F468717

General Info

Members Datasets Scaffolds Average Seq Length
607 370 532 261

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0320300|Ga0436365_0320300_408_1358
Length 303
Sequence MRIATYNVNGINGRLPNLLAWLEEAAPNVVCLQELKAPDDKFPGAAVRAAGYGAVWHGQKSWNGVAILARDTQPAEIRRGLPGDPDDAHSRYIEAAIDGMIVGCLYLPNGNPAPGPKFDYKLRWFQRLTEHAQELLATGEPVVLAGDFNVMPTDLDVYAPERWVDDALFRPEVREAYRCLVARGWTDALRALYPGERVYTFWKYFRNAFGRDAGLRIDHLLVSPSLAARLIAGGVDRNVRGREHASDHAPAWIELAERPHASPNRGSFSAGTVASTPTLRPRTFSSSPSSAATRMPAMPNTET

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
3 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
6 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
7 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
8 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
9 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
10 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
11 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
12 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
13 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
14 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
15 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
16 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
17 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
18 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
19 2643221599 Rhizobium sp. Root708 Isolate Unclassified
20 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
21 2643221688 Rhizobium sp. Root482 Isolate Unclassified
22 2643221693 Rhizobium sp. Root491 Isolate Unclassified
23 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
24 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
25 2718217882 Rhizobium sp. N741 Isolate Nodule
26 2718218009 Rhizobium sp. N561 Isolate Nodule
27 2718218363 Rhizobium sp. N113 Isolate Nodule
28 2718218365 Rhizobium sp. N731 Isolate Nodule
29 2718218366 Rhizobium sp. N621 Isolate Nodule
30 2721755514 Rhizobium sp. N6212 Isolate Nodule
31 2721755810 Rhizobium sp. N871 Isolate Nodule
32 2728369365 Rhizobium sp. N1341 Isolate Nodule
33 2728369397 Rhizobium sp. N1314 Isolate Nodule
34 2738541293 Rhizobium sp. GV031 Isolate Unclassified
35 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
36 2791355264 Rhizobium sp. S9 Isolate Nodule
37 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
38 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
39 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
40 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
41 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
42 2857564685 Duganella sp. R-74599 Isolate Unclassified
43 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
44 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
45 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
46 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
47 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
48 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
49 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
50 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
51 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
52 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
53 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
54 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
55 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
56 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
57 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
58 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
59 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
60 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
187 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
223 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
337 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
340 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
350 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
360 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
361 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
362 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
363 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
364 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
365 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
366 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
367 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
368 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
369 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
370 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.15
Metatranscriptomes 0.49
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 14.33
Nodule 5.6
Rhizoplane 1.48
Rhizosphere 65.57
Stem 0
Stem Tuber 0
Unclassified 12.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000859 3300002987 Bacteria 13230
2 JGI25159J45721_1001040 3300002987 Bacteria 11866
3 JGI25159J45721_1003776 3300002987 Bacteria 5225
4 JGI25165J46597_1000007 3300003214 Bacteria 518996
5 JGI25165J46597_1005525 3300003214 Bacteria 2417
6 JGI25153J46596_10024811 3300003215 Bacteria 2154
7 rootH1_10057858 3300003323 Bacteria 4541
8 JGI25160J50197_1000252 3300003354 Bacteria 40935
9 JGI25160J50197_1001444 3300003354 Bacteria 11882
10 JGI25161J50226_1000185 3300003374 Bacteria 40935
11 JGI25161J50226_1000795 3300003374 Bacteria 11882
12 Ga0055539_1006888 3300003752 Bacteria 1448
13 Ga0055526_1004525 3300003771 Bacteria 8314
14 Ga0055524_1003408 3300003775 Bacteria 7725
15 Ga0055528_1000760 3300003790 Bacteria 22503
16 Ga0055540_1000439 3300003792 Bacteria 32821
17 Ga0055540_1006835 3300003792 Bacteria 4439
18 Ga0055531_10003632 3300003794 Bacteria 9734
19 Ga0055531_10004825 3300003794 Bacteria 8047
20 Ga0055531_10011720 3300003794 Bacteria 4195
21 Ga0055543_1000249 3300004625 Bacteria 40973
22 Ga0055543_1000809 3300004625 Bacteria 15419
23 Ga0065165_1000044 3300005262 Bacteria 203774
24 Ga0065165_1000824 3300005262 Bacteria 40973
25 Ga0065165_1002494 3300005262 Bacteria 15419
26 Ga0065714_10067355 3300005288 Bacteria 5609
27 Ga0068869_100046108 3300005334 Bacteria 3142
28 Ga0070680_100018410 3300005336 Bacteria 5518
29 Ga0070671_100014711 3300005355 Bacteria 6324
30 Ga0070674_100003805 3300005356 Bacteria 8529
31 Ga0070673_100103670 3300005364 Bacteria 2347
32 Ga0070673_100309432 3300005364 Bacteria 1393
33 Ga0070667_100210760 3300005367 Bacteria 1727
34 Ga0070714_100224365 3300005435 Bacteria 1728
35 Ga0070713_100070894 3300005436 Bacteria 2943
36 Ga0070713_100320413 3300005436 Bacteria 1431
37 Ga0070711_100014279 3300005439 Bacteria 5000
38 Ga0070663_100018359 3300005455 Bacteria 4584
39 Ga0070678_100000306 3300005456 Bacteria 22717
40 Ga0070678_100170783 3300005456 Bacteria 1771
41 Ga0070681_10009722 3300005458 Bacteria 9463
42 Ga0070681_10050360 3300005458 Bacteria 4156
43 Ga0070681_10052932 3300005458 Bacteria 4047
44 Ga0070681_10114615 3300005458 Bacteria 2634
45 Ga0070699_100213222 3300005518 Bacteria 1719
46 Ga0070679_100168601 3300005530 Bacteria 2162
47 Ga0070679_100242190 3300005530 Bacteria 1761
48 Ga0070679_100343774 3300005530 Bacteria 1440
49 Ga0068853_100005680 3300005539 Bacteria 9810
50 Ga0068853_100033372 3300005539 Unclassified 4367
51 Ga0070665_100003036 3300005548 Bacteria 18089
52 Ga0070665_100003151 3300005548 Bacteria 17741
53 Ga0070665_100005211 3300005548 Bacteria 13450
54 Ga0070665_100035256 3300005548 Bacteria 5031
55 Ga0070665_100054166 3300005548 Bacteria 4023
56 Ga0070665_100109546 3300005548 Bacteria 2764
57 Ga0070665_100357211 3300005548 Bacteria 1467
58 Ga0068855_100299976 3300005563 Bacteria 1779
59 Ga0068855_100706410 3300005563 Bacteria 1079
60 Ga0068857_100211983 3300005577 Unclassified 1768
61 Ga0068854_100473545 3300005578 Bacteria 1050
62 Ga0068856_100155011 3300005614 Bacteria 2300
63 Ga0068856_100301500 3300005614 Bacteria 1620
64 Ga0068859_100039259 3300005617 Bacteria 4749
65 Ga0068864_100126788 3300005618 Bacteria 2288
66 Ga0068863_100017047 3300005841 Bacteria 6966
67 Ga0068860_100007748 3300005843 Bacteria 10729
68 Ga0068860_100537278 3300005843 Bacteria 1170
69 Ga0068862_100023064 3300005844 Bacteria 5213
70 Ga0070717_10525440 3300006028 Bacteria 1071
71 Ga0075365_10078362 3300006038 Bacteria 2234
72 Ga0075364_10072685 3300006051 Bacteria 2267
73 Ga0070712_100242984 3300006175 Bacteria 1435
74 Ga0075369_10076040 3300006186 Bacteria 1484
75 Ga0075366_10168388 3300006195 Bacteria 1329
76 Ga0097621_100046882 3300006237 Bacteria 3499
77 Ga0097621_100057001 3300006237 Bacteria 3193
78 Ga0075370_10023884 3300006353 Bacteria 3371
79 Ga0068871_100080721 3300006358 Bacteria 2693
80 Ga0075436_100322103 3300006914 Bacteria 1110
81 Ga0097620_100039259 3300006931 Bacteria 4749
82 Ga0099826_10000038 3300006948 Bacteria 101106
83 Ga0099795_10007993 3300007788 Bacteria 2989
84 Ga0105240_10003294 3300009093 Bacteria 25240
85 Ga0105240_10004022 3300009093 Bacteria 22634
86 Ga0105240_10009140 3300009093 Bacteria 14067
87 Ga0105240_10093216 3300009093 Bacteria 3676
88 Ga0105240_10373983 3300009093 Bacteria 1610
89 Ga0105240_10552493 3300009093 Bacteria 1274
90 Ga0111539_10215994 3300009094 Bacteria 2234
91 Ga0111539_10816202 3300009094 Bacteria 1085
92 Ga0105247_10111209 3300009101 Bacteria 1764
93 Ga0105243_10000308 3300009148 Bacteria 54026
94 Ga0105242_10006722 3300009176 Bacteria 8873
95 Ga0105237_10000028 3300009545 Bacteria 201366
96 Ga0105237_10000038 3300009545 Bacteria 190707
97 Ga0105237_10011270 3300009545 Bacteria 9459
98 Ga0105237_10199379 3300009545 Bacteria 2001
99 Ga0105238_10527440 3300009551 Bacteria 1184
100 Ga0099796_10056641 3300010159 Bacteria 1376
101 Ga0105239_10000065 3300010375 Bacteria 151224
102 Ga0105239_10000918 3300010375 Bacteria 41658
103 Ga0105239_10001636 3300010375 Bacteria 29551
104 Ga0105239_10002418 3300010375 Bacteria 23771
105 Ga0105239_10090153 3300010375 Bacteria 3383
106 Ga0105239_10339940 3300010375 Bacteria 1694
107 Ga0157373_10001149 3300013100 Bacteria 20277
108 Ga0157370_10000054 3300013104 Bacteria 118718
109 Ga0163162_10077655 3300013306 Bacteria 3384
110 Ga0157372_10016648 3300013307 Bacteria 7891
111 Ga0157372_10220105 3300013307 Bacteria 2201
112 Ga0157372_10229023 3300013307 Bacteria 2154
113 Ga0157372_10515208 3300013307 Bacteria 1394
114 Ga0157372_10779420 3300013307 Bacteria 1111
115 Ga0182008_10000299 3300014497 Bacteria 38806
116 Ga0182008_10124547 3300014497 Bacteria 1282
117 Ga0157379_10131101 3300014968 Bacteria 2257
118 Ga0163161_10036910 3300017792 Bacteria 3501
119 Ga0213876_10000722 3300021384 Bacteria 23019
120 Ga0209436_109442 3300025208 Bacteria 1856
121 Ga0209437_100261 3300025233 Bacteria 82127
122 Ga0209677_100525 3300025253 Bacteria 21305
123 Ga0209233_1000026 3300025261 Bacteria 678466
124 Ga0209233_1000214 3300025261 Bacteria 108975
125 Ga0209673_1000165 3300025273 Bacteria 138061
126 Ga0209673_1029421 3300025273 Bacteria 1750
127 Ga0209130_1000089 3300025284 Bacteria 152711
128 Ga0209130_1000482 3300025284 Bacteria 40987
129 Ga0209130_1001325 3300025284 Bacteria 16827
130 Ga0209676_1013255 3300025292 Bacteria 3181
131 Ga0209025_1001648 3300025294 Bacteria 27540
132 Ga0209025_1001673 3300025294 Bacteria 27174
133 Ga0209025_1033646 3300025294 Bacteria 2363
134 Ga0209025_1049308 3300025294 Bacteria 1696
135 Ga0209564_1003504 3300025295 Bacteria 10643
136 Ga0209564_1015820 3300025295 Bacteria 3047
137 Ga0209758_1000170 3300025297 Bacteria 149476
138 Ga0209256_1000144 3300025299 Bacteria 151157
139 Ga0209256_1052691 3300025299 Bacteria 977
140 Ga0207426_1000462 3300025302 Bacteria 63167
141 Ga0207426_1001895 3300025302 Bacteria 15179
142 Ga0209051_1000192 3300025303 Bacteria 108667
143 Ga0209051_1001025 3300025303 Bacteria 26597
144 Ga0209257_1000300 3300025304 Bacteria 108786
145 Ga0209257_1006780 3300025304 Bacteria 7210
146 Ga0207696_1000106 3300025711 Bacteria 159964
147 Ga0207692_10190147 3300025898 Bacteria 1201
148 Ga0207647_10011540 3300025904 Bacteria 6191
149 Ga0207645_10360171 3300025907 Bacteria 974
150 Ga0207707_10011776 3300025912 Bacteria 7609
151 Ga0207707_10074419 3300025912 Bacteria 2962
152 Ga0207707_10427771 3300025912 Bacteria 1134
153 Ga0207695_10004032 3300025913 Bacteria 20213
154 Ga0207695_10005241 3300025913 Bacteria 17323
155 Ga0207695_10019958 3300025913 Bacteria 7696
156 Ga0207695_10048486 3300025913 Bacteria 4485
157 Ga0207695_10558830 3300025913 Bacteria 1026
158 Ga0207671_10000418 3300025914 Bacteria 58941
159 Ga0207671_10015821 3300025914 Bacteria 5886
160 Ga0207693_10177596 3300025915 Bacteria 1675
161 Ga0207663_10083199 3300025916 Bacteria 2102
162 Ga0207652_10093110 3300025921 Bacteria 2651
163 Ga0207652_10283898 3300025921 Bacteria 1493
164 Ga0207652_10300587 3300025921 Bacteria 1449
165 Ga0207694_10190305 3300025924 Bacteria 1667
166 Ga0207694_10303046 3300025924 Bacteria 1316
167 Ga0207694_10444588 3300025924 Bacteria 1082
168 Ga0207687_10049717 3300025927 Bacteria 2917
169 Ga0207690_10000560 3300025932 Bacteria 24270
170 Ga0207690_10026894 3300025932 Bacteria 3629
171 Ga0207686_10002271 3300025934 Bacteria 10550
172 Ga0207669_10002638 3300025937 Bacteria 7683
173 Ga0207661_10064175 3300025944 Bacteria 2976
174 Ga0207667_10032412 3300025949 Bacteria 5632
175 Ga0207667_10272605 3300025949 Bacteria 1730
176 Ga0207651_10200640 3300025960 Bacteria 1598
177 Ga0207668_10152568 3300025972 Bacteria 1790
178 Ga0207640_10471579 3300025981 Bacteria 1039
179 Ga0207658_10024155 3300025986 Bacteria 4250
180 Ga0207677_10012976 3300026023 Bacteria 4814
181 Ga0207677_10159223 3300026023 Bacteria 1752
182 Ga0207703_10035945 3300026035 Bacteria 3940
183 Ga0207639_10004475 3300026041 Bacteria 9433
184 Ga0207639_10039561 3300026041 Unclassified 3514
185 Ga0207678_10007267 3300026067 Bacteria 9818
186 Ga0207702_10106162 3300026078 Bacteria 2488
187 Ga0207702_10230131 3300026078 Bacteria 1732
188 Ga0207702_10241730 3300026078 Bacteria 1692
189 Ga0207641_10071501 3300026088 Bacteria 2984
190 Ga0207676_10084321 3300026095 Bacteria 2590
191 Ga0207683_10008495 3300026121 Bacteria 8786
192 Ga0207683_10008731 3300026121 Bacteria 8652
193 Ga0207683_10137049 3300026121 Bacteria 2203
194 Ga0207698_10097046 3300026142 Bacteria 2431
195 Ga0209371_1023347 3300027312 Bacteria 1457
196 Ga0209282_1000093 3300027666 Bacteria 62036
197 Ga0209971_1001802 3300027682 Bacteria 5247
198 Ga0209974_10001618 3300027876 Bacteria 8150
199 Ga0268266_10001732 3300028379 Bacteria 24974
200 Ga0268266_10004368 3300028379 Bacteria 13582
201 Ga0268266_10004733 3300028379 Bacteria 12937
202 Ga0268266_10061451 3300028379 Bacteria 3240
203 Ga0268266_10164644 3300028379 Bacteria 2008
204 Ga0268265_10038671 3300028380 Bacteria 3511
205 Ga0268264_10017332 3300028381 Bacteria 5902
206 Ga0268264_10430490 3300028381 Bacteria 1274
207 Ga0307517_10108368 3300028786 Bacteria 2133
208 Ga0307515_10000569 3300028794 Bacteria 87068
209 Ga0307515_10392928 3300028794 Bacteria 1015
210 Ga0265338_10014046 3300028800 Bacteria 8966
211 Ga0265338_10246141 3300028800 Bacteria 1321
212 Ga0268256_1026249 3300030500 Bacteria 1466
213 Ga0307511_10000046 3300030521 Bacteria 100284
214 Ga0307511_10008113 3300030521 Bacteria 10513
215 Ga0316183_1079280 3300030742 Bacteria 54147
216 Ga0316181_1053827 3300030744 Bacteria 9172
217 Ga0265340_10072734 3300031247 Bacteria 1628
218 Ga0307408_100005956 3300031548 Bacteria 8122
219 Ga0307408_100006588 3300031548 Bacteria 7701
220 Ga0307408_100021693 3300031548 Bacteria 4350
221 Ga0265313_10058149 3300031595 Bacteria 1823
222 Ga0307405_10021259 3300031731 Bacteria 3643
223 Ga0307413_10014691 3300031824 Bacteria 3987
224 Ga0307413_10071834 3300031824 Bacteria 2182
225 Ga0307413_10514519 3300031824 Bacteria 964
226 Ga0307410_10002563 3300031852 Bacteria 8810
227 Ga0307406_10007763 3300031901 Bacteria 5963
228 Ga0307406_10009632 3300031901 Bacteria 5429
229 Ga0307406_10024470 3300031901 Bacteria 3607
230 Ga0307406_10057836 3300031901 Bacteria 2489
231 Ga0307407_10005436 3300031903 Bacteria 5528
232 Ga0307412_10040283 3300031911 Bacteria 3022
233 Ga0307412_10040892 3300031911 Bacteria 3002
234 Ga0307409_100029655 3300031995 Bacteria 3918
235 Ga0307409_100157120 3300031995 Bacteria 1983
236 Ga0307416_100015363 3300032002 Bacteria 5286
237 Ga0307416_100042662 3300032002 Bacteria 3543
238 Ga0307416_100075669 3300032002 Bacteria 2818
239 Ga0307416_100094441 3300032002 Bacteria 2579
240 Ga0307416_100318052 3300032002 Bacteria 1557
241 Ga0307414_10039076 3300032004 Bacteria 3193
242 Ga0307414_10129600 3300032004 Unclassified 1956
243 Ga0307411_10002464 3300032005 Bacteria 8196
244 Ga0307411_10028882 3300032005 Bacteria 3378
245 Ga0307415_100017399 3300032126 Bacteria 4309
246 Ga0307415_100058167 3300032126 Bacteria 2660
247 Ga0307415_100149965 3300032126 Bacteria 1793
248 Ga0307415_100223232 3300032126 Bacteria 1512
249 Ga0373936_0023715 3300035113 Bacteria 2393
250 Ga0373939_0004485 3300035114 Bacteria 3306
251 Ga0373954_0031902 3300035118 Bacteria 2434
252 Ga0373955_0174033 3300035172 Bacteria 1275
253 Ga0373933_0018203 3300035724 Bacteria 3948
254 Ga0373933_0027778 3300035724 Bacteria 3261
255 Ga0373937_0000909 3300036401 Bacteria 25167
256 Ga0373937_0056321 3300036401 Bacteria 3610
257 Ga0395899_0001202 3300037312 Bacteria 22725
258 Ga0395900_0000006 3300037418 Bacteria 495364
259 Ga0395900_0000495 3300037418 Bacteria 55568
260 Ga0395900_0029423 3300037418 Bacteria 5635
261 Ga0395900_0064281 3300037418 Bacteria 3772
262 Ga0395898_0029609 3300037466 Bacteria 5480
263 Ga0395898_0107784 3300037466 Bacteria 2672
264 Ga0395905_0098156 3300037471 Bacteria 2751
265 Ga0395905_0107622 3300037471 Bacteria 2617
266 Ga0395905_0132470 3300037471 Bacteria 2344
267 Ga0395905_0244977 3300037471 Bacteria 1675
268 Ga0395905_0687141 3300037471 Bacteria 926
269 Ga0436364_0801868 3300037853 Bacteria 1117
270 Ga0436364_1210875 3300037853 Bacteria 16114
271 Ga0395901_0000001 3300038443 Bacteria 800383
272 Ga0395901_0000094 3300038443 Bacteria 120153
273 Ga0395901_0106778 3300038443 Bacteria 2939
274 Ga0395901_0395074 3300038443 Bacteria 1421
275 Ga0436365_0320300 3300039437 Bacteria 2151
276 Ga0436365_0969535 3300039437 Bacteria 1526
277 Ga0436365_1140201 3300039437 Bacteria 1572
278 Ga0436365_1664331 3300039437 Bacteria 31697
279 Ga0436365_1666840 3300039437 Bacteria 7995
280 Ga0436360_0139976 3300039438 Bacteria 870
281 Ga0436360_0187655 3300039438 Bacteria 1575
282 Ga0436361_0120332 3300039447 Bacteria 1472
283 Ga0436361_0852213 3300039447 Bacteria 2155
284 Ga0436361_1059495 3300039447 Bacteria 2212
285 Ga0436363_0599542 3300039450 Bacteria 5604
286 Ga0436363_0983892 3300039450 Bacteria 1011
287 Ga0436362_0887806 3300039453 Bacteria 2658
288 Ga0439465_0000751 3300041413 Bacteria 10045
289 Ga0439465_0086851 3300041413 Bacteria 1066
290 Ga0439445_0001786 3300042004 Bacteria 4739
291 Ga0439448_0002686 3300042005 Bacteria 4857
292 Ga0439449_0009832 3300042007 Bacteria 3620
293 Ga0439450_004212 3300042008 Bacteria 2441
294 Ga0439455_0008184 3300042012 Bacteria 2236
295 Ga0439464_0061606 3300042439 Bacteria 1099
296 Ga0466965_0281923 3300044683 Bacteria 898
297 Ga0466966_0260678 3300044684 Bacteria 1044
298 Ga0466963_0013078 3300044694 Bacteria 5090
299 Ga0466964_0000805 3300044706 Bacteria 10230
300 Ga0466970_0004643 3300044765 Bacteria 6778
301 Ga0466957_0062317 3300044842 Bacteria 2290
302 Ga0466959_0227486 3300045049 Bacteria 1292
303 Ga0451576_0255673 3300045051 Bacteria 1831
304 Ga0451576_0299115 3300045051 Bacteria 1683
305 Ga0466958_0150978 3300045836 Bacteria 1465
306 Ga0466967_0025766 3300045976 Bacteria 4854
307 Ga0466967_0151751 3300045976 Bacteria 2166
308 Ga0466967_0281495 3300045976 Bacteria 1596
309 Ga0495592_0376004 3300046454 Bacteria 905
310 Ga0495638_0000435 3300046460 Bacteria 50498
311 Ga0495638_0012345 3300046460 Bacteria 5857
312 Ga0495650_0000089 3300046471 Bacteria 233415
313 Ga0495650_0078312 3300046471 Bacteria 1280
314 Ga0495580_0257483 3300046472 Bacteria 1194
315 Ga0495605_0015613 3300046474 Bacteria 4126
316 Ga0495605_0037226 3300046474 Bacteria 2449
317 Ga0495584_0002107 3300046491 Bacteria 11402
318 Ga0495585_0000353 3300046492 Bacteria 44438
319 Ga0495596_0000230 3300046500 Bacteria 37798
320 Ga0495596_0000680 3300046500 Bacteria 21142
321 Ga0495596_0003120 3300046500 Bacteria 8553
322 Ga0495596_0007022 3300046500 Bacteria 5116
323 Ga0495607_0084043 3300046501 Bacteria 1742
324 Ga0495583_0001156 3300046506 Bacteria 28740
325 Ga0495606_0000104 3300046507 Bacteria 143973
326 Ga0495606_0005710 3300046507 Bacteria 11774
327 Ga0495610_0010646 3300046512 Bacteria 5696
328 Ga0495616_0001403 3300046513 Bacteria 16778
329 Ga0495616_0018893 3300046513 Bacteria 3769
330 Ga0495620_0088732 3300046515 Bacteria 1242
331 Ga0495631_0132465 3300046518 Bacteria 1071
332 Ga0495637_0050020 3300046520 Bacteria 1754
333 Ga0495643_0121666 3300046522 Bacteria 1318
334 Ga0495643_0140209 3300046522 Bacteria 1206
335 Ga0495663_0014075 3300046525 Bacteria 2240
336 Ga0495642_0126915 3300046528 Bacteria 1097
337 Ga0495652_0265727 3300046529 Bacteria 1264
338 Ga0495654_0105144 3300046530 Bacteria 1294
339 Ga0495640_0062489 3300046533 Bacteria 2526
340 Ga0495586_0261947 3300046535 Bacteria 987
341 Ga0495587_0292772 3300046536 Bacteria 911
342 Ga0495609_0018871 3300046538 Bacteria 3194
343 Ga0495621_0040351 3300046539 Bacteria 1635
344 Ga0495597_0014554 3300046542 Bacteria 3742
345 Ga0495597_0038721 3300046542 Bacteria 2136
346 Ga0495622_0000023 3300046557 Bacteria 155188
347 Ga0495633_0035246 3300046558 Bacteria 2403
348 Ga0495633_0039557 3300046558 Bacteria 2251
349 Ga0495668_0003498 3300046616 Bacteria 11713
350 Ga0495668_0031616 3300046616 Bacteria 2983
351 Ga0495668_0044564 3300046616 Bacteria 2465
352 Ga0495611_0000015 3300046648 Bacteria 129696
353 Ga0495625_0063484 3300046660 Bacteria 2608
354 Ga0495625_0112793 3300046660 Bacteria 1857
355 Ga0495659_0008291 3300046664 Bacteria 3308
356 Ga0495661_0002896 3300046665 Bacteria 12980
357 Ga0495669_0024527 3300046684 Bacteria 2626
358 Ga0495670_0088646 3300046691 Bacteria 1581
359 Ga0495649_0054829 3300046694 Bacteria 2155
360 Ga0495589_0006133 3300046794 Bacteria 6349
361 Ga0495660_0019879 3300046810 Bacteria 3852
362 Ga0495636_0025214 3300047318 Bacteria 2413
363 Ga0495672_0048766 3300047320 Bacteria 2510
364 Ga0495672_0071824 3300047320 Bacteria 1957
365 Ga0495676_0103809 3300047321 Bacteria 2098
366 Ga0495683_0000151 3300047323 Bacteria 68310
367 Ga0495683_0015726 3300047323 Bacteria 3929
368 Ga0495683_0039967 3300047323 Bacteria 2370
369 Ga0495687_065245 3300047443 Bacteria 1483
370 Ga0495673_0020397 3300047469 Bacteria 3300
371 Ga0495681_0000507 3300047470 Bacteria 29753
372 Ga0495686_0000895 3300047472 Bacteria 37513
373 Ga0495686_0015440 3300047472 Bacteria 5213
374 Ga0495686_0032214 3300047472 Bacteria 3394
375 Ga0495686_0127526 3300047472 Bacteria 1511
376 Ga0496100_0189635 3300048903 Bacteria 1492
377 Ga0496101_0086018 3300048904 Bacteria 2331
378 Ga0496102_0239706 3300048905 Bacteria 1710
379 Ga0496112_0055478 3300048915 Bacteria 3896
380 Ga0496112_0561337 3300048915 Bacteria 1075
381 Ga0496116_0003190 3300048919 Bacteria 16402
382 Ga0496116_0029315 3300048919 Bacteria 3970
383 Ga0496116_0171601 3300048919 Bacteria 1174
384 Ga0496116_0231723 3300048919 Bacteria 936
385 Ga0496117_0000105 3300048920 Bacteria 188970
386 Ga0496117_0001492 3300048920 Bacteria 33537
387 Ga0496117_0015700 3300048920 Bacteria 6432
388 Ga0496118_0000168 3300048921 Bacteria 118938
389 Ga0496118_0002150 3300048921 Bacteria 27498
390 Ga0496118_0043064 3300048921 Bacteria 3554
391 Ga0496118_0054763 3300048921 Bacteria 3018
392 Ga0496119_0000443 3300048922 Bacteria 56795
393 Ga0496119_0000887 3300048922 Bacteria 39179
394 Ga0496119_0003427 3300048922 Bacteria 16468
395 Ga0496119_0167008 3300048922 Bacteria 1165
396 Ga0496120_0000818 3300048923 Bacteria 44506
397 Ga0496120_0001956 3300048923 Bacteria 22555
398 Ga0496120_0005310 3300048923 Bacteria 10329
399 Ga0496121_0007960 3300048924 Bacteria 12661
400 Ga0496121_0010573 3300048924 Bacteria 10375
401 Ga0496121_0011835 3300048924 Bacteria 9609
402 Ga0496121_0018333 3300048924 Bacteria 7064
403 Ga0496121_0208404 3300048924 Bacteria 1387
404 Ga0496121_0251829 3300048924 Bacteria 1224
405 Ga0496122_0001241 3300048925 Bacteria 43048
406 Ga0496122_0002116 3300048925 Bacteria 29353
407 Ga0496122_0023636 3300048925 Bacteria 5407
408 Ga0496122_0024254 3300048925 Bacteria 5312
409 Ga0496122_0108481 3300048925 Bacteria 1831
410 Ga0496123_0001704 3300048926 Bacteria 29372
411 Ga0496123_0078263 3300048926 Bacteria 2026
412 Ga0496124_0000254 3300048927 Bacteria 103551
413 Ga0496124_0002483 3300048927 Bacteria 24047
414 Ga0496125_0005508 3300048928 Bacteria 14035
415 Ga0496126_0019649 3300048929 Bacteria 6649
416 Ga0496126_0060022 3300048929 Bacteria 3422
417 Ga0496126_0135972 3300048929 Bacteria 2120
418 Ga0496126_0463257 3300048929 Bacteria 1018
419 Ga0501031_0050149 3300049568 Bacteria 2720
420 Ga0501031_0387248 3300049568 Bacteria 904
421 Ga0501032_0031140 3300049569 Bacteria 3658
422 Ga0501032_0221206 3300049569 Bacteria 1232
423 Ga0501033_0049424 3300049570 Bacteria 3121
424 Ga0501034_0021544 3300049571 Bacteria 6567
425 Ga0501034_0036262 3300049571 Bacteria 4995
426 Ga0501034_0040943 3300049571 Bacteria 4688
427 Ga0501034_0068225 3300049571 Bacteria 3567
428 Ga0501034_0093632 3300049571 Bacteria 3001
429 Ga0501034_0141786 3300049571 Bacteria 2382
430 Ga0501034_0336890 3300049571 Bacteria 1439
431 Ga0501036_0008992 3300049572 Bacteria 8214
432 Ga0501036_0022398 3300049572 Bacteria 5314
433 Ga0501037_0002781 3300049573 Bacteria 12670
434 Ga0501037_0147244 3300049573 Bacteria 1684
435 Ga0501038_0000719 3300049574 Bacteria 29592
436 Ga0501038_0055560 3300049574 Bacteria 3401
437 Ga0501038_0059032 3300049574 Bacteria 3287
438 Ga0501038_0078454 3300049574 Bacteria 2786
439 Ga0501039_0007166 3300049575 Bacteria 8493
440 Ga0501039_0210862 3300049575 Bacteria 1528
441 Ga0501043_0001293 3300049579 Bacteria 21959
442 Ga0501043_0018589 3300049579 Bacteria 5453
443 Ga0501043_0073913 3300049579 Bacteria 2677
444 Ga0501043_0102304 3300049579 Bacteria 2252
445 Ga0501043_0152822 3300049579 Bacteria 1806
446 Ga0501046_0000870 3300049580 Bacteria 29401
447 Ga0501046_0213584 3300049580 Bacteria 1431
448 Ga0501047_0006799 3300049581 Bacteria 10745
449 Ga0501047_0057841 3300049581 Bacteria 3748
450 Ga0501047_0301652 3300049581 Bacteria 1444
451 Ga0501047_0486964 3300049581 Bacteria 1061
452 Ga0501048_0064234 3300049582 Bacteria 2596
453 Ga0501048_0226349 3300049582 Bacteria 1327
454 Ga0501067_0032064 3300049583 Bacteria 2915
455 Ga0501068_0002004 3300049584 Bacteria 10828
456 Ga0501069_0000173 3300049585 Bacteria 28962
457 Ga0501070_0010809 3300049586 Bacteria 7711
458 Ga0501071_0206603 3300049587 Bacteria 1476
459 Ga0501071_0563766 3300049587 Bacteria 875
460 Ga0501072_0359538 3300049588 Bacteria 1156
461 Ga0501073_0005108 3300049589 Bacteria 9843
462 Ga0501073_0025376 3300049589 Bacteria 4251
463 Ga0501074_0018024 3300049590 Bacteria 5129
464 Ga0501077_0175530 3300049593 Bacteria 1361
465 Ga0501235_038440 3300049669 Bacteria 1091
466 Ga0501079_0056713 3300049741 Bacteria 3023
467 Ga0501080_0003033 3300049742 Bacteria 14816
468 Ga0501080_0386393 3300049742 Bacteria 1261
469 Ga0501080_0435063 3300049742 Bacteria 1177
470 Ga0501080_0561802 3300049742 Bacteria 1016
471 Ga0501083_0062191 3300049744 Bacteria 2491
472 Ga0501035_0000761 3300049822 Bacteria 34698
473 Ga0501035_0002936 3300049822 Bacteria 16408
474 Ga0501035_0004337 3300049822 Bacteria 13460
475 Ga0501035_0076286 3300049822 Bacteria 2964
476 Ga0501035_0081566 3300049822 Bacteria 2855
477 Ga0501035_0088379 3300049822 Bacteria 2730
478 Ga0501035_0098864 3300049822 Bacteria 2562
479 Ga0501035_0182226 3300049822 Bacteria 1809
480 Ga0501035_0219717 3300049822 Bacteria 1623
481 Ga0501044_0001378 3300049823 Bacteria 28512
482 Ga0501044_0009708 3300049823 Bacteria 10469
483 Ga0501044_0032797 3300049823 Bacteria 5459
484 Ga0501044_0047292 3300049823 Bacteria 4450
485 Ga0501044_0052558 3300049823 Bacteria 4197
486 Ga0501044_0104048 3300049823 Bacteria 2853
487 Ga0501044_0116371 3300049823 Bacteria 2679
488 Ga0501044_0281915 3300049823 Bacteria 1595
489 Ga0501044_0519168 3300049823 Bacteria 1091
490 nmdc:mga00v17_62245_c1 3300050491 Bacteria 2295
491 nmdc:mga0yw44_120165_c1 3300050492 Bacteria 1692
492 nmdc:mga0yw44_81891_c1 3300050492 Bacteria 2024
493 nmdc:mga0k408_160305_c1 3300050493 Bacteria 1340
494 nmdc:mga06z11_235656_c1 3300050494 Bacteria 1073
495 nmdc:mga05p37_496978_c1 3300050507 Bacteria 1401
496 nmdc:mga08y16_228982_c1 3300050511 Bacteria 1922
497 nmdc:mga0sz30_61644_c1 3300050516 Bacteria 1603
498 Ga0495601_0044228 3300053077 Bacteria 2799
499 Ga0495619_0036333 3300053085 Bacteria 3207
500 Ga0500646_0023416 3300053090 Bacteria 1656
501 Ga0500641_0000215 3300053096 Bacteria 21838
502 Ga0500650_0000740 3300053098 Bacteria 8834
503 Ga0500556_0000096 3300053104 Bacteria 82203
504 Ga0500562_000451 3300053108 Bacteria 10026
505 Ga0500569_017589 3300053109 Bacteria 1830
506 Ga0500592_000483 3300053116 Bacteria 6589
507 Ga0500608_000668 3300053122 Bacteria 12543
508 Ga0500618_000019 3300053125 Bacteria 161916
509 Ga0500618_000118 3300053125 Bacteria 64472
510 Ga0500618_005648 3300053125 Bacteria 3773
511 Ga0500652_000248 3300053131 Bacteria 20322
512 Ga0500568_0000115 3300053139 Bacteria 72862
513 Ga0500568_0000509 3300053139 Bacteria 28652
514 Ga0500577_0135051 3300053142 Bacteria 1037
515 Ga0500590_021736 3300053148 Bacteria 3329
516 Ga0500604_0000069 3300053151 Bacteria 37014
517 Ga0500616_0000108 3300053153 Bacteria 152917
518 Ga0500616_0000835 3300053153 Bacteria 34593
519 Ga0500616_0001606 3300053153 Bacteria 21050
520 Ga0500616_0002508 3300053153 Bacteria 15198
521 Ga0500627_0001228 3300053158 Bacteria 7064
522 Ga0500627_0096673 3300053158 Bacteria 1324
523 Ga0500633_0000138 3300053160 Bacteria 9646
524 Ga0500634_0084591 3300053161 Bacteria 1625
525 Ga0500611_008299 3300053727 Bacteria 1601
526 Ga0501084_0000769 3300054114 Bacteria 24411
527 Ga0501084_0010651 3300054114 Bacteria 7611
528 Ga0590071_005517 3300059421 Bacteria 3039
529 Ga0587091_020514 3300059511 Bacteria 1148
530 Ga0587062_011051 3300059639 Bacteria 1131
531 Ga0587072_021504 3300059643 Bacteria 1145
532 Ga0501082_0016299 3300060353 Bacteria 6396

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025898 Ga0207692_10190147 Ga0207692_101901472 230
2 3300003214 JGI25165J46597_1000007 JGI25165J46597_100000731 243
3 3300025261 Ga0209233_1000026 Ga0209233_100002632 243
4 3300005563 Ga0068855_100706410 Ga0068855_1007064101 244
5 3300009093 Ga0105240_10552493 Ga0105240_105524932 244
6 3300025913 Ga0207695_10558830 Ga0207695_105588301 244
7 3300026078 Ga0207702_10230131 Ga0207702_102301312 244
8 3300045051 Ga0451576_0299115 Ga0451576_0299115_523_1383 244
9 3300049571 Ga0501034_0093632 Ga0501034_0093632_481_1236 244
10 3300049822 Ga0501035_0219717 Ga0501035_0219717_303_1058 244
11 3300049823 Ga0501044_0047292 Ga0501044_0047292_1856_2611 244
12 3300049568 Ga0501031_0387248 Ga0501031_0387248_12_767 245
13 3300049823 Ga0501044_0104048 Ga0501044_0104048_691_1464 246
14 3300048924 Ga0496121_0208404 Ga0496121_0208404_150_929 249
15 3300049587 Ga0501071_0206603 Ga0501071_0206603_220_972 250
16 3300010159 Ga0099796_10056641 Ga0099796_100566411 252
17 iso_pu_bacteria 2687453257 2688070008 252
18 iso_pu_bacteria 2751185897 2753763350 252
19 iso_pu_bacteria 2941499720 2941506566 252
20 iso_pu_bacteria 8016522445 8016529478 252
21 iso_pu_bacteria 8016530956 8016534689 252
22 iso_pu_bacteria 8016539877 8016547906 252
23 iso_pu_bacteria 8016548790 8016554225 252
24 iso_pu_bacteria 8016557553 8016562599 252
25 iso_pu_bacteria 8016566248 8016573039 252
26 iso_pu_bacteria 8016575299 8016577186 252
27 iso_pu_bacteria 8016595262 8016600387 252
28 iso_pu_bacteria 8019530166 8019534455 252
29 3300009093 Ga0105240_10003294 Ga0105240_1000329426 253
30 3300025913 Ga0207695_10005241 Ga0207695_100052418 253
31 3300046522 Ga0495643_0121666 Ga0495643_0121666_543_1307 253
32 3300046522 Ga0495643_0140209 Ga0495643_0140209_97_858 253
33 3300049571 Ga0501034_0141786 Ga0501034_0141786_596_1390 253
34 iso_pu_bacteria 2510917026 2511169692 253
35 iso_pu_bacteria 2513237146 2513923596 253
36 iso_pu_bacteria 2582581299 2585228030 253
37 iso_pu_bacteria 2585427633 2585994195 253
38 iso_pu_bacteria 2599185170 2599415623 253
39 iso_pu_bacteria 2643221634 2644195412 253
40 iso_pu_bacteria 2894652903 2894655114 253
41 iso_pu_bacteria 2919171160 2919172240 253
42 iso_pu_bacteria 2933016740 2933019571 253
43 iso_pu_bacteria 3005416602 3005419833 253
44 3300048922 Ga0496119_0167008 Ga0496119_0167008_13_783 254
45 3300049742 Ga0501080_0386393 Ga0501080_0386393_416_1189 254
46 iso_pu_bacteria 2513237138 2513871530 254
47 iso_pu_bacteria 2554235003 2554249216 254
48 iso_pu_bacteria 2554235003 2554249779 254
49 iso_pu_bacteria 2582581308 2585282755 254
50 iso_pu_bacteria 2599185236 2599722931 254
51 iso_pu_bacteria 2600255279 2601612992 254
52 iso_pu_bacteria 2600255308 2601749726 254
53 iso_pu_bacteria 2615840626 2616309895 254
54 iso_pu_bacteria 2615840698 2616550848 254
55 iso_pu_bacteria 2643221551 2643774685 254
56 iso_pu_bacteria 2643221555 2643793130 254
57 iso_pu_bacteria 2643221599 2644005635 254
58 iso_pu_bacteria 2643221693 2644520073 254
59 iso_pu_bacteria 2667528174 2671117208 254
60 iso_pu_bacteria 2738541293 2738804450 254
61 iso_pu_bacteria 2808606387 2808989805 254
62 iso_pu_bacteria 2818991448 2819613775 254
63 iso_pu_bacteria 2899845264 2899848165 254
64 iso_pu_bacteria 2920107658 2920111879 254
65 iso_pu_bacteria 2933594066 2933598839 254
66 iso_pu_bacteria 2979089926 2979091921 254
67 iso_pu_bacteria 2979095461 2979100864 254
68 iso_pu_bacteria 2979100975 2979103116 254
69 iso_pu_bacteria 2984587000 2984588998 254
70 iso_pu_bacteria 2984601300 2984606482 254
71 iso_pu_bacteria 3005445848 3005452556 254
72 iso_pu_bacteria 8005619151 8005626110 254
73 3300005844 Ga0068862_100023064 Ga0068862_1000230644 255
74 3300013306 Ga0163162_10077655 Ga0163162_100776552 255
75 3300013307 Ga0157372_10016648 Ga0157372_100166482 255
76 3300025972 Ga0207668_10152568 Ga0207668_101525681 255
77 3300028380 Ga0268265_10038671 Ga0268265_100386712 255
78 3300028800 Ga0265338_10014046 Ga0265338_100140463 255
79 3300030742 Ga0316183_1079280 Ga0316183_107928023 255
80 3300030744 Ga0316181_1053827 Ga0316181_10538278 255
81 3300038443 Ga0395901_0395074 Ga0395901_0395074_14_784 255
82 3300039438 Ga0436360_0187655 Ga0436360_0187655_456_1289 255
83 3300039447 Ga0436361_0852213 Ga0436361_0852213_367_1134 255
84 3300039450 Ga0436363_0599542 Ga0436363_0599542_1542_2360 255
85 3300046558 Ga0495633_0035246 Ga0495633_0035246_120_890 255
86 3300049587 Ga0501071_0563766 Ga0501071_0563766_31_798 255
87 3300049593 Ga0501077_0175530 Ga0501077_0175530_374_1213 255
88 iso_pu_bacteria 2643221599 2644005428 255
89 iso_pu_bacteria 2808606418 2809143512 255
90 iso_pu_bacteria 2838035591 2838035738 255
91 iso_pu_bacteria 2857564685 2857568494 255
92 3300005334 Ga0068869_100046108 Ga0068869_1000461084 256
93 3300005336 Ga0070680_100018410 Ga0070680_1000184102 256
94 3300005355 Ga0070671_100014711 Ga0070671_1000147115 256
95 3300005364 Ga0070673_100309432 Ga0070673_1003094322 256
96 3300005367 Ga0070667_100210760 Ga0070667_1002107602 256
97 3300005455 Ga0070663_100018359 Ga0070663_1000183592 256
98 3300005458 Ga0070681_10009722 Ga0070681_100097222 256
99 3300005458 Ga0070681_10050360 Ga0070681_100503605 256
100 3300005458 Ga0070681_10052932 Ga0070681_100529325 256
101 3300005530 Ga0070679_100168601 Ga0070679_1001686014 256
102 3300005530 Ga0070679_100242190 Ga0070679_1002421902 256
103 3300005539 Ga0068853_100033372 Ga0068853_1000333722 256
104 3300005548 Ga0070665_100005211 Ga0070665_1000052116 256
105 3300005548 Ga0070665_100054166 Ga0070665_1000541664 256
106 3300005563 Ga0068855_100299976 Ga0068855_1002999763 256
107 3300005617 Ga0068859_100039259 Ga0068859_1000392594 256
108 3300005618 Ga0068864_100126788 Ga0068864_1001267882 256
109 3300005841 Ga0068863_100017047 Ga0068863_1000170474 256
110 3300005843 Ga0068860_100007748 Ga0068860_1000077483 256
111 3300005843 Ga0068860_100537278 Ga0068860_1005372782 256
112 3300006038 Ga0075365_10078362 Ga0075365_100783622 256
113 3300006186 Ga0075369_10076040 Ga0075369_100760401 256
114 3300006931 Ga0097620_100039259 Ga0097620_1000392594 256
115 3300009093 Ga0105240_10093216 Ga0105240_100932163 256
116 3300009094 Ga0111539_10816202 Ga0111539_108162022 256
117 3300009545 Ga0105237_10011270 Ga0105237_1001127010 256
118 3300009551 Ga0105238_10527440 Ga0105238_105274402 256
119 3300010375 Ga0105239_10001636 Ga0105239_100016363 256
120 3300010375 Ga0105239_10090153 Ga0105239_100901533 256
121 3300013307 Ga0157372_10779420 Ga0157372_107794202 256
122 3300014497 Ga0182008_10000299 Ga0182008_100002997 256
123 3300014968 Ga0157379_10131101 Ga0157379_101311013 256
124 3300021384 Ga0213876_10000722 Ga0213876_100007225 256
125 3300025294 Ga0209025_1001673 Ga0209025_10016739 256
126 3300025294 Ga0209025_1033646 Ga0209025_10336462 256
127 3300025904 Ga0207647_10011540 Ga0207647_100115402 256
128 3300025912 Ga0207707_10011776 Ga0207707_100117763 256
129 3300025912 Ga0207707_10074419 Ga0207707_100744192 256
130 3300025913 Ga0207695_10019958 Ga0207695_100199583 256
131 3300025913 Ga0207695_10048486 Ga0207695_100484863 256
132 3300025914 Ga0207671_10015821 Ga0207671_100158214 256
133 3300025921 Ga0207652_10093110 Ga0207652_100931102 256
134 3300025921 Ga0207652_10300587 Ga0207652_103005872 256
135 3300025924 Ga0207694_10444588 Ga0207694_104445882 256
136 3300025927 Ga0207687_10049717 Ga0207687_100497173 256
137 3300025932 Ga0207690_10000560 Ga0207690_1000056021 256
138 3300025932 Ga0207690_10026894 Ga0207690_100268944 256
139 3300025944 Ga0207661_10064175 Ga0207661_100641752 256
140 3300025949 Ga0207667_10032412 Ga0207667_100324128 256
141 3300025981 Ga0207640_10471579 Ga0207640_104715791 256
142 3300026023 Ga0207677_10012976 Ga0207677_100129764 256
143 3300026023 Ga0207677_10159223 Ga0207677_101592232 256
144 3300026041 Ga0207639_10039561 Ga0207639_100395611 256
145 3300026067 Ga0207678_10007267 Ga0207678_100072676 256
146 3300026078 Ga0207702_10241730 Ga0207702_102417303 256
147 3300026088 Ga0207641_10071501 Ga0207641_100715013 256
148 3300026095 Ga0207676_10084321 Ga0207676_100843212 256
149 3300026121 Ga0207683_10137049 Ga0207683_101370493 256
150 3300027682 Ga0209971_1001802 Ga0209971_10018023 256
151 3300027876 Ga0209974_10001618 Ga0209974_100016185 256
152 3300028379 Ga0268266_10004733 Ga0268266_100047336 256
153 3300028379 Ga0268266_10061451 Ga0268266_100614513 256
154 3300028381 Ga0268264_10017332 Ga0268264_100173323 256
155 3300028381 Ga0268264_10430490 Ga0268264_104304901 256
156 3300028786 Ga0307517_10108368 Ga0307517_101083682 256
157 3300031548 Ga0307408_100005956 Ga0307408_1000059564 256
158 3300031548 Ga0307408_100021693 Ga0307408_1000216932 256
159 3300031731 Ga0307405_10021259 Ga0307405_100212592 256
160 3300031824 Ga0307413_10014691 Ga0307413_100146912 256
161 3300031824 Ga0307413_10071834 Ga0307413_100718342 256
162 3300031824 Ga0307413_10514519 Ga0307413_105145191 256
163 3300031852 Ga0307410_10002563 Ga0307410_100025633 256
164 3300031901 Ga0307406_10007763 Ga0307406_100077635 256
165 3300031901 Ga0307406_10024470 Ga0307406_100244702 256
166 3300031901 Ga0307406_10057836 Ga0307406_100578362 256
167 3300031903 Ga0307407_10005436 Ga0307407_100054365 256
168 3300031911 Ga0307412_10040892 Ga0307412_100408923 256
169 3300031995 Ga0307409_100157120 Ga0307409_1001571202 256
170 3300032002 Ga0307416_100015363 Ga0307416_1000153632 256
171 3300032002 Ga0307416_100042662 Ga0307416_1000426623 256
172 3300032002 Ga0307416_100075669 Ga0307416_1000756693 256
173 3300032002 Ga0307416_100094441 Ga0307416_1000944413 256
174 3300032002 Ga0307416_100318052 Ga0307416_1003180522 256
175 3300032004 Ga0307414_10039076 Ga0307414_100390762 256
176 3300032004 Ga0307414_10129600 Ga0307414_101296002 256
177 3300032005 Ga0307411_10002464 Ga0307411_100024643 256
178 3300032005 Ga0307411_10028882 Ga0307411_100288823 256
179 3300032126 Ga0307415_100017399 Ga0307415_1000173993 256
180 3300032126 Ga0307415_100058167 Ga0307415_1000581672 256
181 3300032126 Ga0307415_100149965 Ga0307415_1001499652 256
182 3300032126 Ga0307415_100223232 Ga0307415_1002232323 256
183 3300035113 Ga0373936_0023715 Ga0373936_0023715_1160_1933 256
184 3300037418 Ga0395900_0064281 Ga0395900_0064281_705_1475 256
185 3300037853 Ga0436364_1210875 Ga0436364_1210875_6871_7641 256
186 3300038443 Ga0395901_0106778 Ga0395901_0106778_1217_1987 256
187 3300039437 Ga0436365_1664331 Ga0436365_1664331_6820_7593 256
188 3300039438 Ga0436360_0139976 Ga0436360_0139976_41_811 256
189 3300039447 Ga0436361_0120332 Ga0436361_0120332_212_982 256
190 3300039450 Ga0436363_0983892 Ga0436363_0983892_113_886 256
191 3300042004 Ga0439445_0001786 Ga0439445_0001786_3784_4554 256
192 3300044684 Ga0466966_0260678 Ga0466966_0260678_141_911 256
193 3300045976 Ga0466967_0281495 Ga0466967_0281495_387_1172 256
194 3300046460 Ga0495638_0012345 Ga0495638_0012345_3391_4191 256
195 3300046501 Ga0495607_0084043 Ga0495607_0084043_797_1597 256
196 3300046512 Ga0495610_0010646 Ga0495610_0010646_2888_3688 256
197 3300046513 Ga0495616_0018893 Ga0495616_0018893_740_1540 256
198 3300046515 Ga0495620_0088732 Ga0495620_0088732_342_1142 256
199 3300046518 Ga0495631_0132465 Ga0495631_0132465_212_1012 256
200 3300046520 Ga0495637_0050020 Ga0495637_0050020_584_1384 256
201 3300046525 Ga0495663_0014075 Ga0495663_0014075_167_937 256
202 3300046528 Ga0495642_0126915 Ga0495642_0126915_267_1037 256
203 3300046530 Ga0495654_0105144 Ga0495654_0105144_121_921 256
204 3300046539 Ga0495621_0040351 Ga0495621_0040351_701_1471 256
205 3300046558 Ga0495633_0039557 Ga0495633_0039557_1258_2058 256
206 3300046648 Ga0495611_0000015 Ga0495611_0000015_126080_126916 256
207 3300046665 Ga0495661_0002896 Ga0495661_0002896_8091_8891 256
208 3300046684 Ga0495669_0024527 Ga0495669_0024527_637_1407 256
209 3300046691 Ga0495670_0088646 Ga0495670_0088646_658_1428 256
210 3300046810 Ga0495660_0019879 Ga0495660_0019879_980_1780 256
211 3300047472 Ga0495686_0032214 Ga0495686_0032214_730_1530 256
212 3300048919 Ga0496116_0171601 Ga0496116_0171601_206_1006 256
213 3300048925 Ga0496122_0024254 Ga0496122_0024254_1945_2745 256
214 3300048926 Ga0496123_0078263 Ga0496123_0078263_579_1379 256
215 3300048929 Ga0496126_0060022 Ga0496126_0060022_1666_2466 256
216 3300049669 Ga0501235_038440 Ga0501235_038440_281_1051 256
217 3300050492 nmdc:mga0yw44_120165_c1 nmdc:mga0yw44_120165_c1_797_1597 256
218 3300050492 nmdc:mga0yw44_81891_c1 nmdc:mga0yw44_81891_c1_99_929 256
219 3300050516 nmdc:mga0sz30_61644_c1 nmdc:mga0sz30_61644_c1_69_869 256
220 3300053096 Ga0500641_0000215 Ga0500641_0000215_4481_5281 256
221 3300053098 Ga0500650_0000740 Ga0500650_0000740_6788_7588 256
222 3300053108 Ga0500562_000451 Ga0500562_000451_4703_5503 256
223 3300053109 Ga0500569_017589 Ga0500569_017589_235_1035 256
224 3300053116 Ga0500592_000483 Ga0500592_000483_3595_4395 256
225 3300053131 Ga0500652_000248 Ga0500652_000248_13468_14268 256
226 3300053139 Ga0500568_0000115 Ga0500568_0000115_7701_8501 256
227 3300053151 Ga0500604_0000069 Ga0500604_0000069_25152_25952 256
228 3300053158 Ga0500627_0001228 Ga0500627_0001228_3378_4178 256
229 3300053161 Ga0500634_0084591 Ga0500634_0084591_254_1054 256
230 3300053727 Ga0500611_008299 Ga0500611_008299_70_870 256
231 iso_pu_bacteria 2643221688 2644492142 256
232 iso_pu_bacteria 2929154850 2929157556 256
233 iso_pu_bacteria 2989349275 2989350587 256
234 3300003215 JGI25153J46596_10024811 JGI25153J46596_100248112 257
235 3300003323 rootH1_10057858 rootH1_100578584 257
236 3300003792 Ga0055540_1006835 Ga0055540_10068352 257
237 3300003794 Ga0055531_10003632 Ga0055531_100036328 257
238 3300005288 Ga0065714_10067355 Ga0065714_1006735512 257
239 3300005356 Ga0070674_100003805 Ga0070674_1000038054 257
240 3300005364 Ga0070673_100103670 Ga0070673_1001036704 257
241 3300005456 Ga0070678_100000306 Ga0070678_10000030615 257
242 3300005456 Ga0070678_100170783 Ga0070678_1001707832 257
243 3300005577 Ga0068857_100211983 Ga0068857_1002119832 257
244 3300006237 Ga0097621_100046882 Ga0097621_1000468823 257
245 3300009093 Ga0105240_10009140 Ga0105240_100091402 257
246 3300009148 Ga0105243_10000308 Ga0105243_1000030821 257
247 3300009545 Ga0105237_10000028 Ga0105237_1000002828 257
248 3300013307 Ga0157372_10515208 Ga0157372_105152081 257
249 3300025233 Ga0209437_100261 Ga0209437_10026125 257
250 3300025292 Ga0209676_1013255 Ga0209676_10132552 257
251 3300025294 Ga0209025_1049308 Ga0209025_10493082 257
252 3300025297 Ga0209758_1000170 Ga0209758_100017019 257
253 3300025303 Ga0209051_1001025 Ga0209051_100102512 257
254 3300025907 Ga0207645_10360171 Ga0207645_103601711 257
255 3300025913 Ga0207695_10004032 Ga0207695_100040322 257
256 3300025937 Ga0207669_10002638 Ga0207669_100026386 257
257 3300025960 Ga0207651_10200640 Ga0207651_102006403 257
258 3300026121 Ga0207683_10008731 Ga0207683_100087314 257
259 3300026142 Ga0207698_10097046 Ga0207698_100970462 257
260 3300028794 Ga0307515_10000569 Ga0307515_1000056928 257
261 3300028794 Ga0307515_10392928 Ga0307515_103929281 257
262 3300030521 Ga0307511_10000046 Ga0307511_1000004645 257
263 3300031595 Ga0265313_10058149 Ga0265313_100581493 257
264 3300037853 Ga0436364_0801868 Ga0436364_0801868_140_913 257
265 3300039437 Ga0436365_1140201 Ga0436365_1140201_740_1525 257
266 3300039437 Ga0436365_1666840 Ga0436365_1666840_413_1186 257
267 3300044694 Ga0466963_0013078 Ga0466963_0013078_2604_3380 257
268 3300044765 Ga0466970_0004643 Ga0466970_0004643_3897_4673 257
269 3300044842 Ga0466957_0062317 Ga0466957_0062317_165_941 257
270 3300045049 Ga0466959_0227486 Ga0466959_0227486_118_894 257
271 3300045051 Ga0451576_0255673 Ga0451576_0255673_780_1553 257
272 3300045836 Ga0466958_0150978 Ga0466958_0150978_208_984 257
273 3300045976 Ga0466967_0025766 Ga0466967_0025766_1799_2575 257
274 3300046460 Ga0495638_0000435 Ga0495638_0000435_38469_39242 257
275 3300046474 Ga0495605_0015613 Ga0495605_0015613_2946_3719 257
276 3300046491 Ga0495584_0002107 Ga0495584_0002107_5875_6648 257
277 3300046492 Ga0495585_0000353 Ga0495585_0000353_31955_32728 257
278 3300046500 Ga0495596_0000680 Ga0495596_0000680_14091_14864 257
279 3300046500 Ga0495596_0003120 Ga0495596_0003120_3688_4461 257
280 3300046500 Ga0495596_0007022 Ga0495596_0007022_1630_2406 257
281 3300046506 Ga0495583_0001156 Ga0495583_0001156_7701_8474 257
282 3300046513 Ga0495616_0001403 Ga0495616_0001403_11650_12423 257
283 3300046529 Ga0495652_0265727 Ga0495652_0265727_248_1021 257
284 3300046536 Ga0495587_0292772 Ga0495587_0292772_23_796 257
285 3300046538 Ga0495609_0018871 Ga0495609_0018871_1059_1832 257
286 3300046542 Ga0495597_0038721 Ga0495597_0038721_1060_1836 257
287 3300046557 Ga0495622_0000023 Ga0495622_0000023_58428_59201 257
288 3300046616 Ga0495668_0003498 Ga0495668_0003498_4106_4879 257
289 3300046616 Ga0495668_0044564 Ga0495668_0044564_1193_1966 257
290 3300046660 Ga0495625_0063484 Ga0495625_0063484_674_1447 257
291 3300046660 Ga0495625_0112793 Ga0495625_0112793_214_990 257
292 3300047318 Ga0495636_0025214 Ga0495636_0025214_1291_2064 257
293 3300047320 Ga0495672_0071824 Ga0495672_0071824_238_1011 257
294 3300047323 Ga0495683_0000151 Ga0495683_0000151_32315_33088 257
295 3300047323 Ga0495683_0015726 Ga0495683_0015726_2285_3061 257
296 3300047469 Ga0495673_0020397 Ga0495673_0020397_2223_2996 257
297 3300047472 Ga0495686_0127526 Ga0495686_0127526_584_1360 257
298 3300048924 Ga0496121_0251829 Ga0496121_0251829_187_960 257
299 3300053090 Ga0500646_0023416 Ga0500646_0023416_677_1450 257
300 3300053139 Ga0500568_0000509 Ga0500568_0000509_16581_17354 257
301 3300053142 Ga0500577_0135051 Ga0500577_0135051_119_892 257
302 3300053148 Ga0500590_021736 Ga0500590_021736_1779_2552 257
303 3300053153 Ga0500616_0000835 Ga0500616_0000835_13303_14076 257
304 3300053153 Ga0500616_0001606 Ga0500616_0001606_11272_12045 257
305 3300053153 Ga0500616_0002508 Ga0500616_0002508_2949_3722 257
306 3300053158 Ga0500627_0096673 Ga0500627_0096673_396_1169 257
307 3300059511 Ga0587091_020514 Ga0587091_020514_197_970 257
308 3300059639 Ga0587062_011051 Ga0587062_011051_195_968 257
309 3300059643 Ga0587072_021504 Ga0587072_021504_177_950 257
310 iso_pu_bacteria 2513237138 2513868138 257
311 iso_pu_bacteria 2582581867 2585401859 257
312 iso_pu_bacteria 2585427590 2585820273 257
313 iso_pu_bacteria 2615840624 2616293014 257
314 iso_pu_bacteria 2718217882 2719180567 257
315 iso_pu_bacteria 2718218009 2719731316 257
316 iso_pu_bacteria 2718218363 2721146661 257
317 iso_pu_bacteria 2718218365 2721158186 257
318 iso_pu_bacteria 2718218366 2721163540 257
319 iso_pu_bacteria 2721755514 2722839710 257
320 iso_pu_bacteria 2721755810 2724044072 257
321 iso_pu_bacteria 2728369365 2730163804 257
322 iso_pu_bacteria 2728369397 2730297818 257
323 iso_pu_bacteria 2791355264 2793350252 257
324 iso_pu_bacteria 2923556063 2923560507 257
325 iso_pu_bacteria 8005289223 8005293677 257
326 iso_pu_bacteria 8018127388 8018128375 257
327 3300002987 JGI25159J45721_1001040 JGI25159J45721_100104018 258
328 3300002987 JGI25159J45721_1003776 JGI25159J45721_10037768 258
329 3300003214 JGI25165J46597_1005525 JGI25165J46597_10055252 258
330 3300003354 JGI25160J50197_1000252 JGI25160J50197_100025236 258
331 3300003354 JGI25160J50197_1001444 JGI25160J50197_100144418 258
332 3300003374 JGI25161J50226_1000185 JGI25161J50226_100018536 258
333 3300003374 JGI25161J50226_1000795 JGI25161J50226_10007955 258
334 3300003752 Ga0055539_1006888 Ga0055539_10068883 258
335 3300003792 Ga0055540_1000439 Ga0055540_100043921 258
336 3300003794 Ga0055531_10004825 Ga0055531_100048257 258
337 3300003794 Ga0055531_10011720 Ga0055531_100117205 258
338 3300004625 Ga0055543_1000249 Ga0055543_100024936 258
339 3300004625 Ga0055543_1000809 Ga0055543_100080922 258
340 3300005262 Ga0065165_1000824 Ga0065165_100082411 258
341 3300005262 Ga0065165_1002494 Ga0065165_100249422 258
342 3300005548 Ga0070665_100003151 Ga0070665_1000031519 258
343 3300005578 Ga0068854_100473545 Ga0068854_1004735451 258
344 3300005614 Ga0068856_100301500 Ga0068856_1003015001 258
345 3300006948 Ga0099826_10000038 Ga0099826_1000003843 258
346 3300009101 Ga0105247_10111209 Ga0105247_101112092 258
347 3300009545 Ga0105237_10000038 Ga0105237_10000038156 258
348 3300009545 Ga0105237_10199379 Ga0105237_101993792 258
349 3300010375 Ga0105239_10000065 Ga0105239_100000659 258
350 3300010375 Ga0105239_10002418 Ga0105239_1000241818 258
351 3300013100 Ga0157373_10001149 Ga0157373_100011499 258
352 3300013104 Ga0157370_10000054 Ga0157370_10000054100 258
353 3300025208 Ga0209436_109442 Ga0209436_1094424 258
354 3300025253 Ga0209677_100525 Ga0209677_10052524 258
355 3300025261 Ga0209233_1000214 Ga0209233_100021433 258
356 3300025273 Ga0209673_1029421 Ga0209673_10294213 258
357 3300025284 Ga0209130_1000482 Ga0209130_100048236 258
358 3300025284 Ga0209130_1001325 Ga0209130_100132527 258
359 3300025294 Ga0209025_1001648 Ga0209025_10016487 258
360 3300025295 Ga0209564_1015820 Ga0209564_10158205 258
361 3300025299 Ga0209256_1052691 Ga0209256_10526911 258
362 3300025302 Ga0207426_1000462 Ga0207426_100046242 258
363 3300025302 Ga0207426_1001895 Ga0207426_10018955 258
364 3300025303 Ga0209051_1000192 Ga0209051_100019213 258
365 3300025304 Ga0209257_1000300 Ga0209257_1000300104 258
366 3300025914 Ga0207671_10000418 Ga0207671_100004188 258
367 3300027312 Ga0209371_1023347 Ga0209371_10233471 258
368 3300027666 Ga0209282_1000093 Ga0209282_100009333 258
369 3300028379 Ga0268266_10001732 Ga0268266_1000173211 258
370 3300030500 Ga0268256_1026249 Ga0268256_10262493 258
371 3300031911 Ga0307412_10040283 Ga0307412_100402834 258
372 3300037418 Ga0395900_0029423 Ga0395900_0029423_4096_4872 258
373 3300037466 Ga0395898_0107784 Ga0395898_0107784_1290_2066 258
374 3300037471 Ga0395905_0098156 Ga0395905_0098156_1855_2631 258
375 3300037471 Ga0395905_0244977 Ga0395905_0244977_235_1011 258
376 3300037471 Ga0395905_0687141 Ga0395905_0687141_119_895 258
377 3300039447 Ga0436361_1059495 Ga0436361_1059495_1111_1887 258
378 3300041413 Ga0439465_0000751 Ga0439465_0000751_6281_7057 258
379 3300041413 Ga0439465_0086851 Ga0439465_0086851_20_796 258
380 3300044683 Ga0466965_0281923 Ga0466965_0281923_80_856 258
381 3300047443 Ga0495687_065245 Ga0495687_065245_399_1175 258
382 3300047470 Ga0495681_0000507 Ga0495681_0000507_15279_16055 258
383 3300047472 Ga0495686_0000895 Ga0495686_0000895_12053_12832 258
384 3300047472 Ga0495686_0015440 Ga0495686_0015440_311_1087 258
385 3300048903 Ga0496100_0189635 Ga0496100_0189635_421_1197 258
386 3300048904 Ga0496101_0086018 Ga0496101_0086018_580_1356 258
387 3300048905 Ga0496102_0239706 Ga0496102_0239706_439_1215 258
388 3300048919 Ga0496116_0003190 Ga0496116_0003190_413_1189 258
389 3300048919 Ga0496116_0029315 Ga0496116_0029315_258_1034 258
390 3300048919 Ga0496116_0231723 Ga0496116_0231723_134_910 258
391 3300048920 Ga0496117_0000105 Ga0496117_0000105_34106_34882 258
392 3300048920 Ga0496117_0001492 Ga0496117_0001492_24704_25480 258
393 3300048920 Ga0496117_0015700 Ga0496117_0015700_2062_2838 258
394 3300048921 Ga0496118_0000168 Ga0496118_0000168_64468_65244 258
395 3300048921 Ga0496118_0002150 Ga0496118_0002150_18674_19450 258
396 3300048921 Ga0496118_0043064 Ga0496118_0043064_2640_3416 258
397 3300048921 Ga0496118_0054763 Ga0496118_0054763_1891_2667 258
398 3300048922 Ga0496119_0000443 Ga0496119_0000443_18370_19146 258
399 3300048922 Ga0496119_0000887 Ga0496119_0000887_34286_35062 258
400 3300048922 Ga0496119_0003427 Ga0496119_0003427_8065_8841 258
401 3300048923 Ga0496120_0000818 Ga0496120_0000818_17889_18665 258
402 3300048923 Ga0496120_0001956 Ga0496120_0001956_20434_21210 258
403 3300048923 Ga0496120_0005310 Ga0496120_0005310_1514_2290 258
404 3300048924 Ga0496121_0007960 Ga0496121_0007960_11482_12258 258
405 3300048924 Ga0496121_0010573 Ga0496121_0010573_8060_8836 258
406 3300048924 Ga0496121_0011835 Ga0496121_0011835_696_1472 258
407 3300048924 Ga0496121_0018333 Ga0496121_0018333_2978_3754 258
408 3300048925 Ga0496122_0001241 Ga0496122_0001241_34051_34827 258
409 3300048925 Ga0496122_0002116 Ga0496122_0002116_10506_11282 258
410 3300048925 Ga0496122_0023636 Ga0496122_0023636_4016_4792 258
411 3300048925 Ga0496122_0108481 Ga0496122_0108481_1012_1788 258
412 3300048926 Ga0496123_0001704 Ga0496123_0001704_10506_11282 258
413 3300048927 Ga0496124_0000254 Ga0496124_0000254_69368_70144 258
414 3300048927 Ga0496124_0002483 Ga0496124_0002483_8052_8828 258
415 3300048928 Ga0496125_0005508 Ga0496125_0005508_6045_6821 258
416 3300048929 Ga0496126_0019649 Ga0496126_0019649_1848_2624 258
417 3300048929 Ga0496126_0135972 Ga0496126_0135972_324_1100 258
418 3300048929 Ga0496126_0463257 Ga0496126_0463257_118_894 258
419 3300049569 Ga0501032_0221206 Ga0501032_0221206_253_1029 258
420 3300049571 Ga0501034_0021544 Ga0501034_0021544_3547_4323 258
421 3300049574 Ga0501038_0055560 Ga0501038_0055560_1114_1890 258
422 3300049579 Ga0501043_0018589 Ga0501043_0018589_2231_3007 258
423 3300049822 Ga0501035_0081566 Ga0501035_0081566_2040_2816 258
424 3300049822 Ga0501035_0182226 Ga0501035_0182226_765_1541 258
425 3300049823 Ga0501044_0116371 Ga0501044_0116371_1875_2669 258
426 3300049823 Ga0501044_0519168 Ga0501044_0519168_104_880 258
427 3300053122 Ga0500608_000668 Ga0500608_000668_6973_7749 258
428 3300053125 Ga0500618_000019 Ga0500618_000019_157478_158254 258
429 3300053125 Ga0500618_000118 Ga0500618_000118_40189_40965 258
430 3300053125 Ga0500618_005648 Ga0500618_005648_2302_3078 258
431 3300053153 Ga0500616_0000108 Ga0500616_0000108_114460_115236 258
432 3300053160 Ga0500633_0000138 Ga0500633_0000138_2158_2934 258
433 iso_pu_bacteria 2808606387 2808990275 258
434 iso_pu_bacteria 2857531043 2857535829 258
435 3300005548 Ga0070665_100109546 Ga0070665_1001095462 259
436 3300006195 Ga0075366_10168388 Ga0075366_101683882 259
437 3300017792 Ga0163161_10036910 Ga0163161_100369102 259
438 3300025924 Ga0207694_10303046 Ga0207694_103030463 259
439 3300028800 Ga0265338_10246141 Ga0265338_102461412 259
440 3300046471 Ga0495650_0000089 Ga0495650_0000089_100461_101252 259
441 3300046471 Ga0495650_0078312 Ga0495650_0078312_143_937 259
442 3300046474 Ga0495605_0037226 Ga0495605_0037226_366_1157 259
443 3300046500 Ga0495596_0000230 Ga0495596_0000230_3048_3860 259
444 3300046507 Ga0495606_0000104 Ga0495606_0000104_128456_129235 259
445 3300046694 Ga0495649_0054829 Ga0495649_0054829_14_793 259
446 3300046794 Ga0495589_0006133 Ga0495589_0006133_2135_2926 259
447 3300047320 Ga0495672_0048766 Ga0495672_0048766_203_991 259
448 3300047321 Ga0495676_0103809 Ga0495676_0103809_578_1384 259
449 3300047323 Ga0495683_0039967 Ga0495683_0039967_72_863 259
450 3300049575 Ga0501039_0210862 Ga0501039_0210862_502_1281 259
451 3300050493 nmdc:mga0k408_160305_c1 nmdc:mga0k408_160305_c1_268_1053 259
452 3300059421 Ga0590071_005517 Ga0590071_005517_2101_2883 259
453 3300005548 Ga0070665_100035256 Ga0070665_1000352566 260
454 3300006237 Ga0097621_100057001 Ga0097621_1000570012 260
455 3300006353 Ga0075370_10023884 Ga0075370_100238842 260
456 3300006358 Ga0068871_100080721 Ga0068871_1000807214 260
457 3300009176 Ga0105242_10006722 Ga0105242_1000672215 260
458 3300010375 Ga0105239_10339940 Ga0105239_103399402 260
459 3300013307 Ga0157372_10229023 Ga0157372_102290231 260
460 3300025924 Ga0207694_10190305 Ga0207694_101903051 260
461 3300026035 Ga0207703_10035945 Ga0207703_100359456 260
462 3300030521 Ga0307511_10008113 Ga0307511_100081134 260
463 3300031548 Ga0307408_100006588 Ga0307408_1000065885 260
464 3300031901 Ga0307406_10009632 Ga0307406_100096323 260
465 3300031995 Ga0307409_100029655 Ga0307409_1000296556 260
466 3300035114 Ga0373939_0004485 Ga0373939_0004485_1297_2079 260
467 3300046507 Ga0495606_0005710 Ga0495606_0005710_8130_8912 260
468 3300046616 Ga0495668_0031616 Ga0495668_0031616_359_1141 260
469 3300049568 Ga0501031_0050149 Ga0501031_0050149_533_1324 260
470 3300049569 Ga0501032_0031140 Ga0501032_0031140_528_1319 260
471 3300049570 Ga0501033_0049424 Ga0501033_0049424_1412_2203 260
472 3300049571 Ga0501034_0068225 Ga0501034_0068225_1591_2382 260
473 3300049571 Ga0501034_0336890 Ga0501034_0336890_294_1091 260
474 3300049573 Ga0501037_0147244 Ga0501037_0147244_198_995 260
475 3300049574 Ga0501038_0078454 Ga0501038_0078454_1052_1843 260
476 3300049579 Ga0501043_0073913 Ga0501043_0073913_1786_2577 260
477 3300049579 Ga0501043_0152822 Ga0501043_0152822_521_1318 260
478 3300049581 Ga0501047_0057841 Ga0501047_0057841_1498_2289 260
479 3300049581 Ga0501047_0301652 Ga0501047_0301652_549_1346 260
480 3300049582 Ga0501048_0226349 Ga0501048_0226349_393_1190 260
481 3300049589 Ga0501073_0025376 Ga0501073_0025376_2738_3583 260
482 3300049742 Ga0501080_0435063 Ga0501080_0435063_283_1080 260
483 3300049742 Ga0501080_0561802 Ga0501080_0561802_85_876 260
484 3300049822 Ga0501035_0076286 Ga0501035_0076286_672_1469 260
485 3300049822 Ga0501035_0088379 Ga0501035_0088379_1737_2528 260
486 3300049822 Ga0501035_0098864 Ga0501035_0098864_301_1092 260
487 3300049823 Ga0501044_0052558 Ga0501044_0052558_2986_3777 260
488 3300049823 Ga0501044_0281915 Ga0501044_0281915_632_1429 260
489 3300053104 Ga0500556_0000096 Ga0500556_0000096_39615_40409 260
490 3300054114 Ga0501084_0000769 Ga0501084_0000769_3761_4552 260
491 3300005435 Ga0070714_100224365 Ga0070714_1002243651 261
492 3300005436 Ga0070713_100070894 Ga0070713_1000708942 261
493 3300005436 Ga0070713_100320413 Ga0070713_1003204131 261
494 3300005530 Ga0070679_100343774 Ga0070679_1003437742 261
495 3300005548 Ga0070665_100003036 Ga0070665_1000030369 261
496 3300005614 Ga0068856_100155011 Ga0068856_1001550113 261
497 3300006028 Ga0070717_10525440 Ga0070717_105254401 261
498 3300006914 Ga0075436_100322103 Ga0075436_1003221031 261
499 3300007788 Ga0099795_10007993 Ga0099795_100079933 261
500 3300009093 Ga0105240_10004022 Ga0105240_1000402215 261
501 3300009093 Ga0105240_10373983 Ga0105240_103739831 261
502 3300013307 Ga0157372_10220105 Ga0157372_102201053 261
503 3300014497 Ga0182008_10124547 Ga0182008_101245472 261
504 3300025915 Ga0207693_10177596 Ga0207693_101775962 261
505 3300025921 Ga0207652_10283898 Ga0207652_102838982 261
506 3300026078 Ga0207702_10106162 Ga0207702_101061622 261
507 3300028379 Ga0268266_10004368 Ga0268266_100043689 261
508 3300037418 Ga0395900_0000495 Ga0395900_0000495_32697_33482 261
509 3300037471 Ga0395905_0132470 Ga0395905_0132470_534_1319 261
510 3300038443 Ga0395901_0000094 Ga0395901_0000094_35789_36574 261
511 3300039437 Ga0436365_0969535 Ga0436365_0969535_297_1115 261
512 3300042005 Ga0439448_0002686 Ga0439448_0002686_164_949 261
513 3300042007 Ga0439449_0009832 Ga0439449_0009832_1958_2743 261
514 3300042008 Ga0439450_004212 Ga0439450_004212_1280_2065 261
515 3300042012 Ga0439455_0008184 Ga0439455_0008184_507_1292 261
516 3300044706 Ga0466964_0000805 Ga0466964_0000805_2626_3411 261
517 3300045976 Ga0466967_0151751 Ga0466967_0151751_389_1174 261
518 3300046472 Ga0495580_0257483 Ga0495580_0257483_282_1076 261
519 3300048915 Ga0496112_0055478 Ga0496112_0055478_1078_1872 261
520 3300048915 Ga0496112_0561337 Ga0496112_0561337_50_862 261
521 3300049822 Ga0501035_0000761 Ga0501035_0000761_19592_20377 261
522 3300049823 Ga0501044_0001378 Ga0501044_0001378_22688_23491 261
523 3300050507 nmdc:mga05p37_496978_c1 nmdc:mga05p37_496978_c1_17_805 261
524 3300003771 Ga0055526_1004525 Ga0055526_10045253 262
525 3300003775 Ga0055524_1003408 Ga0055524_10034085 262
526 3300003790 Ga0055528_1000760 Ga0055528_10007608 262
527 3300025273 Ga0209673_1000165 Ga0209673_100016526 262
528 3300025295 Ga0209564_1003504 Ga0209564_100350412 262
529 3300025299 Ga0209256_1000144 Ga0209256_1000144138 262
530 3300025711 Ga0207696_1000106 Ga0207696_1000106133 262
531 3300026121 Ga0207683_10008495 Ga0207683_100084954 262
532 3300035172 Ga0373955_0174033 Ga0373955_0174033_132_950 262
533 3300035724 Ga0373933_0027778 Ga0373933_0027778_204_1022 262
534 3300036401 Ga0373937_0056321 Ga0373937_0056321_537_1355 262
535 3300042439 Ga0439464_0061606 Ga0439464_0061606_25_834 262
536 3300046454 Ga0495592_0376004 Ga0495592_0376004_34_852 262
537 3300046533 Ga0495640_0062489 Ga0495640_0062489_1527_2345 262
538 3300046542 Ga0495597_0014554 Ga0495597_0014554_1618_2415 262
539 3300049588 Ga0501072_0359538 Ga0501072_0359538_38_847 262
540 3300053077 Ga0495601_0044228 Ga0495601_0044228_1495_2313 262
541 3300053085 Ga0495619_0036333 Ga0495619_0036333_646_1464 262
542 3300005439 Ga0070711_100014279 Ga0070711_1000142797 263
543 3300005458 Ga0070681_10114615 Ga0070681_101146152 263
544 3300005539 Ga0068853_100005680 Ga0068853_10000568011 263
545 3300006051 Ga0075364_10072685 Ga0075364_100726852 263
546 3300006175 Ga0070712_100242984 Ga0070712_1002429841 263
547 3300010375 Ga0105239_10000918 Ga0105239_1000091839 263
548 3300025912 Ga0207707_10427771 Ga0207707_104277712 263
549 3300025916 Ga0207663_10083199 Ga0207663_100831993 263
550 3300025934 Ga0207686_10002271 Ga0207686_1000227121 263
551 3300025949 Ga0207667_10272605 Ga0207667_102726052 263
552 3300026041 Ga0207639_10004475 Ga0207639_100044757 263
553 3300035118 Ga0373954_0031902 Ga0373954_0031902_358_1185 263
554 3300035724 Ga0373933_0018203 Ga0373933_0018203_1541_2368 263
555 3300036401 Ga0373937_0000909 Ga0373937_0000909_11349_12176 263
556 3300037312 Ga0395899_0001202 Ga0395899_0001202_20032_20832 263
557 3300037418 Ga0395900_0000006 Ga0395900_0000006_412903_413703 263
558 3300037466 Ga0395898_0029609 Ga0395898_0029609_3032_3832 263
559 3300037471 Ga0395905_0107622 Ga0395905_0107622_505_1305 263
560 3300038443 Ga0395901_0000001 Ga0395901_0000001_456150_456950 263
561 3300039437 Ga0436365_0320300 Ga0436365_0320300_408_1358 263
562 3300039453 Ga0436362_0887806 Ga0436362_0887806_1593_2417 263
563 3300046535 Ga0495586_0261947 Ga0495586_0261947_140_976 263
564 3300046664 Ga0495659_0008291 Ga0495659_0008291_2456_3256 263
565 3300049571 Ga0501034_0040943 Ga0501034_0040943_1859_2668 263
566 3300049572 Ga0501036_0022398 Ga0501036_0022398_887_1696 263
567 3300049574 Ga0501038_0059032 Ga0501038_0059032_1239_2048 263
568 3300049579 Ga0501043_0102304 Ga0501043_0102304_1081_1890 263
569 3300049580 Ga0501046_0213584 Ga0501046_0213584_547_1356 263
570 3300049581 Ga0501047_0486964 Ga0501047_0486964_140_958 263
571 3300049822 Ga0501035_0004337 Ga0501035_0004337_4213_5022 263
572 3300049823 Ga0501044_0032797 Ga0501044_0032797_975_1784 263
573 3300050491 nmdc:mga00v17_62245_c1 nmdc:mga00v17_62245_c1_432_1247 263
574 3300050494 nmdc:mga06z11_235656_c1 nmdc:mga06z11_235656_c1_100_906 263
575 3300002987 JGI25159J45721_1000859 JGI25159J45721_10008596 264
576 3300005262 Ga0065165_1000044 Ga0065165_100004485 264
577 3300005518 Ga0070699_100213222 Ga0070699_1002132221 264
578 3300005548 Ga0070665_100357211 Ga0070665_1003572112 264
579 3300009094 Ga0111539_10215994 Ga0111539_102159942 264
580 3300025284 Ga0209130_1000089 Ga0209130_100008935 264
581 3300025304 Ga0209257_1006780 Ga0209257_10067803 264
582 3300025986 Ga0207658_10024155 Ga0207658_100241554 264
583 3300028379 Ga0268266_10164644 Ga0268266_101646443 264
584 3300031247 Ga0265340_10072734 Ga0265340_100727342 264
585 3300049571 Ga0501034_0036262 Ga0501034_0036262_1606_2427 264
586 3300049572 Ga0501036_0008992 Ga0501036_0008992_7166_7987 264
587 3300049573 Ga0501037_0002781 Ga0501037_0002781_4805_5626 264
588 3300049574 Ga0501038_0000719 Ga0501038_0000719_4252_5073 264
589 3300049575 Ga0501039_0007166 Ga0501039_0007166_7196_8017 264
590 3300049579 Ga0501043_0001293 Ga0501043_0001293_13278_14099 264
591 3300049580 Ga0501046_0000870 Ga0501046_0000870_5063_5884 264
592 3300049581 Ga0501047_0006799 Ga0501047_0006799_6666_7487 264
593 3300049582 Ga0501048_0064234 Ga0501048_0064234_311_1132 264
594 3300049583 Ga0501067_0032064 Ga0501067_0032064_467_1288 264
595 3300049584 Ga0501068_0002004 Ga0501068_0002004_4872_5693 264
596 3300049585 Ga0501069_0000173 Ga0501069_0000173_8825_9646 264
597 3300049586 Ga0501070_0010809 Ga0501070_0010809_5237_6058 264
598 3300049589 Ga0501073_0005108 Ga0501073_0005108_4174_4995 264
599 3300049590 Ga0501074_0018024 Ga0501074_0018024_2645_3466 264
600 3300049741 Ga0501079_0056713 Ga0501079_0056713_42_863 264
601 3300049742 Ga0501080_0003033 Ga0501080_0003033_3258_4079 264
602 3300049744 Ga0501083_0062191 Ga0501083_0062191_995_1816 264
603 3300049822 Ga0501035_0002936 Ga0501035_0002936_3131_3952 264
604 3300049823 Ga0501044_0009708 Ga0501044_0009708_5347_6168 264
605 3300050511 nmdc:mga08y16_228982_c1 nmdc:mga08y16_228982_c1_533_1360 264
606 3300054114 Ga0501084_0010651 Ga0501084_0010651_1793_2614 264
607 3300060353 Ga0501082_0016299 Ga0501082_0016299_3568_4389 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

4

248

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9713 1 257
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9676 1 257
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9668 1 257
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9667 2 257
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9594 1 257
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9735 2 257 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9656 1 257 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9624 2 257 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9583 1 257 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9517 1 257 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A436KS41-F1-model_v4 deleted 1.001 1 77
AF-A0A2W5ADH5-F1-model_v4 Exodeoxyribonuclease III 0.9999 1 128 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A4Q2FJP5-F1-model_v4 Exodeoxyribonuclease III 0.9993 1 108 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A4R3FGF6-F1-model_v4 Exodeoxyribonuclease III 0.9988 3 224 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A357X4M1-F1-model_v4 deleted 0.998 28 128

Feature Viewer

pLDDT pTM Quality
95.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map