Ga0206351_10485341 3300020077 Bacteria 1360
272 Ga0206352_10121977 3300020078 Bacteria 1415
273 Ga0206352_10284584 3300020078 Bacteria 674
274 Ga0206350_10182640 3300020080 Bacteria 651
275 Ga0206350_10199377 3300020080 Bacteria 1391
276 Ga0206354_10245380 3300020081 Bacteria 1997
277 Ga0206354_10357178 3300020081 Bacteria 1707
278 Ga0206354_10790405 3300020081 Bacteria 1683
279 Ga0206353_11417608 3300020082 Bacteria 1222
280 Ga0154015_1264589 3300020610 Bacteria 1358
281 Ga0154015_1376280 3300020610 Bacteria 897
282 Ga0154015_1646162 3300020610 Bacteria 665
283 Ga0213876_10742456 3300021384 Bacteria 522
284 Ga0213875_10284505 3300021388 Bacteria 781
285 Ga0224712_10063749 3300022467 Bacteria 1476
286 Ga0224712_10400556 3300022467 Bacteria 654
287 Ga0207426_1008130 3300025302 Bacteria 4286
288 Ga0207426_1011991 3300025302 Bacteria 3275
289 Ga0207713_1040095 3300025735 Bacteria 1969
290 Ga0207642_11109052 3300025899 Bacteria 512
291 Ga0207710_10138624 3300025900 Bacteria 1173
292 Ga0207688_10009899 3300025901 Bacteria 5190
293 Ga0207688_10088217 3300025901 Bacteria 1779
294 Ga0207688_10179190 3300025901 Bacteria 1263
295 Ga0207680_10100006 3300025903 Bacteria 1861
296 Ga0207647_10063599 3300025904 Bacteria 2244
297 Ga0207699_10320428 3300025906 Bacteria 1087
298 Ga0207645_10169000 3300025907 Bacteria 1432
299 Ga0207643_10000829 3300025908 Bacteria 18766
300 Ga0207643_10088314 3300025908 Bacteria 1804
301 Ga0207705_10009805 3300025909 Bacteria 6971
302 Ga0207654_10054785 3300025911 Bacteria 2306
303 Ga0207707_10330919 3300025912 Bacteria 1314
304 Ga0207695_10200993 3300025913 Bacteria 1907
305 Ga0207671_10104428 3300025914 Bacteria 2149
306 Ga0207671_10302606 3300025914 Bacteria 1263
307 Ga0207693_10105668 3300025915 Bacteria 2208
308 Ga0207663_10012134 3300025916 Bacteria 4648
309 Ga0207660_10074004 3300025917 Bacteria 2485
310 Ga0207662_10055771 3300025918 Bacteria 2358
311 Ga0207662_10139838 3300025918 Bacteria 1533
312 Ga0207662_10890282 3300025918 Bacteria 630
313 Ga0207657_10012901 3300025919 Bacteria 8217
314 Ga0207657_10235462 3300025919 Bacteria 1463
315 Ga0207657_10286186 3300025919 Bacteria 1308
316 Ga0207649_10020772 3300025920 Bacteria 3770
317 Ga0207649_10379938 3300025920 Bacteria 1053
318 Ga0207649_10446554 3300025920 Bacteria 975
319 Ga0207652_10036582 3300025921 Bacteria 4150
320 Ga0207652_10126186 3300025921 Bacteria 2280
321 Ga0207681_10268712 3300025923 Bacteria 1338
322 Ga0207681_10979925 3300025923 Bacteria 709
323 Ga0207694_10663830 3300025924 Bacteria 879
324 Ga0207694_10776213 3300025924 Bacteria 809
325 Ga0207694_11392500 3300025924 Bacteria 593
326 Ga0207650_10006119 3300025925 Bacteria 8199
327 Ga0207650_10402673 3300025925 Bacteria 1133
328 Ga0207659_10004453 3300025926 Bacteria 8479
329 Ga0207659_10008161 3300025926 Bacteria 6482
330 Ga0207687_10009481 3300025927 Bacteria 6366
331 Ga0207687_10014662 3300025927 Bacteria 5132
332 Ga0207700_10021793 3300025928 Bacteria 4382
333 Ga0207644_10058628 3300025931 Bacteria 2783
334 Ga0207644_10885715 3300025931 Bacteria 748
335 Ga0207690_10428755 3300025932 Bacteria 1059
336 Ga0207690_10923001 3300025932 Bacteria 725
337 Ga0207706_10015936 3300025933 Bacteria 6793
338 Ga0207706_10045943 3300025933 Bacteria 3867
339 Ga0207706_10459716 3300025933 Bacteria 1100
340 Ga0207686_11218794 3300025934 Bacteria 616
341 Ga0207709_10185818 3300025935 Bacteria 1472
342 Ga0207670_10150336 3300025936 Bacteria 1727
343 Ga0207670_11810693 3300025936 Bacteria 519
344 Ga0207704_10243456 3300025938 Bacteria 1345
345 Ga0207704_10968048 3300025938 Bacteria 718
346 Ga0207665_11096061 3300025939 Bacteria 635
347 Ga0207691_10014578 3300025940 Bacteria 7492
348 Ga0207711_10196148 3300025941 Bacteria 1841
349 Ga0207711_12102920 3300025941 Bacteria 507
350 Ga0207689_10004110 3300025942 Bacteria 13237
351 Ga0207689_10465654 3300025942 Bacteria 1057
352 Ga0207661_10004749 3300025944 Bacteria 9516
353 Ga0207661_10004995 3300025944 Bacteria 9300
354 Ga0207661_10084137 3300025944 Bacteria 2634
355 Ga0207661_10666640 3300025944 Bacteria 956
356 Ga0207679_10019570 3300025945 Bacteria 4550
357 Ga0207679_10048271 3300025945 Bacteria 3098
358 Ga0207679_10218531 3300025945 Bacteria 1602
359 Ga0207679_10569270 3300025945 Bacteria 1018
360 Ga0207667_10445673 3300025949 Bacteria 1316
361 Ga0207651_10163528 3300025960 Bacteria 1747
362 Ga0207712_10115014 3300025961 Bacteria 2025
363 Ga0207712_10203610 3300025961 Bacteria 1571
364 Ga0207668_10212052 3300025972 Bacteria 1550
365 Ga0207668_10923927 3300025972 Bacteria 777
366 Ga0207640_10216743 3300025981 Bacteria 1462
367 Ga0207658_10716328 3300025986 Bacteria 905
368 Ga0207677_10022459 3300026023 Bacteria 3878
369 Ga0207677_10074383 3300026023 Bacteria 2410
370 Ga0207703_10099149 3300026035 Bacteria 2465
371 Ga0207703_10384895 3300026035 Bacteria 1298
372 Ga0207639_10019296 3300026041 Bacteria 4861
373 Ga0207678_10000537 3300026067 Bacteria 34608
374 Ga0207678_10042979 3300026067 Bacteria 3911
375 Ga0207678_10263050 3300026067 Bacteria 1479
376 Ga0207678_11473416 3300026067 Bacteria 601
377 Ga0207708_10004306 3300026075 Bacteria 10479
378 Ga0207708_10010011 3300026075 Bacteria 7041
379 Ga0207708_10309410 3300026075 Bacteria 1287
380 Ga0207702_10015790 3300026078 Bacteria 6253
381 Ga0207702_10053400 3300026078 Bacteria 3421
382 Ga0207641_10014896 3300026088 Bacteria 6375
383 Ga0207641_10256958 3300026088 Bacteria 1634
384 Ga0207648_10048745 3300026089 Bacteria 3708
385 Ga0207648_11609874 3300026089 Bacteria 610
386 Ga0207676_10001429 3300026095 Bacteria 17746
387 Ga0207676_10136758 3300026095 Bacteria 2092
388 Ga0207676_10292713 3300026095 Bacteria 1483
389 Ga0207674_10104397 3300026116 Bacteria 2812
390 Ga0207674_10138753 3300026116 Bacteria 2392
391 Ga0207674_10203011 3300026116 Bacteria 1932
392 Ga0207674_11175391 3300026116 Bacteria 737
393 Ga0207675_100023096 3300026118 Bacteria 5784
394 Ga0207675_100055589 3300026118 Bacteria 3693
395 Ga0207675_102002950 3300026118 Bacteria 597
396 Ga0207683_10005024 3300026121 Bacteria 11362
397 Ga0207683_10189249 3300026121 Bacteria 1868
398 Ga0207698_10016381 3300026142 Bacteria 4993
399 Ga0207698_12187385 3300026142 Bacteria 566
400 Ga0207428_10017467 3300027907 Bacteria 6156
401 Ga0207428_10018395 3300027907 Bacteria 5970
402 Ga0268266_10020837 3300028379 Bacteria 5591
403 Ga0268265_10011922 3300028380 Bacteria 5881
404 Ga0268264_10191897 3300028381 Bacteria 1863
405 Ga0268264_10896059 3300028381 Bacteria 890
406 Ga0307511_10029063 3300030521 Bacteria 5002
407 Ga0316176_1169306 3300030732 Bacteria 792
408 Ga0316183_1078238 3300030742 Bacteria 784
409 Ga0316181_1215123 3300030744 Bacteria 2547
410 Ga0307513_10000001 3300031456 Bacteria 1660464
411 Ga0307408_100015080 3300031548 Bacteria 5143
412 Ga0307408_100236260 3300031548 Bacteria 1500
413 Ga0307508_10019446 3300031616 Bacteria 6173
414 Ga0307516_10231934 3300031730 Bacteria 1549
415 Ga0307405_10006197 3300031731 Bacteria 5861
416 Ga0307405_10489287 3300031731 Bacteria 984
417 Ga0307413_10062430 3300031824 Bacteria 2305
418 Ga0307413_10291321 3300031824 Bacteria 1233
419 Ga0307410_10027735 3300031852 Bacteria 3582
420 Ga0307410_10253570 3300031852 Bacteria 1369
421 Ga0326468_10055121 3300031889 Bacteria 615
422 Ga0307406_10001387 3300031901 Bacteria 13488
423 Ga0307406_10132359 3300031901 Bacteria 1753
424 Ga0307406_11403290 3300031901 Bacteria 612
425 Ga0307406_11460256 3300031901 Bacteria 601
426 Ga0307407_10094597 3300031903 Bacteria 1840
427 Ga0307407_10142451 3300031903 Bacteria 1548
428 Ga0307407_10488321 3300031903 Bacteria 901
429 Ga0307409_100000427 3300031995 Bacteria 17841
430 Ga0307409_100009939 3300031995 Bacteria 5877
431 Ga0307409_100629303 3300031995 Bacteria 1064
432 Ga0307416_100000122 3300032002 Bacteria 46669
433 Ga0307416_100205811 3300032002 Bacteria 1872
434 Ga0307416_100999681 3300032002 Bacteria 939
435 Ga0307416_101956310 3300032002 Bacteria 689
436 Ga0307416_103730249 3300032002 Bacteria 510
437 Ga0307411_10315688 3300032005 Bacteria 1260
438 Ga0307415_100000011 3300032126 Bacteria 84750
439 Ga0307415_100008317 3300032126 Bacteria 5743
440 Ga0307415_100033356 3300032126 Bacteria 3342
441 Ga0307415_100214911 3300032126 Bacteria 1537
442 Ga0307415_101294266 3300032126 Bacteria 690
443 Ga0373940_0354719 3300035088 Bacteria 515
444 Ga0373953_0038209 3300035117 Bacteria 1898
445 Ga0373943_0359239 3300035170 Bacteria 836
446 Ga0373961_0073859 3300035241 Bacteria 1060
447 Ga0373931_0075985 3300035691 Bacteria 1844
448 Ga0373937_0015793 3300036401 Bacteria 6691
449 Ga0373925_0287612 3300037068 Bacteria 1325
450 Ga0395898_0637116 3300037466 Bacteria 1008
451 Ga0395905_0876356 3300037471 Bacteria 801
452 Ga0436364_0014016 3300037853 Bacteria 3517
453 Ga0436365_1200322 3300039437 Bacteria 577
454 Ga0439436_0032479 3300041404 Bacteria 1513
455 Ga0439438_141187 3300041405 Bacteria 576
456 Ga0439439_0001943 3300041406 Bacteria 4279
457 Ga0439466_0015325 3300041411 Bacteria 2785
458 Ga0451793_1229364 3300041452 Bacteria 1101
459 Ga0451800_0386293 3300041459 Bacteria 657
460 Ga0451807_0348738 3300041486 Bacteria 580
461 Ga0451807_1144640 3300041486 Bacteria 541
462 Ga0451833_1410919 3300041491 Bacteria 672
463 Ga0451839_0228385 3300041496 Bacteria 626
464 Ga0451843_0706615 3300041509 Bacteria 791
465 Ga0451853_0287085 3300041512 Bacteria 542
466 Ga0451853_2966803 3300041512 Bacteria 537
467 Ga0439433_0028060 3300041999 Bacteria 1279
468 Ga0439442_044183 3300042002 Bacteria 939
469 Ga0439449_0002649 3300042007 Bacteria 6969
470 Ga0439449_0145072 3300042007 Bacteria 885
471 Ga0439450_016675 3300042008 Bacteria 1522
472 Ga0439455_0009452 3300042012 Bacteria 2117
473 Ga0439457_003005 3300042014 Bacteria 4686
474 Ga0439462_0235512 3300042015 Bacteria 525
475 Ga0439463_005904 3300042016 Bacteria 3040
476 Ga0450902_012516 3300042137 Bacteria 1358
477 Ga0450906_045237 3300042145 Bacteria 777
478 Ga0439459_0008932 3300042438 Bacteria 1724
479 Ga0439460_0256764 3300042461 Bacteria 605
480 Ga0439440_0119617 3300042993 Bacteria 732
481 Ga0495641_0476020 3300046461 Bacteria 569
482 Ga0495663_0124559 3300046525 Bacteria 865
483 Ga0495586_0600117 3300046535 Bacteria 636
484 Ga0495635_0136886 3300046663 Bacteria 1669
485 Ga0495635_0380402 3300046663 Bacteria 939
486 Ga0495647_0186851 3300046681 Bacteria 904
487 Ga0495674_0587904 3300047319 Bacteria 883
488 Ga0495676_0810459 3300047321 Bacteria 602
489 Ga0495680_0763649 3300047322 Bacteria 634
490 Ga0495685_139930 3300047447 Bacteria 789
491 Ga0496100_0090837 3300048903 Bacteria 2083
492 Ga0496101_0038633 3300048904 Bacteria 3391
493 Ga0496102_0159357 3300048905 Bacteria 2122
494 Ga0496103_0174375 3300048906 Bacteria 1381
495 Ga0496104_0004988 3300048907 Bacteria 11586
496 Ga0496105_0003583 3300048908 Bacteria 11527
497 Ga0496106_0039841 3300048909 Bacteria 3518
498 Ga0496107_0127614 3300048910 Bacteria 1876
499 Ga0496108_0013727 3300048911 Bacteria 6609
500 Ga0496109_0044670 3300048912 Bacteria 4019
501 Ga0496109_1402696 3300048912 Bacteria 634
502 Ga0496110_0011897 3300048913 Bacteria 7147
503 Ga0496111_0016588 3300048914 Bacteria 5078
504 Ga0496112_0060270 3300048915 Bacteria 3739
505 Ga0496112_1280497 3300048915 Bacteria 649
506 Ga0496113_0004453 3300048916 Bacteria 8618
507 Ga0496114_0437981 3300048917 Bacteria 1158
508 Ga0501040_0898483 3300049576 Bacteria 642
509 Ga0501048_0388604 3300049582 Bacteria 997
510 Ga0501069_0676059 3300049585 Bacteria 622
511 Ga0501072_0716293 3300049588 Bacteria 786
512 nmdc:mga0yw44_439676_c1 3300050492 Bacteria 884
513 nmdc:mga06z11_124724_c1 3300050494 Bacteria 1440
514 nmdc:mga06z11_922275_c1 3300050494 Bacteria 532
515 nmdc:mga04h51_212679_c1 3300050495 Bacteria 763
516 nmdc:mga05p37_1185110_c1 3300050507 Bacteria 791
517 nmdc:mga05p37_1332361_c1 3300050507 Bacteria 729
518 nmdc:mga05p37_1347784_c1 3300050507 Bacteria 723
519 nmdc:mga05p37_177905_c1 3300050507 Bacteria 2591
520 nmdc:mga05p37_335288_c1 3300050507 Bacteria 1785
521 nmdc:mga09592_119342_c1 3300050508 Bacteria 2264
522 nmdc:mga09592_196479_c1 3300050508 Bacteria 1746
523 nmdc:mga09592_30910_c1 3300050508 Bacteria 4459
524 nmdc:mga09592_321515_c1 3300050508 Bacteria 1340
525 nmdc:mga09592_354690_c1 3300050508 Bacteria 1269
526 nmdc:mga0qj67_135961_c1 3300050509 Bacteria 1992
527 nmdc:mga0qj67_639664_c1 3300050509 Bacteria 849
528 nmdc:mga06r32_102611_c1 3300050510 Bacteria 2808
529 nmdc:mga06r32_1374992_c1 3300050510 Bacteria 648
530 nmdc:mga06r32_1904491_c1 3300050510 Bacteria 529
531 nmdc:mga06r32_47282_c1 3300050510 Bacteria 4109
532 nmdc:mga06r32_953819_c1 3300050510 Bacteria 812
533 nmdc:mga08y16_24750_c1 3300050511 Bacteria 6335
534 nmdc:mga08y16_262814_c1 3300050511 Bacteria 1782
535 nmdc:mga08y16_4311_c1 3300050511 Bacteria 14857
536 nmdc:mga0n895_28274_c1 3300050512 Bacteria 5334
537 nmdc:mga0rr50_14643_c1 3300050513 Bacteria 5151
538 nmdc:mga08x19_69079_c1 3300050514 Bacteria 2301
539 nmdc:mga0a205_59073_c1 3300050515 Bacteria 3705
540 Ga0495601_0227693 3300053077 Bacteria 1218
541 Ga0495595_0233331 3300053084 Bacteria 920
542 Ga0495619_0065824 3300053085 Bacteria 2418
543 Ga0495619_0549099 3300053085 Bacteria 793
544 Ga0500644_0331766 3300053088 Bacteria 655
545 Ga0500646_0296000 3300053090 Bacteria 579
546 Ga0500583_0053284 3300053092 Bacteria 1885
547 Ga0500641_0019150 3300053096 Bacteria 2585
548 Ga0500594_0306509 3300053118 Bacteria 532
549 Ga0500588_0001778 3300053146 Bacteria 4195
550 Ga0500633_0033521 3300053160 Bacteria 1676
551 Ga0501084_1427531 3300054114 Bacteria 580
552 Ga0587084_062644 3300059477 Bacteria 685
553 Ga0587093_030920 3300059478 Bacteria 770
554 Ga0587066_056272 3300059490 Bacteria 790
555 Ga0587070_022496 3300059491 Bacteria 1074
556 Ga0587077_047432 3300059493 Bacteria 886
557 Ga0587080_036047 3300059503 Bacteria 883
558 Ga0587082_033175 3300059504 Bacteria 911
559 Ga0587083_0087287 3300059505 Bacteria 754
560 Ga0587083_0110316 3300059505 Bacteria 698
561 Ga0587085_032436 3300059506 Bacteria 867
562 Ga0587086_023465 3300059507 Bacteria 860
563 Ga0587088_020662 3300059508 Bacteria 1094
564 Ga0587091_068752 3300059511 Bacteria 770
565 Ga0587091_075996 3300059511 Bacteria 744
566 Ga0587092_029478 3300059512 Bacteria 899
567 Ga0587092_106995 3300059512 Bacteria 583
568 Ga0587094_022270 3300059513 Bacteria 929
569 Ga0587095_022033 3300059514 Bacteria 618
570 Ga0587106_041245 3300059605 Bacteria 784
571 Ga0587125_041881 3300059607 Bacteria 621
572 Ga0587129_019024 3300059608 Bacteria 597
573 Ga0587099_026618 3300059622 Bacteria 683
574 Ga0587101_150085 3300059623 Bacteria 504
575 Ga0587109_064437 3300059624 Bacteria 779
576 Ga0587113_029707 3300059625 Bacteria 615
577 Ga0587115_027984 3300059626 Bacteria 823
578 Ga0587122_013518 3300059628 Bacteria 812
579 Ga0587127_005001 3300059629 Bacteria 899
580 Ga0587128_062444 3300059630 Bacteria 707
581 Ga0587062_079760 3300059639 Bacteria 606
582 Ga0587067_045105 3300059640 Bacteria 871
583 Ga0587067_191296 3300059640 Bacteria 539
584 Ga0587068_048223 3300059641 Bacteria 790
585 Ga0587069_068879 3300059642 Bacteria 668
586 Ga0587075_027885 3300059644 Bacteria 882
587 Ga0587075_140480 3300059644 Bacteria 515
588 Ga0587076_041161 3300059645 Bacteria 864
589 Ga0587078_016868 3300059646 Bacteria 893
590 Ga0587078_028657 3300059646 Bacteria 741
591 Ga0587079_059945 3300059647 Bacteria 822
592 Ga0587100_009137 3300059648 Bacteria 814
593 Ga0587102_016841 3300059649 Bacteria 790
594 Ga0587105_011794 3300059651 Bacteria 679
595 Ga0587107_028288 3300059652 Bacteria 836
596 Ga0587114_027619 3300059655 Bacteria 847
597 Ga0587116_11448 3300059656 Bacteria 605
598 Ga0587119_019641 3300059658 Bacteria 853
599 Ga0587071_044510 3300060344 Bacteria 900
600 Ga0587111_0049893 3300060346 Bacteria 920
601 Ga0501082_0811847 3300060353 Bacteria 818
602 Ga0501082_1178175 3300060353 Bacteria 670
603 Ga0530510_0116045 3300061734 Bacteria 1963

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100279202 Ga0070674_1002792022 78
2 3300009148 Ga0105243_11119963 Ga0105243_111199632 78
3 3300026089 Ga0207648_11609874 Ga0207648_116098742 78
4 3300031852 Ga0307410_10253570 Ga0307410_102535702 78
5 3300031901 Ga0307406_11403290 Ga0307406_114032901 78
6 3300032002 Ga0307416_101956310 Ga0307416_1019563102 78
7 3300032126 Ga0307415_101294266 Ga0307415_1012942662 78
8 3300041459 Ga0451800_0386293 Ga0451800_0386293_11_295 78
9 3300041496 Ga0451839_0228385 Ga0451839_0228385_160_444 78
10 3300031731 Ga0307405_10489287 Ga0307405_104892871 79
11 3300041512 Ga0451853_0287085 Ga0451853_0287085_107_391 79
12 3300041452 Ga0451793_1229364 Ga0451793_1229364_556_840 81
13 3300041486 Ga0451807_1144640 Ga0451807_1144640_26_310 81
14 3300041491 Ga0451833_1410919 Ga0451833_1410919_225_509 81
15 3300041509 Ga0451843_0706615 Ga0451843_0706615_333_617 81
16 3300004801 Ga0058860_10026024 Ga0058860_100260241 82
17 3300006844 Ga0075428_102202173 Ga0075428_1022021732 82
18 3300046525 Ga0495663_0124559 Ga0495663_0124559_273_551 83
19 3300047447 Ga0495685_139930 Ga0495685_139930_453_731 83
20 3300050495 nmdc:mga04h51_212679_c1 nmdc:mga04h51_212679_c1_31_336 83
21 3300050507 nmdc:mga05p37_1332361_c1 nmdc:mga05p37_1332361_c1_94_402 83
22 3300059512 Ga0587092_106995 Ga0587092_106995_170_487 83
23 3300059646 Ga0587078_028657 Ga0587078_028657_182_490 83
24 3300003575 Ga0007409J51694_1045481 Ga0007409J51694_10454811 84
25 3300003693 Ga0032354_1110810 Ga0032354_11108101 84
26 3300005334 Ga0068869_101454434 Ga0068869_1014544341 84
27 3300061734 Ga0530510_0116045 Ga0530510_0116045_1438_1743 85
28 3300014325 Ga0163163_12192914 Ga0163163_121929141 86
29 3300005441 Ga0070700_100656531 Ga0070700_1006565311 87
30 3300026075 Ga0207708_10309410 Ga0207708_103094102 87
31 3300031903 Ga0307407_10488321 Ga0307407_104883212 87
32 3300032126 Ga0307415_100214911 Ga0307415_1002149112 87
33 3300006846 Ga0075430_100317226 Ga0075430_1003172262 88
34 3300006880 Ga0075429_100241139 Ga0075429_1002411392 88
35 3300009094 Ga0111539_10807059 Ga0111539_108070592 88
36 3300009147 Ga0114129_10403857 Ga0114129_104038572 88
37 3300050507 nmdc:mga05p37_1185110_c1 nmdc:mga05p37_1185110_c1_84_392 88
38 3300050508 nmdc:mga09592_196479_c1 nmdc:mga09592_196479_c1_1107_1415 88
39 3300050511 nmdc:mga08y16_262814_c1 nmdc:mga08y16_262814_c1_322_630 88
40 3300025899 Ga0207642_11109052 Ga0207642_111090522 89
41 3300009036 Ga0105244_10137102 Ga0105244_101371022 90
42 3300009093 Ga0105240_10210368 Ga0105240_102103683 90
43 3300009094 Ga0111539_10057516 Ga0111539_100575164 90
44 3300009147 Ga0114129_11283213 Ga0114129_112832131 90
45 3300009148 Ga0105243_10047873 Ga0105243_100478735 90
46 3300009174 Ga0105241_10038274 Ga0105241_100382743 90
47 3300009176 Ga0105242_10523922 Ga0105242_105239222 90
48 3300009177 Ga0105248_10173700 Ga0105248_101737003 90
49 3300009551 Ga0105238_10053895 Ga0105238_100538953 90
50 3300009553 Ga0105249_10164646 Ga0105249_101646462 90
51 3300011119 Ga0105246_10001558 Ga0105246_100015584 90
52 3300013062 Ga0154010_153672 Ga0154010_1536722 90
53 3300013102 Ga0157371_10010033 Ga0157371_100100332 90
54 3300013105 Ga0157369_10490442 Ga0157369_104904422 90
55 3300013296 Ga0157374_10026833 Ga0157374_100268333 90
56 3300013297 Ga0157378_11300763 Ga0157378_113007632 90
57 3300013306 Ga0163162_11960990 Ga0163162_119609902 90
58 3300013307 Ga0157372_10392986 Ga0157372_103929862 90
59 3300014325 Ga0163163_10419522 Ga0163163_104195223 90
60 3300014326 Ga0157380_10707333 Ga0157380_107073332 90
61 3300014497 Ga0182008_10055864 Ga0182008_100558642 90
62 3300014745 Ga0157377_10019775 Ga0157377_100197753 90
63 3300035241 Ga0373961_0073859 Ga0373961_0073859_373_645 90
64 3300035691 Ga0373931_0075985 Ga0373931_0075985_1088_1360 90
65 3300037068 Ga0373925_0287612 Ga0373925_0287612_1020_1292 90
66 3300037466 Ga0395898_0637116 Ga0395898_0637116_289_561 90
67 3300041512 Ga0451853_2966803 Ga0451853_2966803_176_448 90
68 3300042008 Ga0439450_016675 Ga0439450_016675_242_514 90
69 3300042137 Ga0450902_012516 Ga0450902_012516_1000_1272 90
70 3300042438 Ga0439459_0008932 Ga0439459_0008932_1385_1657 90
71 3300046681 Ga0495647_0186851 Ga0495647_0186851_130_402 90
72 3300047321 Ga0495676_0810459 Ga0495676_0810459_207_479 90
73 3300048903 Ga0496100_0090837 Ga0496100_0090837_596_868 90
74 3300048904 Ga0496101_0038633 Ga0496101_0038633_1776_2048 90
75 3300048905 Ga0496102_0159357 Ga0496102_0159357_431_703 90
76 3300048906 Ga0496103_0174375 Ga0496103_0174375_914_1186 90
77 3300048907 Ga0496104_0004988 Ga0496104_0004988_1546_1818 90
78 3300048908 Ga0496105_0003583 Ga0496105_0003583_2667_2939 90
79 3300048909 Ga0496106_0039841 Ga0496106_0039841_1459_1731 90
80 3300048910 Ga0496107_0127614 Ga0496107_0127614_61_333 90
81 3300048911 Ga0496108_0013727 Ga0496108_0013727_4961_5233 90
82 3300048912 Ga0496109_0044670 Ga0496109_0044670_1010_1282 90
83 3300048913 Ga0496110_0011897 Ga0496110_0011897_2528_2800 90
84 3300048914 Ga0496111_0016588 Ga0496111_0016588_1461_1733 90
85 3300048915 Ga0496112_0060270 Ga0496112_0060270_122_394 90
86 3300048916 Ga0496113_0004453 Ga0496113_0004453_2738_3010 90
87 3300048917 Ga0496114_0437981 Ga0496114_0437981_754_1026 90
88 3300049585 Ga0501069_0676059 Ga0501069_0676059_117_389 90
89 3300050507 nmdc:mga05p37_335288_c1 nmdc:mga05p37_335288_c1_699_971 90
90 3300050508 nmdc:mga09592_119342_c1 nmdc:mga09592_119342_c1_1863_2135 90
91 3300050509 nmdc:mga0qj67_639664_c1 nmdc:mga0qj67_639664_c1_242_514 90
92 3300050510 nmdc:mga06r32_102611_c1 nmdc:mga06r32_102611_c1_780_1052 90
93 3300050510 nmdc:mga06r32_1904491_c1 nmdc:mga06r32_1904491_c1_143_445 90
94 3300050511 nmdc:mga08y16_24750_c1 nmdc:mga08y16_24750_c1_2705_2977 90
95 3300050512 nmdc:mga0n895_28274_c1 nmdc:mga0n895_28274_c1_1377_1649 90
96 3300050513 nmdc:mga0rr50_14643_c1 nmdc:mga0rr50_14643_c1_882_1154 90
97 3300050514 nmdc:mga08x19_69079_c1 nmdc:mga08x19_69079_c1_1166_1438 90
98 3300050515 nmdc:mga0a205_59073_c1 nmdc:mga0a205_59073_c1_1727_1999 90
99 iso_pu_bacteria 2643221694 2644526606 90
100 iso_pu_bacteria 2643221722 2644671272 90
101 3300025941 Ga0207711_12102920 Ga0207711_121029202 91
102 3300032002 Ga0307416_100999681 Ga0307416_1009996812 91
103 3300013105 Ga0157369_10769761 Ga0157369_107697612 92
104 3300020081 Ga0206354_10790405 Ga0206354_107904051 92
105 3300013296 Ga0157374_11800245 Ga0157374_118002452 93
106 3300042016 Ga0439463_005904 Ga0439463_005904_1239_1520 93
107 3300053088 Ga0500644_0331766 Ga0500644_0331766_96_380 93
108 iso_pu_bacteria 2515154155 2515850834 93
109 iso_pu_bacteria 2675903058 2676476809 93
110 iso_pu_bacteria 2827628540 2827630101 93
111 3300009147 Ga0114129_10172664 Ga0114129_101726644 94
112 3300005577 Ga0068857_101259728 Ga0068857_1012597282 95
113 3300005617 Ga0068859_100333109 Ga0068859_1003331092 95
114 3300006847 Ga0075431_101717039 Ga0075431_1017170391 95
115 3300006852 Ga0075433_10801766 Ga0075433_108017662 95
116 3300006871 Ga0075434_102570325 Ga0075434_1025703251 95
117 3300006931 Ga0097620_100333145 Ga0097620_1003331452 95
118 3300009094 Ga0111539_10794641 Ga0111539_107946411 95
119 3300009553 Ga0105249_10224343 Ga0105249_102243433 95
120 3300050509 nmdc:mga0qj67_135961_c1 nmdc:mga0qj67_135961_c1_671_964 95
121 3300050510 nmdc:mga06r32_47282_c1 nmdc:mga06r32_47282_c1_2658_2948 95
122 3300001991 JGI24743J22301_10025346 JGI24743J22301_100253462 96
123 3300002073 JGI24745J21846_1015638 JGI24745J21846_10156382 96
124 3300002155 JGI24033J26618_1012900 JGI24033J26618_10129002 96
125 3300002459 JGI24751J29686_10007576 JGI24751J29686_100075763 96
126 3300003693 Ga0032354_1074863 Ga0032354_10748631 96
127 3300004798 Ga0058859_11373918 Ga0058859_113739182 96
128 3300004799 Ga0058863_11972618 Ga0058863_119726182 96
129 3300004800 Ga0058861_12063929 Ga0058861_120639292 96
130 3300004800 Ga0058861_12067567 Ga0058861_120675672 96
131 3300004801 Ga0058860_11635538 Ga0058860_116355382 96
132 3300004803 Ga0058862_12888595 Ga0058862_128885952 96
133 3300005327 Ga0070658_10131350 Ga0070658_101313504 96
134 3300005328 Ga0070676_10378285 Ga0070676_103782851 96
135 3300005329 Ga0070683_100066754 Ga0070683_1000667544 96
136 3300005329 Ga0070683_100322614 Ga0070683_1003226142 96
137 3300005330 Ga0070690_100047860 Ga0070690_1000478603 96
138 3300005331 Ga0070670_100055930 Ga0070670_1000559302 96
139 3300005334 Ga0068869_100005028 Ga0068869_1000050282 96
140 3300005335 Ga0070666_10073850 Ga0070666_100738503 96
141 3300005336 Ga0070680_100007324 Ga0070680_1000073245 96
142 3300005337 Ga0070682_100006130 Ga0070682_1000061306 96
143 3300005337 Ga0070682_101344187 Ga0070682_1013441872 96
144 3300005338 Ga0068868_100034447 Ga0068868_1000344475 96
145 3300005339 Ga0070660_100069503 Ga0070660_1000695034 96
146 3300005340 Ga0070689_100027775 Ga0070689_1000277753 96
147 3300005341 Ga0070691_10001280 Ga0070691_100012804 96
148 3300005343 Ga0070687_100055004 Ga0070687_1000550043 96
149 3300005344 Ga0070661_100129772 Ga0070661_1001297722 96
150 3300005345 Ga0070692_10042533 Ga0070692_100425334 96
151 3300005347 Ga0070668_100251629 Ga0070668_1002516292 96
152 3300005353 Ga0070669_100369001 Ga0070669_1003690012 96
153 3300005354 Ga0070675_100084219 Ga0070675_1000842193 96
154 3300005355 Ga0070671_100034998 Ga0070671_1000349984 96
155 3300005364 Ga0070673_100102151 Ga0070673_1001021513 96
156 3300005365 Ga0070688_100127502 Ga0070688_1001275022 96
157 3300005366 Ga0070659_100032754 Ga0070659_1000327544 96
158 3300005366 Ga0070659_101269643 Ga0070659_1012696431 96
159 3300005367 Ga0070667_100209129 Ga0070667_1002091292 96
160 3300005406 Ga0070703_10469316 Ga0070703_104693162 96
161 3300005434 Ga0070709_10012683 Ga0070709_100126834 96
162 3300005435 Ga0070714_100021156 Ga0070714_1000211563 96
163 3300005436 Ga0070713_100020612 Ga0070713_1000206125 96
164 3300005437 Ga0070710_10064268 Ga0070710_100642682 96
165 3300005439 Ga0070711_100045757 Ga0070711_1000457575 96
166 3300005441 Ga0070700_100016103 Ga0070700_1000161032 96
167 3300005444 Ga0070694_100541311 Ga0070694_1005413112 96
168 3300005455 Ga0070663_100009250 Ga0070663_1000092504 96
169 3300005455 Ga0070663_101355465 Ga0070663_1013554651 96
170 3300005456 Ga0070678_100015294 Ga0070678_1000152945 96
171 3300005457 Ga0070662_100059912 Ga0070662_1000599122 96
172 3300005458 Ga0070681_10029986 Ga0070681_100299866 96
173 3300005459 Ga0068867_100099277 Ga0068867_1000992773 96
174 3300005466 Ga0070685_10054517 Ga0070685_100545174 96
175 3300005530 Ga0070679_100026996 Ga0070679_1000269964 96
176 3300005535 Ga0070684_101412545 Ga0070684_1014125451 96
177 3300005535 Ga0070684_101812912 Ga0070684_1018129121 96
178 3300005539 Ga0068853_100020817 Ga0068853_1000208173 96
179 3300005543 Ga0070672_100074450 Ga0070672_1000744502 96
180 3300005544 Ga0070686_100143278 Ga0070686_1001432782 96
181 3300005545 Ga0070695_100048619 Ga0070695_1000486194 96
182 3300005547 Ga0070693_100008461 Ga0070693_1000084613 96
183 3300005548 Ga0070665_100050708 Ga0070665_1000507084 96
184 3300005563 Ga0068855_100414840 Ga0068855_1004148402 96
185 3300005564 Ga0070664_100086877 Ga0070664_1000868773 96
186 3300005577 Ga0068857_100533179 Ga0068857_1005331792 96
187 3300005577 Ga0068857_102256387 Ga0068857_1022563872 96
188 3300005578 Ga0068854_100519361 Ga0068854_1005193612 96
189 3300005614 Ga0068856_100002544 Ga0068856_1000025444 96
190 3300005614 Ga0068856_100136829 Ga0068856_1001368292 96
191 3300005615 Ga0070702_100001607 Ga0070702_1000016078 96
192 3300005616 Ga0068852_100024929 Ga0068852_1000249295 96
193 3300005617 Ga0068859_100385679 Ga0068859_1003856792 96
194 3300005618 Ga0068864_100014265 Ga0068864_1000142653 96
195 3300005618 Ga0068864_101588084 Ga0068864_1015880842 96
196 3300005718 Ga0068866_11308658 Ga0068866_113086582 96
197 3300005719 Ga0068861_100046078 Ga0068861_1000460784 96
198 3300005840 Ga0068870_10000398 Ga0068870_1000039810 96
199 3300005841 Ga0068863_100004122 Ga0068863_1000041223 96
200 3300005842 Ga0068858_100011915 Ga0068858_1000119155 96
201 3300005843 Ga0068860_100089056 Ga0068860_1000890563 96
202 3300005844 Ga0068862_100718950 Ga0068862_1007189502 96
203 3300005937 Ga0081455_10185127 Ga0081455_101851273 96
204 3300005983 Ga0081540_1033333 Ga0081540_10333333 96
205 3300006038 Ga0075365_10150638 Ga0075365_101506382 96
206 3300006058 Ga0075432_10018558 Ga0075432_100185583 96
207 3300006173 Ga0070716_100272535 Ga0070716_1002725352 96
208 3300006175 Ga0070712_100099572 Ga0070712_1000995722 96
209 3300006178 Ga0075367_11037579 Ga0075367_110375792 96
210 3300006237 Ga0097621_100020834 Ga0097621_1000208344 96
211 3300006358 Ga0068871_100057136 Ga0068871_1000571364 96
212 3300006844 Ga0075428_100000182 Ga0075428_1000001822 96
213 3300006844 Ga0075428_100048038 Ga0075428_1000480382 96
214 3300006847 Ga0075431_100083893 Ga0075431_1000838933 96
215 3300006852 Ga0075433_10001267 Ga0075433_100012677 96
216 3300006871 Ga0075434_100027893 Ga0075434_1000278936 96
217 3300006880 Ga0075429_100519882 Ga0075429_1005198822 96
218 3300006881 Ga0068865_100220713 Ga0068865_1002207133 96
219 3300006914 Ga0075436_100031906 Ga0075436_1000319064 96
220 3300006931 Ga0097620_100385658 Ga0097620_1003856582 96
221 3300007076 Ga0075435_100149566 Ga0075435_1001495663 96
222 3300009011 Ga0105251_10009517 Ga0105251_100095176 96
223 3300009098 Ga0105245_10049551 Ga0105245_100495513 96
224 3300009098 Ga0105245_12566034 Ga0105245_125660341 96
225 3300009101 Ga0105247_10056427 Ga0105247_100564273 96
226 3300009148 Ga0105243_12158859 Ga0105243_121588591 96
227 3300009174 Ga0105241_10255123 Ga0105241_102551233 96
228 3300009176 Ga0105242_11351181 Ga0105242_113511811 96
229 3300009545 Ga0105237_10170077 Ga0105237_101700773 96
230 3300009545 Ga0105237_10535854 Ga0105237_105358542 96
231 3300009551 Ga0105238_10813264 Ga0105238_108132642 96
232 3300009551 Ga0105238_11134663 Ga0105238_111346632 96
233 3300009551 Ga0105238_11935938 Ga0105238_119359382 96
234 3300010375 Ga0105239_10042350 Ga0105239_100423507 96
235 3300010375 Ga0105239_10047187 Ga0105239_100471874 96
236 3300013044 Ga0154019_129167 Ga0154019_1291672 96
237 3300013100 Ga0157373_10059871 Ga0157373_100598713 96
238 3300013104 Ga0157370_10290396 Ga0157370_102903962 96
239 3300013308 Ga0157375_10182075 Ga0157375_101820754 96
240 3300014968 Ga0157379_10033665 Ga0157379_100336653 96
241 3300014968 Ga0157379_10554677 Ga0157379_105546772 96
242 3300014969 Ga0157376_10040153 Ga0157376_100401533 96
243 3300017792 Ga0163161_10634386 Ga0163161_106343862 96
244 3300020069 Ga0197907_10890035 Ga0197907_108900352 96
245 3300020069 Ga0197907_11016600 Ga0197907_110166002 96
246 3300020070 Ga0206356_10889166 Ga0206356_108891662 96
247 3300020070 Ga0206356_11432754 Ga0206356_114327542 96
248 3300020075 Ga0206349_1095474 Ga0206349_10954742 96
249 3300020075 Ga0206349_1740722 Ga0206349_17407223 96
250 3300020076 Ga0206355_1355011 Ga0206355_13550112 96
251 3300020077 Ga0206351_10308496 Ga0206351_103084962 96
252 3300020077 Ga0206351_10485341 Ga0206351_104853412 96
253 3300020078 Ga0206352_10121977 Ga0206352_101219772 96
254 3300020080 Ga0206350_10182640 Ga0206350_101826402 96
255 3300020080 Ga0206350_10199377 Ga0206350_101993772 96
256 3300020081 Ga0206354_10245380 Ga0206354_102453803 96
257 3300020081 Ga0206354_10357178 Ga0206354_103571782 96
258 3300020082 Ga0206353_11417608 Ga0206353_114176082 96
259 3300020610 Ga0154015_1264589 Ga0154015_12645892 96
260 3300020610 Ga0154015_1376280 Ga0154015_13762802 96
261 3300020610 Ga0154015_1646162 Ga0154015_16461622 96
262 3300021384 Ga0213876_10742456 Ga0213876_107424561 96
263 3300022467 Ga0224712_10063749 Ga0224712_100637492 96
264 3300022467 Ga0224712_10400556 Ga0224712_104005561 96
265 3300025735 Ga0207713_1040095 Ga0207713_10400953 96
266 3300025900 Ga0207710_10138624 Ga0207710_101386242 96
267 3300025901 Ga0207688_10009899 Ga0207688_100098993 96
268 3300025901 Ga0207688_10179190 Ga0207688_101791901 96
269 3300025903 Ga0207680_10100006 Ga0207680_101000062 96
270 3300025904 Ga0207647_10063599 Ga0207647_100635993 96
271 3300025906 Ga0207699_10320428 Ga0207699_103204283 96
272 3300025908 Ga0207643_10000829 Ga0207643_1000082914 96
273 3300025909 Ga0207705_10009805 Ga0207705_100098053 96
274 3300025911 Ga0207654_10054785 Ga0207654_100547853 96
275 3300025912 Ga0207707_10330919 Ga0207707_103309192 96
276 3300025913 Ga0207695_10200993 Ga0207695_102009932 96
277 3300025914 Ga0207671_10104428 Ga0207671_101044283 96
278 3300025915 Ga0207693_10105668 Ga0207693_101056683 96
279 3300025916 Ga0207663_10012134 Ga0207663_100121342 96
280 3300025917 Ga0207660_10074004 Ga0207660_100740042 96
281 3300025918 Ga0207662_10055771 Ga0207662_100557713 96
282 3300025918 Ga0207662_10890282 Ga0207662_108902821 96
283 3300025919 Ga0207657_10012901 Ga0207657_100129014 96
284 3300025919 Ga0207657_10286186 Ga0207657_102861862 96
285 3300025920 Ga0207649_10020772 Ga0207649_100207724 96
286 3300025921 Ga0207652_10036582 Ga0207652_100365825 96
287 3300025921 Ga0207652_10126186 Ga0207652_101261863 96
288 3300025923 Ga0207681_10268712 Ga0207681_102687122 96
289 3300025924 Ga0207694_10663830 Ga0207694_106638302 96
290 3300025924 Ga0207694_10776213 Ga0207694_107762132 96
291 3300025924 Ga0207694_11392500 Ga0207694_113925001 96
292 3300025925 Ga0207650_10006119 Ga0207650_100061196 96
293 3300025926 Ga0207659_10008161 Ga0207659_100081618 96
294 3300025927 Ga0207687_10014662 Ga0207687_100146623 96
295 3300025928 Ga0207700_10021793 Ga0207700_100217934 96
296 3300025931 Ga0207644_10058628 Ga0207644_100586284 96
297 3300025932 Ga0207690_10428755 Ga0207690_104287553 96
298 3300025932 Ga0207690_10923001 Ga0207690_109230012 96
299 3300025933 Ga0207706_10045943 Ga0207706_100459432 96
300 3300025933 Ga0207706_10459716 Ga0207706_104597162 96
301 3300025934 Ga0207686_11218794 Ga0207686_112187941 96
302 3300025935 Ga0207709_10185818 Ga0207709_101858182 96
303 3300025936 Ga0207670_10150336 Ga0207670_101503363 96
304 3300025938 Ga0207704_10243456 Ga0207704_102434563 96
305 3300025939 Ga0207665_11096061 Ga0207665_110960611 96
306 3300025940 Ga0207691_10014578 Ga0207691_100145782 96
307 3300025941 Ga0207711_10196148 Ga0207711_101961483 96
308 3300025942 Ga0207689_10004110 Ga0207689_100041108 96
309 3300025944 Ga0207661_10004749 Ga0207661_100047499 96
310 3300025944 Ga0207661_10084137 Ga0207661_100841373 96
311 3300025944 Ga0207661_10666640 Ga0207661_106666402 96
312 3300025945 Ga0207679_10019570 Ga0207679_100195703 96
313 3300025949 Ga0207667_10445673 Ga0207667_104456732 96
314 3300025960 Ga0207651_10163528 Ga0207651_101635283 96
315 3300025961 Ga0207712_10203610 Ga0207712_102036102 96
316 3300025972 Ga0207668_10212052 Ga0207668_102120522 96
317 3300025981 Ga0207640_10216743 Ga0207640_102167432 96
318 3300025986 Ga0207658_10716328 Ga0207658_107163282 96
319 3300026023 Ga0207677_10074383 Ga0207677_100743832 96
320 3300026035 Ga0207703_10099149 Ga0207703_100991492 96
321 3300026041 Ga0207639_10019296 Ga0207639_100192963 96
322 3300026067 Ga0207678_10000537 Ga0207678_1000053714 96
323 3300026067 Ga0207678_10263050 Ga0207678_102630502 96
324 3300026075 Ga0207708_10004306 Ga0207708_100043062 96
325 3300026078 Ga0207702_10015790 Ga0207702_100157906 96
326 3300026078 Ga0207702_10053400 Ga0207702_100534004 96
327 3300026088 Ga0207641_10014896 Ga0207641_100148963 96
328 3300026089 Ga0207648_10048745 Ga0207648_100487453 96
329 3300026095 Ga0207676_10001429 Ga0207676_100014293 96
330 3300026116 Ga0207674_10203011 Ga0207674_102030112 96
331 3300026116 Ga0207674_11175391 Ga0207674_111753912 96
332 3300026118 Ga0207675_100023096 Ga0207675_1000230965 96
333 3300026121 Ga0207683_10005024 Ga0207683_100050243 96
334 3300026142 Ga0207698_10016381 Ga0207698_100163814 96
335 3300027907 Ga0207428_10017467 Ga0207428_100174673 96
336 3300028379 Ga0268266_10020837 Ga0268266_100208373 96
337 3300028381 Ga0268264_10191897 Ga0268264_101918972 96
338 3300030521 Ga0307511_10029063 Ga0307511_100290633 96
339 3300030742 Ga0316183_1078238 Ga0316183_10782382 96
340 3300035170 Ga0373943_0359239 Ga0373943_0359239_503_793 96
341 3300037471 Ga0395905_0876356 Ga0395905_0876356_437_727 96
342 3300039437 Ga0436365_1200322 Ga0436365_1200322_214_504 96
343 3300041404 Ga0439436_0032479 Ga0439436_0032479_782_1072 96
344 3300041406 Ga0439439_0001943 Ga0439439_0001943_2318_2608 96
345 3300041411 Ga0439466_0015325 Ga0439466_0015325_330_620 96
346 3300041999 Ga0439433_0028060 Ga0439433_0028060_632_922 96
347 3300042002 Ga0439442_044183 Ga0439442_044183_113_403 96
348 3300042007 Ga0439449_0002649 Ga0439449_0002649_2288_2578 96
349 3300042012 Ga0439455_0009452 Ga0439455_0009452_415_705 96
350 3300042014 Ga0439457_003005 Ga0439457_003005_3219_3509 96
351 3300042461 Ga0439460_0256764 Ga0439460_0256764_256_546 96
352 3300042993 Ga0439440_0119617 Ga0439440_0119617_291_581 96
353 3300046461 Ga0495641_0476020 Ga0495641_0476020_196_486 96
354 3300046535 Ga0495586_0600117 Ga0495586_0600117_333_623 96
355 3300046663 Ga0495635_0136886 Ga0495635_0136886_739_1029 96
356 3300047319 Ga0495674_0587904 Ga0495674_0587904_371_661 96
357 3300050492 nmdc:mga0yw44_439676_c1 nmdc:mga0yw44_439676_c1_330_620 96
358 3300050494 nmdc:mga06z11_124724_c1 nmdc:mga06z11_124724_c1_816_1106 96
359 3300050494 nmdc:mga06z11_922275_c1 nmdc:mga06z11_922275_c1_141_431 96
360 3300053077 Ga0495601_0227693 Ga0495601_0227693_403_693 96
361 3300053084 Ga0495595_0233331 Ga0495595_0233331_583_873 96
362 3300059477 Ga0587084_062644 Ga0587084_062644_294_584 96
363 3300059478 Ga0587093_030920 Ga0587093_030920_204_494 96
364 3300059490 Ga0587066_056272 Ga0587066_056272_308_598 96
365 3300059491 Ga0587070_022496 Ga0587070_022496_588_878 96
366 3300059493 Ga0587077_047432 Ga0587077_047432_287_577 96
367 3300059503 Ga0587080_036047 Ga0587080_036047_282_572 96
368 3300059504 Ga0587082_033175 Ga0587082_033175_277_567 96
369 3300059505 Ga0587083_0087287 Ga0587083_0087287_58_348 96
370 3300059505 Ga0587083_0110316 Ga0587083_0110316_346_636 96
371 3300059506 Ga0587085_032436 Ga0587085_032436_314_604 96
372 3300059507 Ga0587086_023465 Ga0587086_023465_292_582 96
373 3300059508 Ga0587088_020662 Ga0587088_020662_133_423 96
374 3300059511 Ga0587091_068752 Ga0587091_068752_129_419 96
375 3300059512 Ga0587092_029478 Ga0587092_029478_324_614 96
376 3300059513 Ga0587094_022270 Ga0587094_022270_268_558 96
377 3300059514 Ga0587095_022033 Ga0587095_022033_94_384 96
378 3300059607 Ga0587125_041881 Ga0587125_041881_231_521 96
379 3300059608 Ga0587129_019024 Ga0587129_019024_105_395 96
380 3300059622 Ga0587099_026618 Ga0587099_026618_101_391 96
381 3300059624 Ga0587109_064437 Ga0587109_064437_166_456 96
382 3300059625 Ga0587113_029707 Ga0587113_029707_100_390 96
383 3300059626 Ga0587115_027984 Ga0587115_027984_248_538 96
384 3300059628 Ga0587122_013518 Ga0587122_013518_181_471 96
385 3300059629 Ga0587127_005001 Ga0587127_005001_206_496 96
386 3300059630 Ga0587128_062444 Ga0587128_062444_313_603 96
387 3300059639 Ga0587062_079760 Ga0587062_079760_103_393 96
388 3300059640 Ga0587067_045105 Ga0587067_045105_286_576 96
389 3300059641 Ga0587068_048223 Ga0587068_048223_213_503 96
390 3300059642 Ga0587069_068879 Ga0587069_068879_111_401 96
391 3300059644 Ga0587075_027885 Ga0587075_027885_291_581 96
392 3300059645 Ga0587076_041161 Ga0587076_041161_288_578 96
393 3300059646 Ga0587078_016868 Ga0587078_016868_281_571 96
394 3300059647 Ga0587079_059945 Ga0587079_059945_159_449 96
395 3300059648 Ga0587100_009137 Ga0587100_009137_246_536 96
396 3300059649 Ga0587102_016841 Ga0587102_016841_206_496 96
397 3300059651 Ga0587105_011794 Ga0587105_011794_101_391 96
398 3300059652 Ga0587107_028288 Ga0587107_028288_336_626 96
399 3300059655 Ga0587114_027619 Ga0587114_027619_238_528 96
400 3300059656 Ga0587116_11448 Ga0587116_11448_94_384 96
401 3300059658 Ga0587119_019641 Ga0587119_019641_250_540 96
402 3300060344 Ga0587071_044510 Ga0587071_044510_280_570 96
403 3300060346 Ga0587111_0049893 Ga0587111_0049893_246_536 96
404 3300000549 LJQas_1013115 LJQas_10131152 97
405 3300003354 JGI25160J50197_1034560 JGI25160J50197_10345603 97
406 3300003354 JGI25160J50197_1039529 JGI25160J50197_10395293 97
407 3300003579 Ga0007429J51699_1153713 Ga0007429J51699_11537131 97
408 3300004798 Ga0058859_11486220 Ga0058859_114862201 97
409 3300004800 Ga0058861_10042331 Ga0058861_100423312 97
410 3300004801 Ga0058860_12229073 Ga0058860_122290732 97
411 3300004803 Ga0058862_10093961 Ga0058862_100939612 97
412 3300005328 Ga0070676_10011402 Ga0070676_100114022 97
413 3300005329 Ga0070683_100004355 Ga0070683_1000043556 97
414 3300005329 Ga0070683_100264596 Ga0070683_1002645962 97
415 3300005331 Ga0070670_100089256 Ga0070670_1000892562 97
416 3300005331 Ga0070670_100164881 Ga0070670_1001648813 97
417 3300005331 Ga0070670_100996519 Ga0070670_1009965192 97
418 3300005337 Ga0070682_101668963 Ga0070682_1016689632 97
419 3300005338 Ga0068868_100088880 Ga0068868_1000888801 97
420 3300005339 Ga0070660_100316086 Ga0070660_1003160861 97
421 3300005340 Ga0070689_100195991 Ga0070689_1001959912 97
422 3300005340 Ga0070689_102147115 Ga0070689_1021471151 97
423 3300005341 Ga0070691_10268408 Ga0070691_102684082 97
424 3300005343 Ga0070687_100725161 Ga0070687_1007251612 97
425 3300005344 Ga0070661_100138050 Ga0070661_1001380503 97
426 3300005344 Ga0070661_101113932 Ga0070661_1011139321 97
427 3300005345 Ga0070692_10079679 Ga0070692_100796792 97
428 3300005347 Ga0070668_100445157 Ga0070668_1004451572 97
429 3300005347 Ga0070668_101733383 Ga0070668_1017333831 97
430 3300005354 Ga0070675_100001206 Ga0070675_10000120615 97
431 3300005355 Ga0070671_101591268 Ga0070671_1015912682 97
432 3300005364 Ga0070673_100745257 Ga0070673_1007452572 97
433 3300005366 Ga0070659_100027291 Ga0070659_1000272911 97
434 3300005366 Ga0070659_101049263 Ga0070659_1010492631 97
435 3300005438 Ga0070701_10415330 Ga0070701_104153302 97
436 3300005438 Ga0070701_10924436 Ga0070701_109244361 97
437 3300005441 Ga0070700_100010220 Ga0070700_1000102204 97
438 3300005455 Ga0070663_100006877 Ga0070663_1000068774 97
439 3300005456 Ga0070678_100380879 Ga0070678_1003808792 97
440 3300005457 Ga0070662_100097077 Ga0070662_1000970773 97
441 3300005457 Ga0070662_101440308 Ga0070662_1014403081 97
442 3300005466 Ga0070685_10298067 Ga0070685_102980672 97
443 3300005530 Ga0070679_101267404 Ga0070679_1012674042 97
444 3300005535 Ga0070684_100251975 Ga0070684_1002519753 97
445 3300005535 Ga0070684_101276863 Ga0070684_1012768631 97
446 3300005543 Ga0070672_100905976 Ga0070672_1009059762 97
447 3300005543 Ga0070672_101589459 Ga0070672_1015894591 97
448 3300005544 Ga0070686_100622504 Ga0070686_1006225042 97
449 3300005544 Ga0070686_101506756 Ga0070686_1015067561 97
450 3300005547 Ga0070693_101048760 Ga0070693_1010487602 97
451 3300005564 Ga0070664_100000690 Ga0070664_1000006906 97
452 3300005564 Ga0070664_100241888 Ga0070664_1002418881 97
453 3300005577 Ga0068857_100101428 Ga0068857_1001014284 97
454 3300005577 Ga0068857_100109175 Ga0068857_1001091753 97
455 3300005577 Ga0068857_100321271 Ga0068857_1003212712 97
456 3300005578 Ga0068854_100159807 Ga0068854_1001598071 97
457 3300005616 Ga0068852_101108374 Ga0068852_1011083742 97
458 3300005616 Ga0068852_101869030 Ga0068852_1018690302 97
459 3300005618 Ga0068864_100101208 Ga0068864_1001012084 97
460 3300005618 Ga0068864_100162000 Ga0068864_1001620003 97
461 3300005719 Ga0068861_100102170 Ga0068861_1001021702 97
462 3300005841 Ga0068863_100068954 Ga0068863_1000689544 97
463 3300005841 Ga0068863_100349375 Ga0068863_1003493753 97
464 3300005842 Ga0068858_100354082 Ga0068858_1003540822 97
465 3300005842 Ga0068858_100907509 Ga0068858_1009075091 97
466 3300005843 Ga0068860_100424306 Ga0068860_1004243062 97
467 3300005844 Ga0068862_100044918 Ga0068862_1000449183 97
468 3300005844 Ga0068862_101856935 Ga0068862_1018569352 97
469 3300006844 Ga0075428_100204933 Ga0075428_1002049331 97
470 3300006847 Ga0075431_100966354 Ga0075431_1009663542 97
471 3300006847 Ga0075431_101015528 Ga0075431_1010155282 97
472 3300006852 Ga0075433_11269025 Ga0075433_112690251 97
473 3300006880 Ga0075429_100049388 Ga0075429_1000493882 97
474 3300006880 Ga0075429_100356979 Ga0075429_1003569792 97
475 3300006881 Ga0068865_100346074 Ga0068865_1003460742 97
476 3300009094 Ga0111539_10009710 Ga0111539_100097109 97
477 3300009098 Ga0105245_10007354 Ga0105245_100073545 97
478 3300009147 Ga0114129_10029013 Ga0114129_100290133 97
479 3300009147 Ga0114129_10606568 Ga0114129_106065681 97
480 3300009147 Ga0114129_12315031 Ga0114129_123150312 97
481 3300009174 Ga0105241_10620006 Ga0105241_106200062 97
482 3300009177 Ga0105248_13394863 Ga0105248_133948632 97
483 3300009545 Ga0105237_10330358 Ga0105237_103303582 97
484 3300009553 Ga0105249_10045189 Ga0105249_100451895 97
485 3300009553 Ga0105249_10643457 Ga0105249_106434572 97
486 3300010375 Ga0105239_10216047 Ga0105239_102160474 97
487 3300011119 Ga0105246_12520294 Ga0105246_125202942 97
488 3300013297 Ga0157378_10535169 Ga0157378_105351692 97
489 3300013306 Ga0163162_10620883 Ga0163162_106208832 97
490 3300014325 Ga0163163_10412540 Ga0163163_104125403 97
491 3300014325 Ga0163163_11819650 Ga0163163_118196501 97
492 3300014326 Ga0157380_13318085 Ga0157380_133180851 97
493 3300014745 Ga0157377_10022949 Ga0157377_100229494 97
494 3300014745 Ga0157377_10599468 Ga0157377_105994682 97
495 3300014745 Ga0157377_11422890 Ga0157377_114228901 97
496 3300014968 Ga0157379_10137330 Ga0157379_101373303 97
497 3300014969 Ga0157376_10480737 Ga0157376_104807372 97
498 3300020078 Ga0206352_10284584 Ga0206352_102845842 97
499 3300021388 Ga0213875_10284505 Ga0213875_102845052 97
500 3300025302 Ga0207426_1008130 Ga0207426_10081305 97
501 3300025302 Ga0207426_1011991 Ga0207426_10119915 97
502 3300025901 Ga0207688_10088217 Ga0207688_100882172 97
503 3300025907 Ga0207645_10169000 Ga0207645_101690002 97
504 3300025908 Ga0207643_10088314 Ga0207643_100883142 97
505 3300025914 Ga0207671_10302606 Ga0207671_103026062 97
506 3300025918 Ga0207662_10139838 Ga0207662_101398382 97
507 3300025919 Ga0207657_10235462 Ga0207657_102354623 97
508 3300025920 Ga0207649_10379938 Ga0207649_103799382 97
509 3300025920 Ga0207649_10446554 Ga0207649_104465542 97
510 3300025923 Ga0207681_10979925 Ga0207681_109799252 97
511 3300025925 Ga0207650_10402673 Ga0207650_104026732 97
512 3300025926 Ga0207659_10004453 Ga0207659_100044536 97
513 3300025927 Ga0207687_10009481 Ga0207687_100094813 97
514 3300025931 Ga0207644_10885715 Ga0207644_108857151 97
515 3300025933 Ga0207706_10015936 Ga0207706_100159363 97
516 3300025936 Ga0207670_11810693 Ga0207670_118106932 97
517 3300025938 Ga0207704_10968048 Ga0207704_109680481 97
518 3300025942 Ga0207689_10465654 Ga0207689_104656542 97
519 3300025944 Ga0207661_10004995 Ga0207661_100049957 97
520 3300025945 Ga0207679_10048271 Ga0207679_100482712 97
521 3300025945 Ga0207679_10218531 Ga0207679_102185312 97
522 3300025945 Ga0207679_10569270 Ga0207679_105692702 97
523 3300025961 Ga0207712_10115014 Ga0207712_101150143 97
524 3300025972 Ga0207668_10923927 Ga0207668_109239272 97
525 3300026023 Ga0207677_10022459 Ga0207677_100224594 97
526 3300026035 Ga0207703_10384895 Ga0207703_103848952 97
527 3300026067 Ga0207678_10042979 Ga0207678_100429794 97
528 3300026067 Ga0207678_11473416 Ga0207678_114734161 97
529 3300026075 Ga0207708_10010011 Ga0207708_100100116 97
530 3300026088 Ga0207641_10256958 Ga0207641_102569582 97
531 3300026095 Ga0207676_10136758 Ga0207676_101367582 97
532 3300026095 Ga0207676_10292713 Ga0207676_102927133 97
533 3300026116 Ga0207674_10104397 Ga0207674_101043973 97
534 3300026116 Ga0207674_10138753 Ga0207674_101387532 97
535 3300026118 Ga0207675_100055589 Ga0207675_1000555893 97
536 3300026118 Ga0207675_102002950 Ga0207675_1020029501 97
537 3300026121 Ga0207683_10189249 Ga0207683_101892492 97
538 3300026142 Ga0207698_12187385 Ga0207698_121873851 97
539 3300027907 Ga0207428_10018395 Ga0207428_100183955 97
540 3300028380 Ga0268265_10011922 Ga0268265_100119224 97
541 3300028381 Ga0268264_10896059 Ga0268264_108960591 97
542 3300030732 Ga0316176_1169306 Ga0316176_11693062 97
543 3300030744 Ga0316181_1215123 Ga0316181_12151234 97
544 3300031456 Ga0307513_10000001 Ga0307513_100000011286 97
545 3300031548 Ga0307408_100015080 Ga0307408_1000150803 97
546 3300031548 Ga0307408_100236260 Ga0307408_1002362601 97
547 3300031616 Ga0307508_10019446 Ga0307508_100194462 97
548 3300031730 Ga0307516_10231934 Ga0307516_102319343 97
549 3300031731 Ga0307405_10006197 Ga0307405_100061976 97
550 3300031824 Ga0307413_10062430 Ga0307413_100624302 97
551 3300031824 Ga0307413_10291321 Ga0307413_102913212 97
552 3300031852 Ga0307410_10027735 Ga0307410_100277352 97
553 3300031889 Ga0326468_10055121 Ga0326468_100551212 97
554 3300031901 Ga0307406_10001387 Ga0307406_100013874 97
555 3300031901 Ga0307406_10132359 Ga0307406_101323594 97
556 3300031901 Ga0307406_11460256 Ga0307406_114602561 97
557 3300031903 Ga0307407_10094597 Ga0307407_100945973 97
558 3300031903 Ga0307407_10142451 Ga0307407_101424512 97
559 3300031995 Ga0307409_100000427 Ga0307409_1000004275 97
560 3300031995 Ga0307409_100009939 Ga0307409_1000099393 97
561 3300031995 Ga0307409_100629303 Ga0307409_1006293032 97
562 3300032002 Ga0307416_100000122 Ga0307416_1000001229 97
563 3300032002 Ga0307416_100205811 Ga0307416_1002058112 97
564 3300032002 Ga0307416_103730249 Ga0307416_1037302491 97
565 3300032005 Ga0307411_10315688 Ga0307411_103156882 97
566 3300032126 Ga0307415_100000011 Ga0307415_10000001140 97
567 3300032126 Ga0307415_100008317 Ga0307415_1000083176 97
568 3300032126 Ga0307415_100033356 Ga0307415_1000333563 97
569 3300035088 Ga0373940_0354719 Ga0373940_0354719_27_344 97
570 3300035117 Ga0373953_0038209 Ga0373953_0038209_760_1065 97
571 3300036401 Ga0373937_0015793 Ga0373937_0015793_58_363 97
572 3300037853 Ga0436364_0014016 Ga0436364_0014016_2970_3266 97
573 3300041405 Ga0439438_141187 Ga0439438_141187_159_452 97
574 3300041486 Ga0451807_0348738 Ga0451807_0348738_138_431 97
575 3300042007 Ga0439449_0145072 Ga0439449_0145072_131_424 97
576 3300042015 Ga0439462_0235512 Ga0439462_0235512_147_440 97
577 3300042145 Ga0450906_045237 Ga0450906_045237_207_500 97
578 3300046663 Ga0495635_0380402 Ga0495635_0380402_615_920 97
579 3300047322 Ga0495680_0763649 Ga0495680_0763649_275_580 97
580 3300048912 Ga0496109_1402696 Ga0496109_1402696_273_575 97
581 3300048915 Ga0496112_1280497 Ga0496112_1280497_232_528 97
582 3300049576 Ga0501040_0898483 Ga0501040_0898483_280_582 97
583 3300049582 Ga0501048_0388604 Ga0501048_0388604_587_904 97
584 3300049588 Ga0501072_0716293 Ga0501072_0716293_373_690 97
585 3300050507 nmdc:mga05p37_1347784_c1 nmdc:mga05p37_1347784_c1_339_647 97
586 3300050507 nmdc:mga05p37_177905_c1 nmdc:mga05p37_177905_c1_448_756 97
587 3300050508 nmdc:mga09592_30910_c1 nmdc:mga09592_30910_c1_436_744 97
588 3300050508 nmdc:mga09592_321515_c1 nmdc:mga09592_321515_c1_899_1201 97
589 3300050508 nmdc:mga09592_354690_c1 nmdc:mga09592_354690_c1_683_1000 97
590 3300050510 nmdc:mga06r32_1374992_c1 nmdc:mga06r32_1374992_c1_282_590 97
591 3300050510 nmdc:mga06r32_953819_c1 nmdc:mga06r32_953819_c1_139_450 97
592 3300050511 nmdc:mga08y16_4311_c1 nmdc:mga08y16_4311_c1_10316_10633 97
593 3300053085 Ga0495619_0065824 Ga0495619_0065824_677_982 97
594 3300053085 Ga0495619_0549099 Ga0495619_0549099_303_596 97
595 3300053090 Ga0500646_0296000 Ga0500646_0296000_55_357 97
596 3300053092 Ga0500583_0053284 Ga0500583_0053284_1341_1655 97
597 3300053096 Ga0500641_0019150 Ga0500641_0019150_1145_1459 97
598 3300053118 Ga0500594_0306509 Ga0500594_0306509_124_438 97
599 3300053146 Ga0500588_0001778 Ga0500588_0001778_3176_3490 97
600 3300053160 Ga0500633_0033521 Ga0500633_0033521_866_1180 97
601 3300054114 Ga0501084_1427531 Ga0501084_1427531_183_500 97
602 3300059511 Ga0587091_075996 Ga0587091_075996_334_651 97
603 3300059605 Ga0587106_041245 Ga0587106_041245_390_683 97
604 3300059623 Ga0587101_150085 Ga0587101_150085_120_422 97
605 3300059640 Ga0587067_191296 Ga0587067_191296_181_498 97
606 3300059644 Ga0587075_140480 Ga0587075_140480_28_345 97
607 3300060353 Ga0501082_0811847 Ga0501082_0811847_313_618 97
608 3300060353 Ga0501082_1178175 Ga0501082_1178175_266_583 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

10

93

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.8187 1 91
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.6914 1 91
6ek4-assembly3.cif.gz_C paxb from photorhabdus luminescens 0.52 2 93
6ek4-assembly3.cif.gz_C paxb from photorhabdus luminescens 0.4919 2 93
7v35-assembly1.cif.gz_R cryo-em structure of the gipr/glp-1r/gcgr triagonist peptide 20-bound human gcgr-gs complex 0.2877 5 97
ID Description Score Start End Superfamily
af_Q12235_49_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4686 5 91 1.20.1250.20
af_Q12235_49_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4239 5 91 1.20.1250.20
af_Q5ADN9_136_257_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.4204 2 91 3.30.40.10
af_A0A0R4IY33_196_297_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3907 5 93 1.20.58.160
af_Q9ULU8_836_940_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.3821 3 88 1.20.1310.10
ID Description Score Start End GO Terms
AF-A0A1I1G3P3-F1-model_v4 YggT family protein 0.9952 1 93 GO:0016020
AF-S2VS64-F1-model_v4 deleted 0.995 3 93
AF-V7LEN3-F1-model_v4 deleted 0.9937 2 91
AF-A0A5B9G201-F1-model_v4 YggT family protein 0.9925 2 92 GO:0016020
AF-U5E7E9-F1-model_v4 YggT family protein 0.9924 2 93 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.71 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map