F468743

General Info

Members Datasets Scaffolds Average Seq Length
607 238 1214 147

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0294525|Ga0501047_0294525_425_961
Length 178
Sequence MGRACYHRHVTGARRARESAGFSFNRWGNDMSSDAKPFWQCIPLAQMSTQQWESLCDGCGKCCLHKLEDEDSGEVFYTDVACRYLSAECRCQCYGQRSEKVANCLTLRPQDLDTVAWLPSTCAYRLLSEKKPLPDWHPLVTGDPQSVHNAGQSVKGRCVSEQSVGEMDFEDHIVSWPC

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
110 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
111 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
182 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
183 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
184 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
185 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
196 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
212 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
215 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
216 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
217 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
218 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
219 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.49
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 0.66
Rhizosphere 95.06
Stem 0
Stem Tuber 0.16
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0294525 3300049581 Bacteria 1466
2 Ga0065712_10030330 3300005290 Bacteria 1677
3 Ga0065715_10093315 3300005293 Bacteria 4717
4 Ga0065715_10095842 3300005293 Bacteria 3995
5 Ga0065715_10152976 3300005293 Bacteria 1708
6 Ga0065715_10155639 3300005293 Bacteria 1670
7 Ga0065715_10289986 3300005293 Bacteria 1065
8 Ga0065715_10588058 3300005293 Bacteria 716
9 Ga0070658_10869101 3300005327 Bacteria 784
10 Ga0070676_10054196 3300005328 Bacteria 2364
11 Ga0070676_10067116 3300005328 Bacteria 2144
12 Ga0070683_100187421 3300005329 Bacteria 1964
13 Ga0070683_101215552 3300005329 Bacteria 724
14 Ga0070670_100003277 3300005331 Bacteria 13391
15 Ga0070670_100104205 3300005331 Bacteria 2443
16 Ga0070670_100233000 3300005331 Bacteria 1602
17 Ga0070670_101642228 3300005331 Bacteria 591
18 Ga0070677_10001818 3300005333 Bacteria 6735
19 Ga0070677_10001877 3300005333 Bacteria 6648
20 Ga0070677_10025564 3300005333 Bacteria 2205
21 Ga0070677_10085236 3300005333 Bacteria 1362
22 Ga0070677_10219490 3300005333 Bacteria 928
23 Ga0070677_10267525 3300005333 Bacteria 856
24 Ga0070677_10324303 3300005333 Bacteria 790
25 Ga0068869_100581919 3300005334 Bacteria 944
26 Ga0070660_100039693 3300005339 Bacteria 3578
27 Ga0070689_100847631 3300005340 Bacteria 806
28 Ga0070668_100019412 3300005347 Bacteria 5116
29 Ga0070668_100074422 3300005347 Bacteria 2650
30 Ga0070668_100092312 3300005347 Bacteria 2388
31 Ga0070668_100132571 3300005347 Bacteria 2001
32 Ga0070668_100159541 3300005347 Bacteria 1829
33 Ga0070668_100449361 3300005347 Bacteria 1108
34 Ga0070668_100515707 3300005347 Bacteria 1037
35 Ga0070668_101279678 3300005347 Bacteria 666
36 Ga0070669_100004075 3300005353 Bacteria 10581
37 Ga0070669_100013468 3300005353 Bacteria 5813
38 Ga0070669_100052606 3300005353 Bacteria 2980
39 Ga0070669_100066257 3300005353 Bacteria 2662
40 Ga0070669_100504027 3300005353 Bacteria 1004
41 Ga0070669_100549666 3300005353 Bacteria 963
42 Ga0070675_100005450 3300005354 Bacteria 9731
43 Ga0070675_100013820 3300005354 Bacteria 6356
44 Ga0070675_100023915 3300005354 Bacteria 4889
45 Ga0070675_100065398 3300005354 Bacteria 3007
46 Ga0070675_100394937 3300005354 Bacteria 1233
47 Ga0070671_100013594 3300005355 Bacteria 6566
48 Ga0070671_100014702 3300005355 Bacteria 6325
49 Ga0070671_100101736 3300005355 Bacteria 2411
50 Ga0070671_100440718 3300005355 Bacteria 1117
51 Ga0070671_100675316 3300005355 Bacteria 895
52 Ga0070671_100709460 3300005355 Bacteria 873
53 Ga0070673_100003783 3300005364 Bacteria 9492
54 Ga0070673_100149808 3300005364 Bacteria 1975
55 Ga0070673_100487730 3300005364 Bacteria 1113
56 Ga0070673_101001798 3300005364 Bacteria 778
57 Ga0070673_101423240 3300005364 Bacteria 653
58 Ga0070659_100132288 3300005366 Bacteria 2027
59 Ga0070659_100297058 3300005366 Bacteria 1346
60 Ga0070659_100303923 3300005366 Bacteria 1331
61 Ga0070659_100744543 3300005366 Bacteria 850
62 Ga0070659_101418648 3300005366 Bacteria 617
63 Ga0070667_100060332 3300005367 Bacteria 3209
64 Ga0070663_100008594 3300005455 Bacteria 6290
65 Ga0070663_100080644 3300005455 Bacteria 2390
66 Ga0070663_100153211 3300005455 Bacteria 1769
67 Ga0070663_100567832 3300005455 Bacteria 950
68 Ga0070678_100116820 3300005456 Bacteria 2097
69 Ga0070678_100713986 3300005456 Bacteria 904
70 Ga0070662_100004563 3300005457 Bacteria 8767
71 Ga0070662_100115215 3300005457 Bacteria 2053
72 Ga0070662_100258201 3300005457 Bacteria 1403
73 Ga0068867_100064793 3300005459 Bacteria 2717
74 Ga0070679_100036532 3300005530 Bacteria 4875
75 Ga0070679_100939292 3300005530 Bacteria 808
76 Ga0070679_101474266 3300005530 Bacteria 627
77 Ga0068853_100163850 3300005539 Bacteria 2008
78 Ga0068853_101601654 3300005539 Bacteria 631
79 Ga0070672_100004066 3300005543 Bacteria 9547
80 Ga0070672_100058047 3300005543 Bacteria 3040
81 Ga0070672_100403676 3300005543 Bacteria 1172
82 Ga0070672_100846576 3300005543 Bacteria 806
83 Ga0070672_101013925 3300005543 Bacteria 736
84 Ga0070672_101024052 3300005543 Bacteria 732
85 Ga0070665_100000296 3300005548 Bacteria 78411
86 Ga0070665_100006408 3300005548 Bacteria 11980
87 Ga0070665_100545045 3300005548 Bacteria 1172
88 Ga0068855_100074149 3300005563 Bacteria 3952
89 Ga0068855_100887020 3300005563 Bacteria 943
90 Ga0070664_100173927 3300005564 Bacteria 1911
91 Ga0070664_100279749 3300005564 Bacteria 1505
92 Ga0068857_100032654 3300005577 Bacteria 4602
93 Ga0068857_100210168 3300005577 Bacteria 1776
94 Ga0068854_100275839 3300005578 Bacteria 1352
95 Ga0068854_100381118 3300005578 Bacteria 1162
96 Ga0068854_100411154 3300005578 Bacteria 1122
97 Ga0070702_100431299 3300005615 Bacteria 951
98 Ga0068864_100010591 3300005618 Bacteria 7624
99 Ga0068864_100934558 3300005618 Bacteria 857
100 Ga0068861_100088582 3300005719 Bacteria 2438
101 Ga0068860_100737485 3300005843 Bacteria 996
102 Ga0068862_100024006 3300005844 Bacteria 5112
103 Ga0068862_100062009 3300005844 Bacteria 3215
104 Ga0068862_100153694 3300005844 Bacteria 2050
105 Ga0081539_10038087 3300005985 Bacteria 2854
106 Ga0075365_10127512 3300006038 Bacteria 1759
107 Ga0075370_10454688 3300006353 Bacteria 771
108 Ga0075428_100139488 3300006844 Bacteria 2635
109 Ga0075431_100009548 3300006847 Bacteria 9744
110 Ga0068865_100437422 3300006881 Bacteria 1079
111 Ga0105240_10001036 3300009093 Bacteria 49427
112 Ga0105240_10026858 3300009093 Bacteria 7549
113 Ga0111539_10089423 3300009094 Bacteria 3618
114 Ga0114129_11031045 3300009147 Bacteria 1034
115 Ga0105243_10107392 3300009148 Bacteria 2328
116 Ga0105243_10847518 3300009148 Bacteria 905
117 Ga0105243_11262223 3300009148 Bacteria 754
118 Ga0105241_10510187 3300009174 Bacteria 1074
119 Ga0105248_10007244 3300009177 Bacteria 12169
120 Ga0105248_10056380 3300009177 Bacteria 4408
121 Ga0105248_10455609 3300009177 Bacteria 1442
122 Ga0105248_10690983 3300009177 Bacteria 1151
123 Ga0105237_10006373 3300009545 Bacteria 13104
124 Ga0105238_10678250 3300009551 Bacteria 1042
125 Ga0105249_10012287 3300009553 Bacteria 7546
126 Ga0105249_10116415 3300009553 Bacteria 2533
127 Ga0105249_10147273 3300009553 Bacteria 2263
128 Ga0105032_111856 3300009979 Bacteria 700
129 Ga0105239_10000319 3300010375 Bacteria 70995
130 Ga0157369_12161692 3300013105 Bacteria 564
131 Ga0163162_10116910 3300013306 Bacteria 2768
132 Ga0157375_11789942 3300013308 Bacteria 728
133 Ga0163163_10386343 3300014325 Bacteria 1457
134 Ga0157380_10000710 3300014326 Bacteria 20822
135 Ga0157380_10011868 3300014326 Bacteria 6300
136 Ga0157380_10018361 3300014326 Bacteria 5190
137 Ga0157380_10033752 3300014326 Bacteria 3942
138 Ga0157380_10403236 3300014326 Bacteria 1298
139 Ga0157380_11049441 3300014326 Bacteria 851
140 Ga0157380_11550700 3300014326 Bacteria 717
141 Ga0157380_11606351 3300014326 Bacteria 706
142 Ga0182008_10354180 3300014497 Bacteria 779
143 Ga0183363_1003 3300015690 Bacteria 421263
144 Ga0163161_10002075 3300017792 Bacteria 14527
145 Ga0163161_10208924 3300017792 Bacteria 1507
146 Ga0213873_10000026 3300021358 Bacteria 74525
147 Ga0213876_10000149 3300021384 Bacteria 74548
148 Ga0207666_1013169 3300025271 Bacteria 1159
149 Ga0207673_1013878 3300025290 Bacteria 1060
150 Ga0207697_10007313 3300025315 Bacteria 4932
151 Ga0207697_10197247 3300025315 Bacteria 885
152 Ga0207682_10000811 3300025893 Bacteria 14470
153 Ga0207682_10000923 3300025893 Bacteria 13618
154 Ga0207682_10113760 3300025893 Bacteria 1194
155 Ga0207682_10441618 3300025893 Bacteria 616
156 Ga0207642_10641218 3300025899 Bacteria 665
157 Ga0207688_10028578 3300025901 Bacteria 3068
158 Ga0207688_10035767 3300025901 Bacteria 2751
159 Ga0207688_10166728 3300025901 Bacteria 1308
160 Ga0207645_10104655 3300025907 Bacteria 1828
161 Ga0207645_10161666 3300025907 Bacteria 1465
162 Ga0207705_10389296 3300025909 Bacteria 1077
163 Ga0207695_10000867 3300025913 Bacteria 55339
164 Ga0207695_10030759 3300025913 Bacteria 5906
165 Ga0207671_10000924 3300025914 Bacteria 36861
166 Ga0207662_10533911 3300025918 Bacteria 811
167 Ga0207662_10892162 3300025918 Bacteria 629
168 Ga0207657_10072788 3300025919 Bacteria 2906
169 Ga0207652_10063304 3300025921 Bacteria 3198
170 Ga0207652_10223128 3300025921 Bacteria 1698
171 Ga0207652_10628938 3300025921 Bacteria 961
172 Ga0207652_10841683 3300025921 Bacteria 813
173 Ga0207681_10001743 3300025923 Bacteria 13962
174 Ga0207681_10003745 3300025923 Bacteria 9452
175 Ga0207681_10008452 3300025923 Bacteria 6292
176 Ga0207681_10391879 3300025923 Bacteria 1120
177 Ga0207650_10009710 3300025925 Bacteria 6580
178 Ga0207650_10036943 3300025925 Bacteria 3556
179 Ga0207650_10038799 3300025925 Bacteria 3480
180 Ga0207650_10045331 3300025925 Bacteria 3235
181 Ga0207650_10533419 3300025925 Bacteria 983
182 Ga0207659_10001878 3300025926 Bacteria 12439
183 Ga0207659_10015651 3300025926 Bacteria 4921
184 Ga0207659_10132549 3300025926 Bacteria 1925
185 Ga0207659_10150590 3300025926 Bacteria 1816
186 Ga0207644_10037317 3300025931 Bacteria 3418
187 Ga0207644_10080961 3300025931 Bacteria 2399
188 Ga0207644_10133521 3300025931 Bacteria 1903
189 Ga0207644_10188664 3300025931 Bacteria 1620
190 Ga0207644_10639521 3300025931 Bacteria 885
191 Ga0207690_10219490 3300025932 Bacteria 1454
192 Ga0207690_10299015 3300025932 Bacteria 1259
193 Ga0207706_10000276 3300025933 Bacteria 55889
194 Ga0207706_10050867 3300025933 Bacteria 3661
195 Ga0207706_10065993 3300025933 Bacteria 3186
196 Ga0207706_10091080 3300025933 Bacteria 2681
197 Ga0207706_10146766 3300025933 Bacteria 2075
198 Ga0207706_10904466 3300025933 Bacteria 745
199 Ga0207709_10635382 3300025935 Bacteria 848
200 Ga0207669_10069712 3300025937 Bacteria 2201
201 Ga0207669_10213802 3300025937 Bacteria 1410
202 Ga0207704_10404051 3300025938 Bacteria 1079
203 Ga0207691_10014857 3300025940 Bacteria 7421
204 Ga0207691_10074956 3300025940 Bacteria 3051
205 Ga0207691_10313890 3300025940 Bacteria 1345
206 Ga0207691_10326121 3300025940 Bacteria 1316
207 Ga0207691_10635973 3300025940 Bacteria 902
208 Ga0207711_10002512 3300025941 Bacteria 16345
209 Ga0207711_10191609 3300025941 Bacteria 1863
210 Ga0207711_10446789 3300025941 Bacteria 1203
211 Ga0207689_11107175 3300025942 Bacteria 667
212 Ga0207661_10162599 3300025944 Bacteria 1938
213 Ga0207679_10065660 3300025945 Bacteria 2717
214 Ga0207679_10117363 3300025945 Bacteria 2112
215 Ga0207679_11629105 3300025945 Bacteria 591
216 Ga0207651_10007898 3300025960 Bacteria 5700
217 Ga0207651_10200932 3300025960 Bacteria 1597
218 Ga0207651_10442937 3300025960 Bacteria 1113
219 Ga0207651_10979338 3300025960 Bacteria 755
220 Ga0207651_11012153 3300025960 Bacteria 743
221 Ga0207651_11590194 3300025960 Bacteria 589
222 Ga0207712_10041655 3300025961 Bacteria 3157
223 Ga0207712_10136891 3300025961 Bacteria 1874
224 Ga0207668_10010258 3300025972 Bacteria 5655
225 Ga0207668_10020817 3300025972 Bacteria 4175
226 Ga0207668_10106690 3300025972 Bacteria 2093
227 Ga0207668_10142626 3300025972 Bacteria 1844
228 Ga0207668_10259890 3300025972 Bacteria 1414
229 Ga0207668_10274387 3300025972 Bacteria 1380
230 Ga0207668_10855243 3300025972 Bacteria 808
231 Ga0207640_10270633 3300025981 Bacteria 1329
232 Ga0207640_10737315 3300025981 Bacteria 848
233 Ga0207640_11175929 3300025981 Bacteria 681
234 Ga0207658_10788476 3300025986 Bacteria 862
235 Ga0207639_10587999 3300026041 Bacteria 1025
236 Ga0207678_10000746 3300026067 Bacteria 29716
237 Ga0207678_10033178 3300026067 Bacteria 4499
238 Ga0207678_10136115 3300026067 Bacteria 2096
239 Ga0207648_10015998 3300026089 Bacteria 6874
240 Ga0207648_10623528 3300026089 Bacteria 995
241 Ga0207676_10025317 3300026095 Bacteria 4403
242 Ga0207674_10046306 3300026116 Bacteria 4466
243 Ga0207674_10113311 3300026116 Bacteria 2685
244 Ga0207674_10228457 3300026116 Bacteria 1809
245 Ga0207674_10958319 3300026116 Bacteria 824
246 Ga0207675_100001317 3300026118 Bacteria 24894
247 Ga0207683_10135351 3300026121 Bacteria 2218
248 Ga0207683_10632424 3300026121 Bacteria 991
249 Ga0207698_12056983 3300026142 Bacteria 585
250 Ga0209970_1021407 3300027614 Bacteria 1095
251 Ga0209974_10005701 3300027876 Bacteria 4372
252 Ga0209974_10025077 3300027876 Bacteria 1974
253 Ga0209974_10149600 3300027876 Bacteria 842
254 Ga0207428_10146283 3300027907 Bacteria 1801
255 Ga0268266_10002428 3300028379 Bacteria 20045
256 Ga0268266_10006479 3300028379 Bacteria 10715
257 Ga0268265_10015482 3300028380 Bacteria 5220
258 Ga0268265_10169407 3300028380 Bacteria 1865
259 Ga0268265_10355072 3300028380 Bacteria 1340
260 Ga0268264_11208463 3300028381 Bacteria 765
261 Ga0316176_1130815 3300030732 Bacteria 849
262 Ga0314311_1217840 3300030733 Bacteria 983
263 Ga0316180_1192854 3300030736 Bacteria 2271
264 Ga0316183_1009445 3300030742 Bacteria 1709
265 Ga0316182_1111562 3300030745 Bacteria 1151
266 Ga0316182_1353257 3300030745 Bacteria 1540
267 Ga0316182_1411167 3300030745 Bacteria 635
268 Ga0265327_10156806 3300031251 Bacteria 1054
269 Ga0307408_100044776 3300031548 Bacteria 3156
270 Ga0307408_100083186 3300031548 Bacteria 2397
271 Ga0307408_100129318 3300031548 Bacteria 1968
272 Ga0307408_100222652 3300031548 Bacteria 1540
273 Ga0307408_100229118 3300031548 Bacteria 1520
274 Ga0307408_100289596 3300031548 Bacteria 1367
275 Ga0307408_100494288 3300031548 Bacteria 1070
276 Ga0307408_101073935 3300031548 Bacteria 745
277 Ga0307408_101493315 3300031548 Bacteria 639
278 Ga0316579_10012053 3300031691 Bacteria 3691
279 Ga0307405_10016238 3300031731 Bacteria 4054
280 Ga0307405_10022125 3300031731 Bacteria 3589
281 Ga0307405_10108500 3300031731 Bacteria 1876
282 Ga0307405_10117564 3300031731 Bacteria 1813
283 Ga0307405_10117656 3300031731 Bacteria 1812
284 Ga0307405_10223351 3300031731 Bacteria 1383
285 Ga0307405_10456734 3300031731 Bacteria 1014
286 Ga0307405_10546712 3300031731 Bacteria 936
287 Ga0307405_10655388 3300031731 Bacteria 864
288 Ga0307405_10739850 3300031731 Bacteria 818
289 Ga0307413_10001416 3300031824 Bacteria 9062
290 Ga0307413_10002347 3300031824 Bacteria 7682
291 Ga0307413_10009080 3300031824 Bacteria 4736
292 Ga0307413_10009412 3300031824 Bacteria 4674
293 Ga0307413_10010707 3300031824 Bacteria 4466
294 Ga0307413_10010909 3300031824 Bacteria 4436
295 Ga0307413_10012453 3300031824 Bacteria 4236
296 Ga0307413_10016879 3300031824 Bacteria 3788
297 Ga0307413_10026240 3300031824 Bacteria 3208
298 Ga0307413_10088005 3300031824 Bacteria 2014
299 Ga0307413_10088896 3300031824 Bacteria 2005
300 Ga0307413_10090727 3300031824 Bacteria 1989
301 Ga0307413_10095257 3300031824 Bacteria 1951
302 Ga0307413_10275057 3300031824 Bacteria 1263
303 Ga0307413_10420571 3300031824 Bacteria 1052
304 Ga0307413_10512436 3300031824 Bacteria 965
305 Ga0307413_10866659 3300031824 Bacteria 764
306 Ga0307413_11070707 3300031824 Bacteria 695
307 Ga0307413_11250956 3300031824 Bacteria 647
308 Ga0307413_11502128 3300031824 Bacteria 596
309 Ga0307413_11537769 3300031824 Bacteria 589
310 Ga0307410_10001153 3300031852 Bacteria 11617
311 Ga0307410_10002542 3300031852 Bacteria 8832
312 Ga0307410_10003195 3300031852 Bacteria 8165
313 Ga0307410_10006267 3300031852 Bacteria 6404
314 Ga0307410_10013340 3300031852 Bacteria 4791
315 Ga0307410_10016102 3300031852 Bacteria 4450
316 Ga0307410_10016264 3300031852 Bacteria 4432
317 Ga0307410_10025301 3300031852 Bacteria 3722
318 Ga0307410_10042112 3300031852 Bacteria 3016
319 Ga0307410_10053248 3300031852 Bacteria 2738
320 Ga0307410_10060037 3300031852 Bacteria 2598
321 Ga0307410_10074035 3300031852 Bacteria 2370
322 Ga0307410_10094297 3300031852 Bacteria 2131
323 Ga0307410_10232218 3300031852 Bacteria 1425
324 Ga0307410_10279730 3300031852 Bacteria 1309
325 Ga0307410_10539247 3300031852 Bacteria 965
326 Ga0307410_10615787 3300031852 Bacteria 907
327 Ga0307410_10621536 3300031852 Bacteria 903
328 Ga0307410_10667649 3300031852 Bacteria 873
329 Ga0307410_11079122 3300031852 Bacteria 695
330 Ga0307410_11154268 3300031852 Bacteria 673
331 Ga0307406_10022213 3300031901 Bacteria 3762
332 Ga0307406_10048820 3300031901 Bacteria 2675
333 Ga0307406_10109298 3300031901 Bacteria 1900
334 Ga0307406_10245378 3300031901 Bacteria 1346
335 Ga0307406_10250127 3300031901 Bacteria 1335
336 Ga0307406_10303222 3300031901 Bacteria 1228
337 Ga0307406_10311693 3300031901 Bacteria 1213
338 Ga0307406_10468562 3300031901 Bacteria 1014
339 Ga0307406_10704764 3300031901 Bacteria 843
340 Ga0307407_10001255 3300031903 Bacteria 9038
341 Ga0307407_10003308 3300031903 Bacteria 6581
342 Ga0307407_10007632 3300031903 Bacteria 4909
343 Ga0307407_10016972 3300031903 Bacteria 3640
344 Ga0307407_10037455 3300031903 Bacteria 2680
345 Ga0307407_10066119 3300031903 Bacteria 2131
346 Ga0307407_10088467 3300031903 Bacteria 1892
347 Ga0307407_10131310 3300031903 Bacteria 1603
348 Ga0307407_10363499 3300031903 Bacteria 1028
349 Ga0307412_10004147 3300031911 Bacteria 8072
350 Ga0307412_10019765 3300031911 Bacteria 4086
351 Ga0307412_10056849 3300031911 Bacteria 2609
352 Ga0307412_10059803 3300031911 Bacteria 2555
353 Ga0307412_10109709 3300031911 Bacteria 1968
354 Ga0307412_10164005 3300031911 Bacteria 1655
355 Ga0307412_10208006 3300031911 Bacteria 1491
356 Ga0307412_10395566 3300031911 Bacteria 1123
357 Ga0307412_10454046 3300031911 Bacteria 1056
358 Ga0307412_10810404 3300031911 Bacteria 813
359 Ga0307412_11482962 3300031911 Bacteria 616
360 Ga0307409_100011036 3300031995 Bacteria 5666
361 Ga0307409_100020016 3300031995 Bacteria 4548
362 Ga0307409_100023061 3300031995 Bacteria 4304
363 Ga0307409_100030301 3300031995 Bacteria 3885
364 Ga0307409_100045186 3300031995 Bacteria 3323
365 Ga0307409_100060778 3300031995 Bacteria 2949
366 Ga0307409_100106243 3300031995 Bacteria 2342
367 Ga0307409_100111302 3300031995 Bacteria 2296
368 Ga0307409_100112479 3300031995 Bacteria 2286
369 Ga0307409_100119545 3300031995 Bacteria 2228
370 Ga0307409_100144236 3300031995 Bacteria 2056
371 Ga0307409_100146597 3300031995 Bacteria 2042
372 Ga0307409_100197549 3300031995 Bacteria 1796
373 Ga0307409_100208522 3300031995 Bacteria 1754
374 Ga0307409_100252316 3300031995 Bacteria 1614
375 Ga0307409_100265807 3300031995 Bacteria 1577
376 Ga0307409_100540166 3300031995 Bacteria 1142
377 Ga0307409_100803797 3300031995 Bacteria 948
378 Ga0307409_100882752 3300031995 Bacteria 907
379 Ga0307409_100962057 3300031995 Bacteria 870
380 Ga0307409_101398556 3300031995 Bacteria 726
381 Ga0307409_102142402 3300031995 Bacteria 589
382 Ga0307409_102849573 3300031995 Bacteria 511
383 Ga0307416_100013987 3300032002 Bacteria 5476
384 Ga0307416_100032191 3300032002 Bacteria 3958
385 Ga0307416_100037765 3300032002 Bacteria 3720
386 Ga0307416_100053804 3300032002 Bacteria 3232
387 Ga0307416_100079205 3300032002 Bacteria 2768
388 Ga0307416_100158379 3300032002 Bacteria 2088
389 Ga0307416_100170797 3300032002 Bacteria 2024
390 Ga0307416_100201079 3300032002 Bacteria 1890
391 Ga0307416_100422780 3300032002 Bacteria 1377
392 Ga0307416_100429022 3300032002 Bacteria 1368
393 Ga0307416_100870081 3300032002 Bacteria 1000
394 Ga0307416_101097567 3300032002 Bacteria 900
395 Ga0307416_101506818 3300032002 Bacteria 778
396 Ga0307416_101522723 3300032002 Bacteria 774
397 Ga0307416_101987275 3300032002 Bacteria 684
398 Ga0307414_10001742 3300032004 Bacteria 11289
399 Ga0307414_10001927 3300032004 Bacteria 10746
400 Ga0307414_10011892 3300032004 Bacteria 5127
401 Ga0307414_10011948 3300032004 Bacteria 5118
402 Ga0307414_10022701 3300032004 Bacteria 3964
403 Ga0307414_10038644 3300032004 Bacteria 3207
404 Ga0307414_10066100 3300032004 Bacteria 2583
405 Ga0307414_10082181 3300032004 Bacteria 2361
406 Ga0307414_10111872 3300032004 Bacteria 2080
407 Ga0307414_10132858 3300032004 Unclassified 1935
408 Ga0307414_10172503 3300032004 Bacteria 1731
409 Ga0307414_10303873 3300032004 Bacteria 1351
410 Ga0307414_10305192 3300032004 Bacteria 1348
411 Ga0307414_10505527 3300032004 Bacteria 1070
412 Ga0307414_10508512 3300032004 Bacteria 1067
413 Ga0307414_10589809 3300032004 Bacteria 995
414 Ga0307414_10875622 3300032004 Bacteria 822
415 Ga0307414_11051147 3300032004 Bacteria 751
416 Ga0307414_11098467 3300032004 Bacteria 734
417 Ga0307414_11316645 3300032004 Bacteria 670
418 Ga0307414_11368750 3300032004 Bacteria 657
419 Ga0307411_10005387 3300032005 Bacteria 6280
420 Ga0307411_10005628 3300032005 Bacteria 6177
421 Ga0307411_10012445 3300032005 Bacteria 4643
422 Ga0307411_10017405 3300032005 Bacteria 4094
423 Ga0307411_10038256 3300032005 Bacteria 3024
424 Ga0307411_10092305 3300032005 Bacteria 2117
425 Ga0307411_10103647 3300032005 Bacteria 2018
426 Ga0307411_10117103 3300032005 Bacteria 1919
427 Ga0307411_10121420 3300032005 Bacteria 1891
428 Ga0307411_10157831 3300032005 Bacteria 1694
429 Ga0307411_10209981 3300032005 Unclassified 1502
430 Ga0307411_10271708 3300032005 Bacteria 1344
431 Ga0307411_10332651 3300032005 Bacteria 1231
432 Ga0307411_10431998 3300032005 Bacteria 1097
433 Ga0307411_10545196 3300032005 Bacteria 988
434 Ga0307411_10878868 3300032005 Bacteria 795
435 Ga0307411_10994509 3300032005 Bacteria 751
436 Ga0307411_11007955 3300032005 Bacteria 746
437 Ga0307411_11712313 3300032005 Bacteria 582
438 Ga0307411_11742845 3300032005 Bacteria 577
439 Ga0307411_11758987 3300032005 Bacteria 575
440 Ga0307411_12130599 3300032005 Bacteria 525
441 Ga0307415_100000171 3300032126 Bacteria 28816
442 Ga0307415_100012229 3300032126 Bacteria 4956
443 Ga0307415_100015026 3300032126 Bacteria 4572
444 Ga0307415_100019886 3300032126 Bacteria 4086
445 Ga0307415_100121231 3300032126 Bacteria 1961
446 Ga0307415_100212688 3300032126 Bacteria 1544
447 Ga0307415_100313701 3300032126 Bacteria 1304
448 Ga0307415_100516973 3300032126 Bacteria 1047
449 Ga0307415_100709624 3300032126 Bacteria 908
450 Ga0307415_100757529 3300032126 Bacteria 882
451 Ga0316583_10271937 3300032133 Bacteria 586
452 Ga0316593_10000323 3300032168 Bacteria 8238
453 Ga0316593_10041902 3300032168 Bacteria 1525
454 Ga0316586_1041004 3300033527 Bacteria 814
455 Ga0373937_0162454 3300036401 Bacteria 2094
456 Ga0395899_0015179 3300037312 Bacteria 5873
457 Ga0395899_0041242 3300037312 Bacteria 3449
458 Ga0395900_0001407 3300037418 Bacteria 28797
459 Ga0395900_0317673 3300037418 Bacteria 1538
460 Ga0395898_0134781 3300037466 Bacteria 2364
461 Ga0395905_0000541 3300037471 Bacteria 51481
462 Ga0395905_0301206 3300037471 Bacteria 1491
463 Ga0395905_0373221 3300037471 Bacteria 1320
464 Ga0395905_0450645 3300037471 Bacteria 1185
465 Ga0395905_0482615 3300037471 Bacteria 1139
466 Ga0395905_0501051 3300037471 Bacteria 1114
467 Ga0395901_0025266 3300038443 Bacteria 6098
468 Ga0395901_0036664 3300038443 Bacteria 5068
469 Ga0395901_0126468 3300038443 Bacteria 2686
470 Ga0436365_0124207 3300039437 Bacteria 44215
471 Ga0436360_0482827 3300039438 Bacteria 2794
472 Ga0436363_0662017 3300039450 Bacteria 645
473 Ga0436363_1649312 3300039450 Bacteria 1238
474 Ga0436362_0376260 3300039453 Bacteria 74620
475 Ga0451807_2405185 3300041486 Bacteria 619
476 Ga0439433_0088908 3300041999 Bacteria 758
477 Ga0439443_001733 3300042003 Bacteria 2483
478 Ga0439445_0001028 3300042004 Bacteria 5948
479 Ga0439449_0053990 3300042007 Bacteria 1485
480 Ga0439452_063356 3300042010 Bacteria 825
481 Ga0439462_0203653 3300042015 Bacteria 564
482 Ga0450895_025401 3300042132 Bacteria 564
483 Ga0450905_057911 3300042142 Bacteria 643
484 Ga0439464_0004857 3300042439 Bacteria 3447
485 Ga0439460_0197986 3300042461 Bacteria 684
486 Ga0466966_0000021 3300044684 Bacteria 116714
487 Ga0466968_0168267 3300044735 Bacteria 1014
488 Ga0466970_0145602 3300044765 Bacteria 1307
489 Ga0466960_0266130 3300044901 Bacteria 957
490 Ga0495607_0018419 3300046501 Bacteria 4452
491 Ga0495616_0126274 3300046513 Bacteria 1176
492 Ga0495663_0001226 3300046525 Bacteria 8198
493 Ga0495663_0004571 3300046525 Bacteria 3881
494 Ga0495663_0007736 3300046525 Bacteria 2972
495 Ga0495663_0010805 3300046525 Bacteria 2540
496 Ga0495663_0347821 3300046525 Bacteria 540
497 Ga0495642_0140004 3300046528 Bacteria 1044
498 Ga0495642_0315775 3300046528 Bacteria 685
499 Ga0495598_0026338 3300046537 Bacteria 1593
500 Ga0495621_0004360 3300046539 Bacteria 3973
501 Ga0495621_0005588 3300046539 Bacteria 3624
502 Ga0495621_0026657 3300046539 Bacteria 1952
503 Ga0495633_0016375 3300046558 Bacteria 3824
504 Ga0495633_0060247 3300046558 Bacteria 1779
505 Ga0495656_0539323 3300046615 Bacteria 621
506 Ga0495625_0308240 3300046660 Bacteria 1011
507 Ga0495661_0173573 3300046665 Bacteria 1148
508 Ga0495669_0001697 3300046684 Bacteria 9017
509 Ga0495670_0013579 3300046691 Bacteria 4005
510 Ga0495670_0044296 3300046691 Bacteria 2221
511 Ga0495670_0097210 3300046691 Bacteria 1513
512 Ga0495670_0230158 3300046691 Bacteria 985
513 Ga0495670_0303641 3300046691 Bacteria 855
514 Ga0495670_0717378 3300046691 Bacteria 545
515 Ga0495677_0002911 3300047445 Bacteria 6663
516 Ga0495677_0045622 3300047445 Bacteria 1608
517 Ga0495673_0018833 3300047469 Bacteria 3471
518 Ga0495681_0388534 3300047470 Bacteria 524
519 Ga0495686_0000100 3300047472 Bacteria 180492
520 Ga0496101_0361748 3300048904 Bacteria 1141
521 Ga0496102_1476151 3300048905 Bacteria 599
522 Ga0496109_0077848 3300048912 Bacteria 3052
523 Ga0496117_0017171 3300048920 Bacteria 6057
524 Ga0496117_0070534 3300048920 Bacteria 2346
525 Ga0496118_0001340 3300048921 Bacteria 37345
526 Ga0496118_0288474 3300048921 Bacteria 909
527 Ga0496121_0001202 3300048924 Bacteria 45329
528 Ga0496121_0002347 3300048924 Bacteria 29197
529 Ga0496121_0002899 3300048924 Bacteria 25178
530 Ga0496121_0296819 3300048924 Bacteria 1098
531 Ga0496123_0027265 3300048926 Bacteria 4258
532 Ga0496124_0173206 3300048927 Bacteria 1669
533 Ga0496126_0029428 3300048929 Bacteria 5218
534 Ga0501290_000121 3300049513 Bacteria 11976
535 Ga0501292_000051 3300049515 Bacteria 24863
536 Ga0501294_001336 3300049517 Bacteria 2518
537 Ga0501297_013879 3300049520 Bacteria 949
538 Ga0501300_014204 3300049523 Bacteria 1162
539 Ga0501033_0162806 3300049570 Bacteria 1605
540 Ga0501034_0110256 3300049571 Bacteria 2743
541 Ga0501037_0184474 3300049573 Bacteria 1479
542 Ga0501038_1176087 3300049574 Bacteria 558
543 Ga0501041_1006439 3300049577 Bacteria 536
544 Ga0501043_0100616 3300049579 Bacteria 2272
545 Ga0501047_0309983 3300049581 Bacteria 1419
546 Ga0501047_0911902 3300049581 Bacteria 692
547 Ga0501069_0035870 3300049585 Bacteria 2733
548 Ga0501070_0014643 3300049586 Bacteria 6600
549 Ga0501202_011193 3300049652 Bacteria 1677
550 Ga0501202_018819 3300049652 Bacteria 1359
551 Ga0501202_083965 3300049652 Bacteria 752
552 Ga0501206_000156 3300049653 Bacteria 7367
553 Ga0501207_001401 3300049654 Bacteria 3005
554 Ga0501207_034957 3300049654 Bacteria 857
555 Ga0501222_000337 3300049662 Bacteria 7427
556 Ga0501223_000791 3300049663 Bacteria 7492
557 Ga0501224_006625 3300049664 Bacteria 1678
558 Ga0501227_001176 3300049665 Bacteria 5860
559 Ga0501230_008367 3300049667 Bacteria 1563
560 Ga0501235_007343 3300049669 Bacteria 2403
561 Ga0501235_020736 3300049669 Bacteria 1459
562 Ga0501235_158267 3300049669 Bacteria 591
563 Ga0501236_017647 3300049670 Bacteria 1022
564 Ga0501243_009689 3300049675 Bacteria 1498
565 Ga0501259_016802 3300049688 Bacteria 1262
566 Ga0501261_000034 3300049690 Bacteria 28674
567 Ga0501221_003874 3300049704 Bacteria 2470
568 Ga0501221_025506 3300049704 Bacteria 1195
569 Ga0501225_0002879 3300049705 Bacteria 5283
570 Ga0501245_013175 3300049708 Bacteria 1220
571 Ga0501263_002086 3300049760 Bacteria 1995
572 Ga0501263_016990 3300049760 Bacteria 952
573 Ga0501264_019944 3300049761 Bacteria 705
574 Ga0501266_008390 3300049763 Bacteria 1300
575 Ga0501268_003226 3300049765 Bacteria 2216
576 Ga0501268_023591 3300049765 Bacteria 1069
577 Ga0501272_011424 3300049769 Bacteria 1000
578 Ga0501279_000036 3300049775 Bacteria 31545
579 Ga0501280_000020 3300049776 Bacteria 52521
580 Ga0501281_01062 3300049777 Bacteria 2253
581 Ga0501282_000015 3300049778 Bacteria 25078
582 Ga0501283_002170 3300049779 Bacteria 2550
583 Ga0501283_070157 3300049779 Bacteria 644
584 Ga0501035_0265073 3300049822 Bacteria 1455
585 Ga0501035_0599209 3300049822 Bacteria 898
586 Ga0501044_0130688 3300049823 Bacteria 2505
587 Ga0501044_0202690 3300049823 Bacteria 1942
588 Ga0501044_0980735 3300049823 Bacteria 717
589 Ga0501044_1481774 3300049823 Bacteria 544
590 nmdc:mga0yw44_88329_c1 3300050492 Bacteria 1954
591 nmdc:mga06r32_78148_c1 3300050510 Bacteria 3216
592 nmdc:mga08y16_150258_c1 3300050511 Bacteria 2421
593 nmdc:mga08y16_224170_c1 3300050511 Bacteria 1945
594 nmdc:mga0n895_443986_c1 3300050512 Bacteria 1310
595 nmdc:mga0rr50_1834546_c1 3300050513 Bacteria 510
596 Ga0495655_0008463 3300053083 Bacteria 1956
597 Ga0500566_0036040 3300053094 Bacteria 2872
598 Ga0500592_000541 3300053116 Bacteria 6243
599 Ga0500608_070196 3300053122 Bacteria 1666
600 Ga0500559_0018982 3300053136 Bacteria 2906
601 Ga0500573_0130044 3300053140 Bacteria 1395
602 Ga0500627_0281268 3300053158 Bacteria 730
603 Ga0500587_000112 3300053739 Bacteria 7353
604 Ga0590071_099333 3300059421 Bacteria 733
605 Ga0590075_029370 3300059424 Bacteria 1390
606 Ga0501082_0689033 3300060353 Bacteria 894
607 2885429307 2885427238 Bacteria 2291351
608 Ga0501047_0294525
609 Ga0065712_10030330
610 Ga0065715_10093315
611 Ga0065715_10095842
612 Ga0065715_10152976
613 Ga0065715_10155639
614 Ga0065715_10289986
615 Ga0065715_10588058
616 Ga0070658_10869101
617 Ga0070676_10054196
618 Ga0070676_10067116
619 Ga0070683_100187421
620 Ga0070683_101215552
621 Ga0070670_100003277
622 Ga0070670_100104205
623 Ga0070670_100233000
624 Ga0070670_101642228
625 Ga0070677_10001818
626 Ga0070677_10001877
627 Ga0070677_10025564
628 Ga0070677_10085236
629 Ga0070677_10219490
630 Ga0070677_10267525
631 Ga0070677_10324303
632 Ga0068869_100581919
633 Ga0070660_100039693
634 Ga0070689_100847631
635 Ga0070668_100019412
636 Ga0070668_100074422
637 Ga0070668_100092312
638 Ga0070668_100132571
639 Ga0070668_100159541
640 Ga0070668_100449361
641 Ga0070668_100515707
642 Ga0070668_101279678
643 Ga0070669_100004075
644 Ga0070669_100013468
645 Ga0070669_100052606
646 Ga0070669_100066257
647 Ga0070669_100504027
648 Ga0070669_100549666
649 Ga0070675_100005450
650 Ga0070675_100013820
651 Ga0070675_100023915
652 Ga0070675_100065398
653 Ga0070675_100394937
654 Ga0070671_100013594
655 Ga0070671_100014702
656 Ga0070671_100101736
657 Ga0070671_100440718
658 Ga0070671_100675316
659 Ga0070671_100709460
660 Ga0070673_100003783
661 Ga0070673_100149808
662 Ga0070673_100487730
663 Ga0070673_101001798
664 Ga0070673_101423240
665 Ga0070659_100132288
666 Ga0070659_100297058
667 Ga0070659_100303923
668 Ga0070659_100744543
669 Ga0070659_101418648
670 Ga0070667_100060332
671 Ga0070663_100008594
672 Ga0070663_100080644
673 Ga0070663_100153211
674 Ga0070663_100567832
675 Ga0070678_100116820
676 Ga0070678_100713986
677 Ga0070662_100004563
678 Ga0070662_100115215
679 Ga0070662_100258201
680 Ga0068867_100064793
681 Ga0070679_100036532
682 Ga0070679_100939292
683 Ga0070679_101474266
684 Ga0068853_100163850
685 Ga0068853_101601654
686 Ga0070672_100004066
687 Ga0070672_100058047
688 Ga0070672_100403676
689 Ga0070672_100846576
690 Ga0070672_101013925
691 Ga0070672_101024052
692 Ga0070665_100000296
693 Ga0070665_100006408
694 Ga0070665_100545045
695 Ga0068855_100074149
696 Ga0068855_100887020
697 Ga0070664_100173927
698 Ga0070664_100279749
699 Ga0068857_100032654
700 Ga0068857_100210168
701 Ga0068854_100275839
702 Ga0068854_100381118
703 Ga0068854_100411154
704 Ga0070702_100431299
705 Ga0068864_100010591
706 Ga0068864_100934558
707 Ga0068861_100088582
708 Ga0068860_100737485
709 Ga0068862_100024006
710 Ga0068862_100062009
711 Ga0068862_100153694
712 Ga0081539_10038087
713 Ga0075365_10127512
714 Ga0075370_10454688
715 Ga0075428_100139488
716 Ga0075431_100009548
717 Ga0068865_100437422
718 Ga0105240_10001036
719 Ga0105240_10026858
720 Ga0111539_10089423
721 Ga0114129_11031045
722 Ga0105243_10107392
723 Ga0105243_10847518
724 Ga0105243_11262223
725 Ga0105241_10510187
726 Ga0105248_10007244
727 Ga0105248_10056380
728 Ga0105248_10455609
729 Ga0105248_10690983
730 Ga0105237_10006373
731 Ga0105238_10678250
732 Ga0105249_10012287
733 Ga0105249_10116415
734 Ga0105249_10147273
735 Ga0105032_111856
736 Ga0105239_10000319
737 Ga0157369_12161692
738 Ga0163162_10116910
739 Ga0157375_11789942
740 Ga0163163_10386343
741 Ga0157380_10000710
742 Ga0157380_10011868
743 Ga0157380_10018361
744 Ga0157380_10033752
745 Ga0157380_10403236
746 Ga0157380_11049441
747 Ga0157380_11550700
748 Ga0157380_11606351
749 Ga0182008_10354180
750 Ga0183363_1003
751 Ga0163161_10002075
752 Ga0163161_10208924
753 Ga0213873_10000026
754 Ga0213876_10000149
755 Ga0207666_1013169
756 Ga0207673_1013878
757 Ga0207697_10007313
758 Ga0207697_10197247
759 Ga0207682_10000811
760 Ga0207682_10000923
761 Ga0207682_10113760
762 Ga0207682_10441618
763 Ga0207642_10641218
764 Ga0207688_10028578
765 Ga0207688_10035767
766 Ga0207688_10166728
767 Ga0207645_10104655
768 Ga0207645_10161666
769 Ga0207705_10389296
770 Ga0207695_10000867
771 Ga0207695_10030759
772 Ga0207671_10000924
773 Ga0207662_10533911
774 Ga0207662_10892162
775 Ga0207657_10072788
776 Ga0207652_10063304
777 Ga0207652_10223128
778 Ga0207652_10628938
779 Ga0207652_10841683
780 Ga0207681_10001743
781 Ga0207681_10003745
782 Ga0207681_10008452
783 Ga0207681_10391879
784 Ga0207650_10009710
785 Ga0207650_10036943
786 Ga0207650_10038799
787 Ga0207650_10045331
788 Ga0207650_10533419
789 Ga0207659_10001878
790 Ga0207659_10015651
791 Ga0207659_10132549
792 Ga0207659_10150590
793 Ga0207644_10037317
794 Ga0207644_10080961
795 Ga0207644_10133521
796 Ga0207644_10188664
797 Ga0207644_10639521
798 Ga0207690_10219490
799 Ga0207690_10299015
800 Ga0207706_10000276
801 Ga0207706_10050867
802 Ga0207706_10065993
803 Ga0207706_10091080
804 Ga0207706_10146766
805 Ga0207706_10904466
806 Ga0207709_10635382
807 Ga0207669_10069712
808 Ga0207669_10213802
809 Ga0207704_10404051
810 Ga0207691_10014857
811 Ga0207691_10074956
812 Ga0207691_10313890
813 Ga0207691_10326121
814 Ga0207691_10635973
815 Ga0207711_10002512
816 Ga0207711_10191609
817 Ga0207711_10446789
818 Ga0207689_11107175
819 Ga0207661_10162599
820 Ga0207679_10065660
821 Ga0207679_10117363
822 Ga0207679_11629105
823 Ga0207651_10007898
824 Ga0207651_10200932
825 Ga0207651_10442937
826 Ga0207651_10979338
827 Ga0207651_11012153
828 Ga0207651_11590194
829 Ga0207712_10041655
830 Ga0207712_10136891
831 Ga0207668_10010258
832 Ga0207668_10020817
833 Ga0207668_10106690
834 Ga0207668_10142626
835 Ga0207668_10259890
836 Ga0207668_10274387
837 Ga0207668_10855243
838 Ga0207640_10270633
839 Ga0207640_10737315
840 Ga0207640_11175929
841 Ga0207658_10788476
842 Ga0207639_10587999
843 Ga0207678_10000746
844 Ga0207678_10033178
845 Ga0207678_10136115
846 Ga0207648_10015998
847 Ga0207648_10623528
848 Ga0207676_10025317
849 Ga0207674_10046306
850 Ga0207674_10113311
851 Ga0207674_10228457
852 Ga0207674_10958319
853 Ga0207675_100001317
854 Ga0207683_10135351
855 Ga0207683_10632424
856 Ga0207698_12056983
857 Ga0209970_1021407
858 Ga0209974_10005701
859 Ga0209974_10025077
860 Ga0209974_10149600
861 Ga0207428_10146283
862 Ga0268266_10002428
863 Ga0268266_10006479
864 Ga0268265_10015482
865 Ga0268265_10169407
866 Ga0268265_10355072
867 Ga0268264_11208463
868 Ga0316176_1130815
869 Ga0314311_1217840
870 Ga0316180_1192854
871 Ga0316183_1009445
872 Ga0316182_1111562
873 Ga0316182_1353257
874 Ga0316182_1411167
875 Ga0265327_10156806
876 Ga0307408_100044776
877 Ga0307408_100083186
878 Ga0307408_100129318
879 Ga0307408_100222652
880 Ga0307408_100229118
881 Ga0307408_100289596
882 Ga0307408_100494288
883 Ga0307408_101073935
884 Ga0307408_101493315
885 Ga0316579_10012053
886 Ga0307405_10016238
887 Ga0307405_10022125
888 Ga0307405_10108500
889 Ga0307405_10117564
890 Ga0307405_10117656
891 Ga0307405_10223351
892 Ga0307405_10456734
893 Ga0307405_10546712
894 Ga0307405_10655388
895 Ga0307405_10739850
896 Ga0307413_10001416
897 Ga0307413_10002347
898 Ga0307413_10009080
899 Ga0307413_10009412
900 Ga0307413_10010707
901 Ga0307413_10010909
902 Ga0307413_10012453
903 Ga0307413_10016879
904 Ga0307413_10026240
905 Ga0307413_10088005
906 Ga0307413_10088896
907 Ga0307413_10090727
908 Ga0307413_10095257
909 Ga0307413_10275057
910 Ga0307413_10420571
911 Ga0307413_10512436
912 Ga0307413_10866659
913 Ga0307413_11070707
914 Ga0307413_11250956
915 Ga0307413_11502128
916 Ga0307413_11537769
917 Ga0307410_10001153
918 Ga0307410_10002542
919 Ga0307410_10003195
920 Ga0307410_10006267
921 Ga0307410_10013340
922 Ga0307410_10016102
923 Ga0307410_10016264
924 Ga0307410_10025301
925 Ga0307410_10042112
926 Ga0307410_10053248
927 Ga0307410_10060037
928 Ga0307410_10074035
929 Ga0307410_10094297
930 Ga0307410_10232218
931 Ga0307410_10279730
932 Ga0307410_10539247
933 Ga0307410_10615787
934 Ga0307410_10621536
935 Ga0307410_10667649
936 Ga0307410_11079122
937 Ga0307410_11154268
938 Ga0307406_10022213
939 Ga0307406_10048820
940 Ga0307406_10109298
941 Ga0307406_10245378
942 Ga0307406_10250127
943 Ga0307406_10303222
944 Ga0307406_10311693
945 Ga0307406_10468562
946 Ga0307406_10704764
947 Ga0307407_10001255
948 Ga0307407_10003308
949 Ga0307407_10007632
950 Ga0307407_10016972
951 Ga0307407_10037455
952 Ga0307407_10066119
953 Ga0307407_10088467
954 Ga0307407_10131310
955 Ga0307407_10363499
956 Ga0307412_10004147
957 Ga0307412_10019765
958 Ga0307412_10056849
959 Ga0307412_10059803
960 Ga0307412_10109709
961 Ga0307412_10164005
962 Ga0307412_10208006
963 Ga0307412_10395566
964 Ga0307412_10454046
965 Ga0307412_10810404
966 Ga0307412_11482962
967 Ga0307409_100011036
968 Ga0307409_100020016
969 Ga0307409_100023061
970 Ga0307409_100030301
971 Ga0307409_100045186
972 Ga0307409_100060778
973 Ga0307409_100106243
974 Ga0307409_100111302
975 Ga0307409_100112479
976 Ga0307409_100119545
977 Ga0307409_100144236
978 Ga0307409_100146597
979 Ga0307409_100197549
980 Ga0307409_100208522
981 Ga0307409_100252316
982 Ga0307409_100265807
983 Ga0307409_100540166
984 Ga0307409_100803797
985 Ga0307409_100882752
986 Ga0307409_100962057
987 Ga0307409_101398556
988 Ga0307409_102142402
989 Ga0307409_102849573
990 Ga0307416_100013987
991 Ga0307416_100032191
992 Ga0307416_100037765
993 Ga0307416_100053804
994 Ga0307416_100079205
995 Ga0307416_100158379
996 Ga0307416_100170797
997 Ga0307416_100201079
998 Ga0307416_100422780
999 Ga0307416_100429022
1000 Ga0307416_100870081
1001 Ga0307416_101097567
1002 Ga0307416_101506818
1003 Ga0307416_101522723
1004 Ga0307416_101987275
1005 Ga0307414_10001742
1006 Ga0307414_10001927
1007 Ga0307414_10011892
1008 Ga0307414_10011948
1009 Ga0307414_10022701
1010 Ga0307414_10038644
1011 Ga0307414_10066100
1012 Ga0307414_10082181
1013 Ga0307414_10111872
1014 Ga0307414_10132858
1015 Ga0307414_10172503
1016 Ga0307414_10303873
1017 Ga0307414_10305192
1018 Ga0307414_10505527
1019 Ga0307414_10508512
1020 Ga0307414_10589809
1021 Ga0307414_10875622
1022 Ga0307414_11051147
1023 Ga0307414_11098467
1024 Ga0307414_11316645
1025 Ga0307414_11368750
1026 Ga0307411_10005387
1027 Ga0307411_10005628
1028 Ga0307411_10012445
1029 Ga0307411_10017405
1030 Ga0307411_10038256
1031 Ga0307411_10092305
1032 Ga0307411_10103647
1033 Ga0307411_10117103
1034 Ga0307411_10121420
1035 Ga0307411_10157831
1036 Ga0307411_10209981
1037 Ga0307411_10271708
1038 Ga0307411_10332651
1039 Ga0307411_10431998
1040 Ga0307411_10545196
1041 Ga0307411_10878868
1042 Ga0307411_10994509
1043 Ga0307411_11007955
1044 Ga0307411_11712313
1045 Ga0307411_11742845
1046 Ga0307411_11758987
1047 Ga0307411_12130599
1048 Ga0307415_100000171
1049 Ga0307415_100012229
1050 Ga0307415_100015026
1051 Ga0307415_100019886
1052 Ga0307415_100121231
1053 Ga0307415_100212688
1054 Ga0307415_100313701
1055 Ga0307415_100516973
1056 Ga0307415_100709624
1057 Ga0307415_100757529
1058 Ga0316583_10271937
1059 Ga0316593_10000323
1060 Ga0316593_10041902
1061 Ga0316586_1041004
1062 Ga0373937_0162454
1063 Ga0395899_0015179
1064 Ga0395899_0041242
1065 Ga0395900_0001407
1066 Ga0395900_0317673
1067 Ga0395898_0134781
1068 Ga0395905_0000541
1069 Ga0395905_0301206
1070 Ga0395905_0373221
1071 Ga0395905_0450645
1072 Ga0395905_0482615
1073 Ga0395905_0501051
1074 Ga0395901_0025266
1075 Ga0395901_0036664
1076 Ga0395901_0126468
1077 Ga0436365_0124207
1078 Ga0436360_0482827
1079 Ga0436363_0662017
1080 Ga0436363_1649312
1081 Ga0436362_0376260
1082 Ga0451807_2405185
1083 Ga0439433_0088908
1084 Ga0439443_001733
1085 Ga0439445_0001028
1086 Ga0439449_0053990
1087 Ga0439452_063356
1088 Ga0439462_0203653
1089 Ga0450895_025401
1090 Ga0450905_057911
1091 Ga0439464_0004857
1092 Ga0439460_0197986
1093 Ga0466966_0000021
1094 Ga0466968_0168267
1095 Ga0466970_0145602
1096 Ga0466960_0266130
1097 Ga0495607_0018419
1098 Ga0495616_0126274
1099 Ga0495663_0001226
1100 Ga0495663_0004571
1101 Ga0495663_0007736
1102 Ga0495663_0010805
1103 Ga0495663_0347821
1104 Ga0495642_0140004
1105 Ga0495642_0315775
1106 Ga0495598_0026338
1107 Ga0495621_0004360
1108 Ga0495621_0005588
1109 Ga0495621_0026657
1110 Ga0495633_0016375
1111 Ga0495633_0060247
1112 Ga0495656_0539323
1113 Ga0495625_0308240
1114 Ga0495661_0173573
1115 Ga0495669_0001697
1116 Ga0495670_0013579
1117 Ga0495670_0044296
1118 Ga0495670_0097210
1119 Ga0495670_0230158
1120 Ga0495670_0303641
1121 Ga0495670_0717378
1122 Ga0495677_0002911
1123 Ga0495677_0045622
1124 Ga0495673_0018833
1125 Ga0495681_0388534
1126 Ga0495686_0000100
1127 Ga0496101_0361748
1128 Ga0496102_1476151
1129 Ga0496109_0077848
1130 Ga0496117_0017171
1131 Ga0496117_0070534
1132 Ga0496118_0001340
1133 Ga0496118_0288474
1134 Ga0496121_0001202
1135 Ga0496121_0002347
1136 Ga0496121_0002899
1137 Ga0496121_0296819
1138 Ga0496123_0027265
1139 Ga0496124_0173206
1140 Ga0496126_0029428
1141 Ga0501290_000121
1142 Ga0501292_000051
1143 Ga0501294_001336
1144 Ga0501297_013879
1145 Ga0501300_014204
1146 Ga0501033_0162806
1147 Ga0501034_0110256
1148 Ga0501037_0184474
1149 Ga0501038_1176087
1150 Ga0501041_1006439
1151 Ga0501043_0100616
1152 Ga0501047_0309983
1153 Ga0501047_0911902
1154 Ga0501069_0035870
1155 Ga0501070_0014643
1156 Ga0501202_011193
1157 Ga0501202_018819
1158 Ga0501202_083965
1159 Ga0501206_000156
1160 Ga0501207_001401
1161 Ga0501207_034957
1162 Ga0501222_000337
1163 Ga0501223_000791
1164 Ga0501224_006625
1165 Ga0501227_001176
1166 Ga0501230_008367
1167 Ga0501235_007343
1168 Ga0501235_020736
1169 Ga0501235_158267
1170 Ga0501236_017647
1171 Ga0501243_009689
1172 Ga0501259_016802
1173 Ga0501261_000034
1174 Ga0501221_003874
1175 Ga0501221_025506
1176 Ga0501225_0002879
1177 Ga0501245_013175
1178 Ga0501263_002086
1179 Ga0501263_016990
1180 Ga0501264_019944
1181 Ga0501266_008390
1182 Ga0501268_003226
1183 Ga0501268_023591
1184 Ga0501272_011424
1185 Ga0501279_000036
1186 Ga0501280_000020
1187 Ga0501281_01062
1188 Ga0501282_000015
1189 Ga0501283_002170
1190 Ga0501283_070157
1191 Ga0501035_0265073
1192 Ga0501035_0599209
1193 Ga0501044_0130688
1194 Ga0501044_0202690
1195 Ga0501044_0980735
1196 Ga0501044_1481774
1197 nmdc:mga0yw44_88329_c1
1198 nmdc:mga06r32_78148_c1
1199 nmdc:mga08y16_150258_c1
1200 nmdc:mga08y16_224170_c1
1201 nmdc:mga0n895_443986_c1
1202 nmdc:mga0rr50_1834546_c1
1203 Ga0495655_0008463
1204 Ga0500566_0036040
1205 Ga0500592_000541
1206 Ga0500608_070196
1207 Ga0500559_0018982
1208 Ga0500573_0130044
1209 Ga0500627_0281268
1210 Ga0500587_000112
1211 Ga0590071_099333
1212 Ga0590075_029370
1213 Ga0501082_0689033
1214 2885429307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

55

123

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pl3-assembly2.cif.gz_B cytochrome domain of cellobiose dehydrogenase, m65h mutant 0.5358 35 50
4ncr-assembly2.cif.gz_B crystal structure of m. tuberculosis dpre1 in complex with pbtz169 0.3653 35 58
4jn5-assembly2.cif.gz_B crystal structures of the first condensation domain of the cda synthetase 0.3548 19 54
2mky-assembly1.cif.gz_A structure of the prgk first periplasmic domain 0.329 19 45
7plo-assembly1.cif.gz_3 h. sapiens replisome-cul2/lrr1 complex 0.244 30 81
ID Description Score Start End Superfamily
af_A0A1D6E9H4_7_153_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.718 36 50 2.40.50.140
af_Q9W2M0_570_621_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6928 36 49 3.30.40.10
af_A0A0R4IAE5_301_520_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6021 32 50 2.120.10.80
5vi9A02 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5987 36 50 3.30.200.20
af_P10080_177_283_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.5885 36 50 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A258H836-F1-model_v4 Uncharacterized protein 0.9835 10 149
AF-A0A173KV35-F1-model_v4 UPF0260 protein EP837_01454 0.9824 9 149
AF-A0A249MRQ2-F1-model_v4 YcgN family cysteine cluster protein 0.9824 9 149
AF-A0A0C2V3L1-F1-model_v4 Uncharacterized protein 0.9796 28 145
AF-A0A291N4U0-F1-model_v4 UPF0260 protein A6768_21175 0.9795 9 149

Map