F468717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 370 | 532 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0320300|Ga0436365_0320300_408_1358 |
| Length | 303 |
| Sequence | MRIATYNVNGINGRLPNLLAWLEEAAPNVVCLQELKAPDDKFPGAAVRAAGYGAVWHGQKSWNGVAILARDTQPAEIRRGLPGDPDDAHSRYIEAAIDGMIVGCLYLPNGNPAPGPKFDYKLRWFQRLTEHAQELLATGEPVVLAGDFNVMPTDLDVYAPERWVDDALFRPEVREAYRCLVARGWTDALRALYPGERVYTFWKYFRNAFGRDAGLRIDHLLVSPSLAARLIAGGVDRNVRGREHASDHAPAWIELAERPHASPNRGSFSAGTVASTPTLRPRTFSSSPSSAATRMPAMPNTET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 2 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 3 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 4 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 5 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 6 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 7 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 8 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 9 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 10 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 11 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 12 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 13 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 14 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 15 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 16 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 17 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 18 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 19 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 20 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 21 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 22 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 23 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 24 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 25 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 26 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 27 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 28 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 29 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 30 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 31 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 32 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 33 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 34 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 35 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 36 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 37 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 38 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 39 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 40 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 41 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 42 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 43 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 44 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 45 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 46 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 47 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 48 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 49 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 50 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 51 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 52 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 53 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 54 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 55 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 56 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 57 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 58 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 59 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 60 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 66 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 74 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 187 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 223 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 335 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 337 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 340 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 341 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 347 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 360 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 361 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 362 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 363 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 364 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 365 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 366 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 367 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 368 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 369 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 370 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.15 |
| Metatranscriptomes | 0.49 |
| Isolates | 12.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 14.33 |
| Nodule | 5.6 |
| Rhizoplane | 1.48 |
| Rhizosphere | 65.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000859 | 3300002987 | Bacteria | 13230 |
| 2 | JGI25159J45721_1001040 | 3300002987 | Bacteria | 11866 |
| 3 | JGI25159J45721_1003776 | 3300002987 | Bacteria | 5225 |
| 4 | JGI25165J46597_1000007 | 3300003214 | Bacteria | 518996 |
| 5 | JGI25165J46597_1005525 | 3300003214 | Bacteria | 2417 |
| 6 | JGI25153J46596_10024811 | 3300003215 | Bacteria | 2154 |
| 7 | rootH1_10057858 | 3300003323 | Bacteria | 4541 |
| 8 | JGI25160J50197_1000252 | 3300003354 | Bacteria | 40935 |
| 9 | JGI25160J50197_1001444 | 3300003354 | Bacteria | 11882 |
| 10 | JGI25161J50226_1000185 | 3300003374 | Bacteria | 40935 |
| 11 | JGI25161J50226_1000795 | 3300003374 | Bacteria | 11882 |
| 12 | Ga0055539_1006888 | 3300003752 | Bacteria | 1448 |
| 13 | Ga0055526_1004525 | 3300003771 | Bacteria | 8314 |
| 14 | Ga0055524_1003408 | 3300003775 | Bacteria | 7725 |
| 15 | Ga0055528_1000760 | 3300003790 | Bacteria | 22503 |
| 16 | Ga0055540_1000439 | 3300003792 | Bacteria | 32821 |
| 17 | Ga0055540_1006835 | 3300003792 | Bacteria | 4439 |
| 18 | Ga0055531_10003632 | 3300003794 | Bacteria | 9734 |
| 19 | Ga0055531_10004825 | 3300003794 | Bacteria | 8047 |
| 20 | Ga0055531_10011720 | 3300003794 | Bacteria | 4195 |
| 21 | Ga0055543_1000249 | 3300004625 | Bacteria | 40973 |
| 22 | Ga0055543_1000809 | 3300004625 | Bacteria | 15419 |
| 23 | Ga0065165_1000044 | 3300005262 | Bacteria | 203774 |
| 24 | Ga0065165_1000824 | 3300005262 | Bacteria | 40973 |
| 25 | Ga0065165_1002494 | 3300005262 | Bacteria | 15419 |
| 26 | Ga0065714_10067355 | 3300005288 | Bacteria | 5609 |
| 27 | Ga0068869_100046108 | 3300005334 | Bacteria | 3142 |
| 28 | Ga0070680_100018410 | 3300005336 | Bacteria | 5518 |
| 29 | Ga0070671_100014711 | 3300005355 | Bacteria | 6324 |
| 30 | Ga0070674_100003805 | 3300005356 | Bacteria | 8529 |
| 31 | Ga0070673_100103670 | 3300005364 | Bacteria | 2347 |
| 32 | Ga0070673_100309432 | 3300005364 | Bacteria | 1393 |
| 33 | Ga0070667_100210760 | 3300005367 | Bacteria | 1727 |
| 34 | Ga0070714_100224365 | 3300005435 | Bacteria | 1728 |
| 35 | Ga0070713_100070894 | 3300005436 | Bacteria | 2943 |
| 36 | Ga0070713_100320413 | 3300005436 | Bacteria | 1431 |
| 37 | Ga0070711_100014279 | 3300005439 | Bacteria | 5000 |
| 38 | Ga0070663_100018359 | 3300005455 | Bacteria | 4584 |
| 39 | Ga0070678_100000306 | 3300005456 | Bacteria | 22717 |
| 40 | Ga0070678_100170783 | 3300005456 | Bacteria | 1771 |
| 41 | Ga0070681_10009722 | 3300005458 | Bacteria | 9463 |
| 42 | Ga0070681_10050360 | 3300005458 | Bacteria | 4156 |
| 43 | Ga0070681_10052932 | 3300005458 | Bacteria | 4047 |
| 44 | Ga0070681_10114615 | 3300005458 | Bacteria | 2634 |
| 45 | Ga0070699_100213222 | 3300005518 | Bacteria | 1719 |
| 46 | Ga0070679_100168601 | 3300005530 | Bacteria | 2162 |
| 47 | Ga0070679_100242190 | 3300005530 | Bacteria | 1761 |
| 48 | Ga0070679_100343774 | 3300005530 | Bacteria | 1440 |
| 49 | Ga0068853_100005680 | 3300005539 | Bacteria | 9810 |
| 50 | Ga0068853_100033372 | 3300005539 | Unclassified | 4367 |
| 51 | Ga0070665_100003036 | 3300005548 | Bacteria | 18089 |
| 52 | Ga0070665_100003151 | 3300005548 | Bacteria | 17741 |
| 53 | Ga0070665_100005211 | 3300005548 | Bacteria | 13450 |
| 54 | Ga0070665_100035256 | 3300005548 | Bacteria | 5031 |
| 55 | Ga0070665_100054166 | 3300005548 | Bacteria | 4023 |
| 56 | Ga0070665_100109546 | 3300005548 | Bacteria | 2764 |
| 57 | Ga0070665_100357211 | 3300005548 | Bacteria | 1467 |
| 58 | Ga0068855_100299976 | 3300005563 | Bacteria | 1779 |
| 59 | Ga0068855_100706410 | 3300005563 | Bacteria | 1079 |
| 60 | Ga0068857_100211983 | 3300005577 | Unclassified | 1768 |
| 61 | Ga0068854_100473545 | 3300005578 | Bacteria | 1050 |
| 62 | Ga0068856_100155011 | 3300005614 | Bacteria | 2300 |
| 63 | Ga0068856_100301500 | 3300005614 | Bacteria | 1620 |
| 64 | Ga0068859_100039259 | 3300005617 | Bacteria | 4749 |
| 65 | Ga0068864_100126788 | 3300005618 | Bacteria | 2288 |
| 66 | Ga0068863_100017047 | 3300005841 | Bacteria | 6966 |
| 67 | Ga0068860_100007748 | 3300005843 | Bacteria | 10729 |
| 68 | Ga0068860_100537278 | 3300005843 | Bacteria | 1170 |
| 69 | Ga0068862_100023064 | 3300005844 | Bacteria | 5213 |
| 70 | Ga0070717_10525440 | 3300006028 | Bacteria | 1071 |
| 71 | Ga0075365_10078362 | 3300006038 | Bacteria | 2234 |
| 72 | Ga0075364_10072685 | 3300006051 | Bacteria | 2267 |
| 73 | Ga0070712_100242984 | 3300006175 | Bacteria | 1435 |
| 74 | Ga0075369_10076040 | 3300006186 | Bacteria | 1484 |
| 75 | Ga0075366_10168388 | 3300006195 | Bacteria | 1329 |
| 76 | Ga0097621_100046882 | 3300006237 | Bacteria | 3499 |
| 77 | Ga0097621_100057001 | 3300006237 | Bacteria | 3193 |
| 78 | Ga0075370_10023884 | 3300006353 | Bacteria | 3371 |
| 79 | Ga0068871_100080721 | 3300006358 | Bacteria | 2693 |
| 80 | Ga0075436_100322103 | 3300006914 | Bacteria | 1110 |
| 81 | Ga0097620_100039259 | 3300006931 | Bacteria | 4749 |
| 82 | Ga0099826_10000038 | 3300006948 | Bacteria | 101106 |
| 83 | Ga0099795_10007993 | 3300007788 | Bacteria | 2989 |
| 84 | Ga0105240_10003294 | 3300009093 | Bacteria | 25240 |
| 85 | Ga0105240_10004022 | 3300009093 | Bacteria | 22634 |
| 86 | Ga0105240_10009140 | 3300009093 | Bacteria | 14067 |
| 87 | Ga0105240_10093216 | 3300009093 | Bacteria | 3676 |
| 88 | Ga0105240_10373983 | 3300009093 | Bacteria | 1610 |
| 89 | Ga0105240_10552493 | 3300009093 | Bacteria | 1274 |
| 90 | Ga0111539_10215994 | 3300009094 | Bacteria | 2234 |
| 91 | Ga0111539_10816202 | 3300009094 | Bacteria | 1085 |
| 92 | Ga0105247_10111209 | 3300009101 | Bacteria | 1764 |
| 93 | Ga0105243_10000308 | 3300009148 | Bacteria | 54026 |
| 94 | Ga0105242_10006722 | 3300009176 | Bacteria | 8873 |
| 95 | Ga0105237_10000028 | 3300009545 | Bacteria | 201366 |
| 96 | Ga0105237_10000038 | 3300009545 | Bacteria | 190707 |
| 97 | Ga0105237_10011270 | 3300009545 | Bacteria | 9459 |
| 98 | Ga0105237_10199379 | 3300009545 | Bacteria | 2001 |
| 99 | Ga0105238_10527440 | 3300009551 | Bacteria | 1184 |
| 100 | Ga0099796_10056641 | 3300010159 | Bacteria | 1376 |
| 101 | Ga0105239_10000065 | 3300010375 | Bacteria | 151224 |
| 102 | Ga0105239_10000918 | 3300010375 | Bacteria | 41658 |
| 103 | Ga0105239_10001636 | 3300010375 | Bacteria | 29551 |
| 104 | Ga0105239_10002418 | 3300010375 | Bacteria | 23771 |
| 105 | Ga0105239_10090153 | 3300010375 | Bacteria | 3383 |
| 106 | Ga0105239_10339940 | 3300010375 | Bacteria | 1694 |
| 107 | Ga0157373_10001149 | 3300013100 | Bacteria | 20277 |
| 108 | Ga0157370_10000054 | 3300013104 | Bacteria | 118718 |
| 109 | Ga0163162_10077655 | 3300013306 | Bacteria | 3384 |
| 110 | Ga0157372_10016648 | 3300013307 | Bacteria | 7891 |
| 111 | Ga0157372_10220105 | 3300013307 | Bacteria | 2201 |
| 112 | Ga0157372_10229023 | 3300013307 | Bacteria | 2154 |
| 113 | Ga0157372_10515208 | 3300013307 | Bacteria | 1394 |
| 114 | Ga0157372_10779420 | 3300013307 | Bacteria | 1111 |
| 115 | Ga0182008_10000299 | 3300014497 | Bacteria | 38806 |
| 116 | Ga0182008_10124547 | 3300014497 | Bacteria | 1282 |
| 117 | Ga0157379_10131101 | 3300014968 | Bacteria | 2257 |
| 118 | Ga0163161_10036910 | 3300017792 | Bacteria | 3501 |
| 119 | Ga0213876_10000722 | 3300021384 | Bacteria | 23019 |
| 120 | Ga0209436_109442 | 3300025208 | Bacteria | 1856 |
| 121 | Ga0209437_100261 | 3300025233 | Bacteria | 82127 |
| 122 | Ga0209677_100525 | 3300025253 | Bacteria | 21305 |
| 123 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 124 | Ga0209233_1000214 | 3300025261 | Bacteria | 108975 |
| 125 | Ga0209673_1000165 | 3300025273 | Bacteria | 138061 |
| 126 | Ga0209673_1029421 | 3300025273 | Bacteria | 1750 |
| 127 | Ga0209130_1000089 | 3300025284 | Bacteria | 152711 |
| 128 | Ga0209130_1000482 | 3300025284 | Bacteria | 40987 |
| 129 | Ga0209130_1001325 | 3300025284 | Bacteria | 16827 |
| 130 | Ga0209676_1013255 | 3300025292 | Bacteria | 3181 |
| 131 | Ga0209025_1001648 | 3300025294 | Bacteria | 27540 |
| 132 | Ga0209025_1001673 | 3300025294 | Bacteria | 27174 |
| 133 | Ga0209025_1033646 | 3300025294 | Bacteria | 2363 |
| 134 | Ga0209025_1049308 | 3300025294 | Bacteria | 1696 |
| 135 | Ga0209564_1003504 | 3300025295 | Bacteria | 10643 |
| 136 | Ga0209564_1015820 | 3300025295 | Bacteria | 3047 |
| 137 | Ga0209758_1000170 | 3300025297 | Bacteria | 149476 |
| 138 | Ga0209256_1000144 | 3300025299 | Bacteria | 151157 |
| 139 | Ga0209256_1052691 | 3300025299 | Bacteria | 977 |
| 140 | Ga0207426_1000462 | 3300025302 | Bacteria | 63167 |
| 141 | Ga0207426_1001895 | 3300025302 | Bacteria | 15179 |
| 142 | Ga0209051_1000192 | 3300025303 | Bacteria | 108667 |
| 143 | Ga0209051_1001025 | 3300025303 | Bacteria | 26597 |
| 144 | Ga0209257_1000300 | 3300025304 | Bacteria | 108786 |
| 145 | Ga0209257_1006780 | 3300025304 | Bacteria | 7210 |
| 146 | Ga0207696_1000106 | 3300025711 | Bacteria | 159964 |
| 147 | Ga0207692_10190147 | 3300025898 | Bacteria | 1201 |
| 148 | Ga0207647_10011540 | 3300025904 | Bacteria | 6191 |
| 149 | Ga0207645_10360171 | 3300025907 | Bacteria | 974 |
| 150 | Ga0207707_10011776 | 3300025912 | Bacteria | 7609 |
| 151 | Ga0207707_10074419 | 3300025912 | Bacteria | 2962 |
| 152 | Ga0207707_10427771 | 3300025912 | Bacteria | 1134 |
| 153 | Ga0207695_10004032 | 3300025913 | Bacteria | 20213 |
| 154 | Ga0207695_10005241 | 3300025913 | Bacteria | 17323 |
| 155 | Ga0207695_10019958 | 3300025913 | Bacteria | 7696 |
| 156 | Ga0207695_10048486 | 3300025913 | Bacteria | 4485 |
| 157 | Ga0207695_10558830 | 3300025913 | Bacteria | 1026 |
| 158 | Ga0207671_10000418 | 3300025914 | Bacteria | 58941 |
| 159 | Ga0207671_10015821 | 3300025914 | Bacteria | 5886 |
| 160 | Ga0207693_10177596 | 3300025915 | Bacteria | 1675 |
| 161 | Ga0207663_10083199 | 3300025916 | Bacteria | 2102 |
| 162 | Ga0207652_10093110 | 3300025921 | Bacteria | 2651 |
| 163 | Ga0207652_10283898 | 3300025921 | Bacteria | 1493 |
| 164 | Ga0207652_10300587 | 3300025921 | Bacteria | 1449 |
| 165 | Ga0207694_10190305 | 3300025924 | Bacteria | 1667 |
| 166 | Ga0207694_10303046 | 3300025924 | Bacteria | 1316 |
| 167 | Ga0207694_10444588 | 3300025924 | Bacteria | 1082 |
| 168 | Ga0207687_10049717 | 3300025927 | Bacteria | 2917 |
| 169 | Ga0207690_10000560 | 3300025932 | Bacteria | 24270 |
| 170 | Ga0207690_10026894 | 3300025932 | Bacteria | 3629 |
| 171 | Ga0207686_10002271 | 3300025934 | Bacteria | 10550 |
| 172 | Ga0207669_10002638 | 3300025937 | Bacteria | 7683 |
| 173 | Ga0207661_10064175 | 3300025944 | Bacteria | 2976 |
| 174 | Ga0207667_10032412 | 3300025949 | Bacteria | 5632 |
| 175 | Ga0207667_10272605 | 3300025949 | Bacteria | 1730 |
| 176 | Ga0207651_10200640 | 3300025960 | Bacteria | 1598 |
| 177 | Ga0207668_10152568 | 3300025972 | Bacteria | 1790 |
| 178 | Ga0207640_10471579 | 3300025981 | Bacteria | 1039 |
| 179 | Ga0207658_10024155 | 3300025986 | Bacteria | 4250 |
| 180 | Ga0207677_10012976 | 3300026023 | Bacteria | 4814 |
| 181 | Ga0207677_10159223 | 3300026023 | Bacteria | 1752 |
| 182 | Ga0207703_10035945 | 3300026035 | Bacteria | 3940 |
| 183 | Ga0207639_10004475 | 3300026041 | Bacteria | 9433 |
| 184 | Ga0207639_10039561 | 3300026041 | Unclassified | 3514 |
| 185 | Ga0207678_10007267 | 3300026067 | Bacteria | 9818 |
| 186 | Ga0207702_10106162 | 3300026078 | Bacteria | 2488 |
| 187 | Ga0207702_10230131 | 3300026078 | Bacteria | 1732 |
| 188 | Ga0207702_10241730 | 3300026078 | Bacteria | 1692 |
| 189 | Ga0207641_10071501 | 3300026088 | Bacteria | 2984 |
| 190 | Ga0207676_10084321 | 3300026095 | Bacteria | 2590 |
| 191 | Ga0207683_10008495 | 3300026121 | Bacteria | 8786 |
| 192 | Ga0207683_10008731 | 3300026121 | Bacteria | 8652 |
| 193 | Ga0207683_10137049 | 3300026121 | Bacteria | 2203 |
| 194 | Ga0207698_10097046 | 3300026142 | Bacteria | 2431 |
| 195 | Ga0209371_1023347 | 3300027312 | Bacteria | 1457 |
| 196 | Ga0209282_1000093 | 3300027666 | Bacteria | 62036 |
| 197 | Ga0209971_1001802 | 3300027682 | Bacteria | 5247 |
| 198 | Ga0209974_10001618 | 3300027876 | Bacteria | 8150 |
| 199 | Ga0268266_10001732 | 3300028379 | Bacteria | 24974 |
| 200 | Ga0268266_10004368 | 3300028379 | Bacteria | 13582 |
| 201 | Ga0268266_10004733 | 3300028379 | Bacteria | 12937 |
| 202 | Ga0268266_10061451 | 3300028379 | Bacteria | 3240 |
| 203 | Ga0268266_10164644 | 3300028379 | Bacteria | 2008 |
| 204 | Ga0268265_10038671 | 3300028380 | Bacteria | 3511 |
| 205 | Ga0268264_10017332 | 3300028381 | Bacteria | 5902 |
| 206 | Ga0268264_10430490 | 3300028381 | Bacteria | 1274 |
| 207 | Ga0307517_10108368 | 3300028786 | Bacteria | 2133 |
| 208 | Ga0307515_10000569 | 3300028794 | Bacteria | 87068 |
| 209 | Ga0307515_10392928 | 3300028794 | Bacteria | 1015 |
| 210 | Ga0265338_10014046 | 3300028800 | Bacteria | 8966 |
| 211 | Ga0265338_10246141 | 3300028800 | Bacteria | 1321 |
| 212 | Ga0268256_1026249 | 3300030500 | Bacteria | 1466 |
| 213 | Ga0307511_10000046 | 3300030521 | Bacteria | 100284 |
| 214 | Ga0307511_10008113 | 3300030521 | Bacteria | 10513 |
| 215 | Ga0316183_1079280 | 3300030742 | Bacteria | 54147 |
| 216 | Ga0316181_1053827 | 3300030744 | Bacteria | 9172 |
| 217 | Ga0265340_10072734 | 3300031247 | Bacteria | 1628 |
| 218 | Ga0307408_100005956 | 3300031548 | Bacteria | 8122 |
| 219 | Ga0307408_100006588 | 3300031548 | Bacteria | 7701 |
| 220 | Ga0307408_100021693 | 3300031548 | Bacteria | 4350 |
| 221 | Ga0265313_10058149 | 3300031595 | Bacteria | 1823 |
| 222 | Ga0307405_10021259 | 3300031731 | Bacteria | 3643 |
| 223 | Ga0307413_10014691 | 3300031824 | Bacteria | 3987 |
| 224 | Ga0307413_10071834 | 3300031824 | Bacteria | 2182 |
| 225 | Ga0307413_10514519 | 3300031824 | Bacteria | 964 |
| 226 | Ga0307410_10002563 | 3300031852 | Bacteria | 8810 |
| 227 | Ga0307406_10007763 | 3300031901 | Bacteria | 5963 |
| 228 | Ga0307406_10009632 | 3300031901 | Bacteria | 5429 |
| 229 | Ga0307406_10024470 | 3300031901 | Bacteria | 3607 |
| 230 | Ga0307406_10057836 | 3300031901 | Bacteria | 2489 |
| 231 | Ga0307407_10005436 | 3300031903 | Bacteria | 5528 |
| 232 | Ga0307412_10040283 | 3300031911 | Bacteria | 3022 |
| 233 | Ga0307412_10040892 | 3300031911 | Bacteria | 3002 |
| 234 | Ga0307409_100029655 | 3300031995 | Bacteria | 3918 |
| 235 | Ga0307409_100157120 | 3300031995 | Bacteria | 1983 |
| 236 | Ga0307416_100015363 | 3300032002 | Bacteria | 5286 |
| 237 | Ga0307416_100042662 | 3300032002 | Bacteria | 3543 |
| 238 | Ga0307416_100075669 | 3300032002 | Bacteria | 2818 |
| 239 | Ga0307416_100094441 | 3300032002 | Bacteria | 2579 |
| 240 | Ga0307416_100318052 | 3300032002 | Bacteria | 1557 |
| 241 | Ga0307414_10039076 | 3300032004 | Bacteria | 3193 |
| 242 | Ga0307414_10129600 | 3300032004 | Unclassified | 1956 |
| 243 | Ga0307411_10002464 | 3300032005 | Bacteria | 8196 |
| 244 | Ga0307411_10028882 | 3300032005 | Bacteria | 3378 |
| 245 | Ga0307415_100017399 | 3300032126 | Bacteria | 4309 |
| 246 | Ga0307415_100058167 | 3300032126 | Bacteria | 2660 |
| 247 | Ga0307415_100149965 | 3300032126 | Bacteria | 1793 |
| 248 | Ga0307415_100223232 | 3300032126 | Bacteria | 1512 |
| 249 | Ga0373936_0023715 | 3300035113 | Bacteria | 2393 |
| 250 | Ga0373939_0004485 | 3300035114 | Bacteria | 3306 |
| 251 | Ga0373954_0031902 | 3300035118 | Bacteria | 2434 |
| 252 | Ga0373955_0174033 | 3300035172 | Bacteria | 1275 |
| 253 | Ga0373933_0018203 | 3300035724 | Bacteria | 3948 |
| 254 | Ga0373933_0027778 | 3300035724 | Bacteria | 3261 |
| 255 | Ga0373937_0000909 | 3300036401 | Bacteria | 25167 |
| 256 | Ga0373937_0056321 | 3300036401 | Bacteria | 3610 |
| 257 | Ga0395899_0001202 | 3300037312 | Bacteria | 22725 |
| 258 | Ga0395900_0000006 | 3300037418 | Bacteria | 495364 |
| 259 | Ga0395900_0000495 | 3300037418 | Bacteria | 55568 |
| 260 | Ga0395900_0029423 | 3300037418 | Bacteria | 5635 |
| 261 | Ga0395900_0064281 | 3300037418 | Bacteria | 3772 |
| 262 | Ga0395898_0029609 | 3300037466 | Bacteria | 5480 |
| 263 | Ga0395898_0107784 | 3300037466 | Bacteria | 2672 |
| 264 | Ga0395905_0098156 | 3300037471 | Bacteria | 2751 |
| 265 | Ga0395905_0107622 | 3300037471 | Bacteria | 2617 |
| 266 | Ga0395905_0132470 | 3300037471 | Bacteria | 2344 |
| 267 | Ga0395905_0244977 | 3300037471 | Bacteria | 1675 |
| 268 | Ga0395905_0687141 | 3300037471 | Bacteria | 926 |
| 269 | Ga0436364_0801868 | 3300037853 | Bacteria | 1117 |
| 270 | Ga0436364_1210875 | 3300037853 | Bacteria | 16114 |
| 271 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 272 | Ga0395901_0000094 | 3300038443 | Bacteria | 120153 |
| 273 | Ga0395901_0106778 | 3300038443 | Bacteria | 2939 |
| 274 | Ga0395901_0395074 | 3300038443 | Bacteria | 1421 |
| 275 | Ga0436365_0320300 | 3300039437 | Bacteria | 2151 |
| 276 | Ga0436365_0969535 | 3300039437 | Bacteria | 1526 |
| 277 | Ga0436365_1140201 | 3300039437 | Bacteria | 1572 |
| 278 | Ga0436365_1664331 | 3300039437 | Bacteria | 31697 |
| 279 | Ga0436365_1666840 | 3300039437 | Bacteria | 7995 |
| 280 | Ga0436360_0139976 | 3300039438 | Bacteria | 870 |
| 281 | Ga0436360_0187655 | 3300039438 | Bacteria | 1575 |
| 282 | Ga0436361_0120332 | 3300039447 | Bacteria | 1472 |
| 283 | Ga0436361_0852213 | 3300039447 | Bacteria | 2155 |
| 284 | Ga0436361_1059495 | 3300039447 | Bacteria | 2212 |
| 285 | Ga0436363_0599542 | 3300039450 | Bacteria | 5604 |
| 286 | Ga0436363_0983892 | 3300039450 | Bacteria | 1011 |
| 287 | Ga0436362_0887806 | 3300039453 | Bacteria | 2658 |
| 288 | Ga0439465_0000751 | 3300041413 | Bacteria | 10045 |
| 289 | Ga0439465_0086851 | 3300041413 | Bacteria | 1066 |
| 290 | Ga0439445_0001786 | 3300042004 | Bacteria | 4739 |
| 291 | Ga0439448_0002686 | 3300042005 | Bacteria | 4857 |
| 292 | Ga0439449_0009832 | 3300042007 | Bacteria | 3620 |
| 293 | Ga0439450_004212 | 3300042008 | Bacteria | 2441 |
| 294 | Ga0439455_0008184 | 3300042012 | Bacteria | 2236 |
| 295 | Ga0439464_0061606 | 3300042439 | Bacteria | 1099 |
| 296 | Ga0466965_0281923 | 3300044683 | Bacteria | 898 |
| 297 | Ga0466966_0260678 | 3300044684 | Bacteria | 1044 |
| 298 | Ga0466963_0013078 | 3300044694 | Bacteria | 5090 |
| 299 | Ga0466964_0000805 | 3300044706 | Bacteria | 10230 |
| 300 | Ga0466970_0004643 | 3300044765 | Bacteria | 6778 |
| 301 | Ga0466957_0062317 | 3300044842 | Bacteria | 2290 |
| 302 | Ga0466959_0227486 | 3300045049 | Bacteria | 1292 |
| 303 | Ga0451576_0255673 | 3300045051 | Bacteria | 1831 |
| 304 | Ga0451576_0299115 | 3300045051 | Bacteria | 1683 |
| 305 | Ga0466958_0150978 | 3300045836 | Bacteria | 1465 |
| 306 | Ga0466967_0025766 | 3300045976 | Bacteria | 4854 |
| 307 | Ga0466967_0151751 | 3300045976 | Bacteria | 2166 |
| 308 | Ga0466967_0281495 | 3300045976 | Bacteria | 1596 |
| 309 | Ga0495592_0376004 | 3300046454 | Bacteria | 905 |
| 310 | Ga0495638_0000435 | 3300046460 | Bacteria | 50498 |
| 311 | Ga0495638_0012345 | 3300046460 | Bacteria | 5857 |
| 312 | Ga0495650_0000089 | 3300046471 | Bacteria | 233415 |
| 313 | Ga0495650_0078312 | 3300046471 | Bacteria | 1280 |
| 314 | Ga0495580_0257483 | 3300046472 | Bacteria | 1194 |
| 315 | Ga0495605_0015613 | 3300046474 | Bacteria | 4126 |
| 316 | Ga0495605_0037226 | 3300046474 | Bacteria | 2449 |
| 317 | Ga0495584_0002107 | 3300046491 | Bacteria | 11402 |
| 318 | Ga0495585_0000353 | 3300046492 | Bacteria | 44438 |
| 319 | Ga0495596_0000230 | 3300046500 | Bacteria | 37798 |
| 320 | Ga0495596_0000680 | 3300046500 | Bacteria | 21142 |
| 321 | Ga0495596_0003120 | 3300046500 | Bacteria | 8553 |
| 322 | Ga0495596_0007022 | 3300046500 | Bacteria | 5116 |
| 323 | Ga0495607_0084043 | 3300046501 | Bacteria | 1742 |
| 324 | Ga0495583_0001156 | 3300046506 | Bacteria | 28740 |
| 325 | Ga0495606_0000104 | 3300046507 | Bacteria | 143973 |
| 326 | Ga0495606_0005710 | 3300046507 | Bacteria | 11774 |
| 327 | Ga0495610_0010646 | 3300046512 | Bacteria | 5696 |
| 328 | Ga0495616_0001403 | 3300046513 | Bacteria | 16778 |
| 329 | Ga0495616_0018893 | 3300046513 | Bacteria | 3769 |
| 330 | Ga0495620_0088732 | 3300046515 | Bacteria | 1242 |
| 331 | Ga0495631_0132465 | 3300046518 | Bacteria | 1071 |
| 332 | Ga0495637_0050020 | 3300046520 | Bacteria | 1754 |
| 333 | Ga0495643_0121666 | 3300046522 | Bacteria | 1318 |
| 334 | Ga0495643_0140209 | 3300046522 | Bacteria | 1206 |
| 335 | Ga0495663_0014075 | 3300046525 | Bacteria | 2240 |
| 336 | Ga0495642_0126915 | 3300046528 | Bacteria | 1097 |
| 337 | Ga0495652_0265727 | 3300046529 | Bacteria | 1264 |
| 338 | Ga0495654_0105144 | 3300046530 | Bacteria | 1294 |
| 339 | Ga0495640_0062489 | 3300046533 | Bacteria | 2526 |
| 340 | Ga0495586_0261947 | 3300046535 | Bacteria | 987 |
| 341 | Ga0495587_0292772 | 3300046536 | Bacteria | 911 |
| 342 | Ga0495609_0018871 | 3300046538 | Bacteria | 3194 |
| 343 | Ga0495621_0040351 | 3300046539 | Bacteria | 1635 |
| 344 | Ga0495597_0014554 | 3300046542 | Bacteria | 3742 |
| 345 | Ga0495597_0038721 | 3300046542 | Bacteria | 2136 |
| 346 | Ga0495622_0000023 | 3300046557 | Bacteria | 155188 |
| 347 | Ga0495633_0035246 | 3300046558 | Bacteria | 2403 |
| 348 | Ga0495633_0039557 | 3300046558 | Bacteria | 2251 |
| 349 | Ga0495668_0003498 | 3300046616 | Bacteria | 11713 |
| 350 | Ga0495668_0031616 | 3300046616 | Bacteria | 2983 |
| 351 | Ga0495668_0044564 | 3300046616 | Bacteria | 2465 |
| 352 | Ga0495611_0000015 | 3300046648 | Bacteria | 129696 |
| 353 | Ga0495625_0063484 | 3300046660 | Bacteria | 2608 |
| 354 | Ga0495625_0112793 | 3300046660 | Bacteria | 1857 |
| 355 | Ga0495659_0008291 | 3300046664 | Bacteria | 3308 |
| 356 | Ga0495661_0002896 | 3300046665 | Bacteria | 12980 |
| 357 | Ga0495669_0024527 | 3300046684 | Bacteria | 2626 |
| 358 | Ga0495670_0088646 | 3300046691 | Bacteria | 1581 |
| 359 | Ga0495649_0054829 | 3300046694 | Bacteria | 2155 |
| 360 | Ga0495589_0006133 | 3300046794 | Bacteria | 6349 |
| 361 | Ga0495660_0019879 | 3300046810 | Bacteria | 3852 |
| 362 | Ga0495636_0025214 | 3300047318 | Bacteria | 2413 |
| 363 | Ga0495672_0048766 | 3300047320 | Bacteria | 2510 |
| 364 | Ga0495672_0071824 | 3300047320 | Bacteria | 1957 |
| 365 | Ga0495676_0103809 | 3300047321 | Bacteria | 2098 |
| 366 | Ga0495683_0000151 | 3300047323 | Bacteria | 68310 |
| 367 | Ga0495683_0015726 | 3300047323 | Bacteria | 3929 |
| 368 | Ga0495683_0039967 | 3300047323 | Bacteria | 2370 |
| 369 | Ga0495687_065245 | 3300047443 | Bacteria | 1483 |
| 370 | Ga0495673_0020397 | 3300047469 | Bacteria | 3300 |
| 371 | Ga0495681_0000507 | 3300047470 | Bacteria | 29753 |
| 372 | Ga0495686_0000895 | 3300047472 | Bacteria | 37513 |
| 373 | Ga0495686_0015440 | 3300047472 | Bacteria | 5213 |
| 374 | Ga0495686_0032214 | 3300047472 | Bacteria | 3394 |
| 375 | Ga0495686_0127526 | 3300047472 | Bacteria | 1511 |
| 376 | Ga0496100_0189635 | 3300048903 | Bacteria | 1492 |
| 377 | Ga0496101_0086018 | 3300048904 | Bacteria | 2331 |
| 378 | Ga0496102_0239706 | 3300048905 | Bacteria | 1710 |
| 379 | Ga0496112_0055478 | 3300048915 | Bacteria | 3896 |
| 380 | Ga0496112_0561337 | 3300048915 | Bacteria | 1075 |
| 381 | Ga0496116_0003190 | 3300048919 | Bacteria | 16402 |
| 382 | Ga0496116_0029315 | 3300048919 | Bacteria | 3970 |
| 383 | Ga0496116_0171601 | 3300048919 | Bacteria | 1174 |
| 384 | Ga0496116_0231723 | 3300048919 | Bacteria | 936 |
| 385 | Ga0496117_0000105 | 3300048920 | Bacteria | 188970 |
| 386 | Ga0496117_0001492 | 3300048920 | Bacteria | 33537 |
| 387 | Ga0496117_0015700 | 3300048920 | Bacteria | 6432 |
| 388 | Ga0496118_0000168 | 3300048921 | Bacteria | 118938 |
| 389 | Ga0496118_0002150 | 3300048921 | Bacteria | 27498 |
| 390 | Ga0496118_0043064 | 3300048921 | Bacteria | 3554 |
| 391 | Ga0496118_0054763 | 3300048921 | Bacteria | 3018 |
| 392 | Ga0496119_0000443 | 3300048922 | Bacteria | 56795 |
| 393 | Ga0496119_0000887 | 3300048922 | Bacteria | 39179 |
| 394 | Ga0496119_0003427 | 3300048922 | Bacteria | 16468 |
| 395 | Ga0496119_0167008 | 3300048922 | Bacteria | 1165 |
| 396 | Ga0496120_0000818 | 3300048923 | Bacteria | 44506 |
| 397 | Ga0496120_0001956 | 3300048923 | Bacteria | 22555 |
| 398 | Ga0496120_0005310 | 3300048923 | Bacteria | 10329 |
| 399 | Ga0496121_0007960 | 3300048924 | Bacteria | 12661 |
| 400 | Ga0496121_0010573 | 3300048924 | Bacteria | 10375 |
| 401 | Ga0496121_0011835 | 3300048924 | Bacteria | 9609 |
| 402 | Ga0496121_0018333 | 3300048924 | Bacteria | 7064 |
| 403 | Ga0496121_0208404 | 3300048924 | Bacteria | 1387 |
| 404 | Ga0496121_0251829 | 3300048924 | Bacteria | 1224 |
| 405 | Ga0496122_0001241 | 3300048925 | Bacteria | 43048 |
| 406 | Ga0496122_0002116 | 3300048925 | Bacteria | 29353 |
| 407 | Ga0496122_0023636 | 3300048925 | Bacteria | 5407 |
| 408 | Ga0496122_0024254 | 3300048925 | Bacteria | 5312 |
| 409 | Ga0496122_0108481 | 3300048925 | Bacteria | 1831 |
| 410 | Ga0496123_0001704 | 3300048926 | Bacteria | 29372 |
| 411 | Ga0496123_0078263 | 3300048926 | Bacteria | 2026 |
| 412 | Ga0496124_0000254 | 3300048927 | Bacteria | 103551 |
| 413 | Ga0496124_0002483 | 3300048927 | Bacteria | 24047 |
| 414 | Ga0496125_0005508 | 3300048928 | Bacteria | 14035 |
| 415 | Ga0496126_0019649 | 3300048929 | Bacteria | 6649 |
| 416 | Ga0496126_0060022 | 3300048929 | Bacteria | 3422 |
| 417 | Ga0496126_0135972 | 3300048929 | Bacteria | 2120 |
| 418 | Ga0496126_0463257 | 3300048929 | Bacteria | 1018 |
| 419 | Ga0501031_0050149 | 3300049568 | Bacteria | 2720 |
| 420 | Ga0501031_0387248 | 3300049568 | Bacteria | 904 |
| 421 | Ga0501032_0031140 | 3300049569 | Bacteria | 3658 |
| 422 | Ga0501032_0221206 | 3300049569 | Bacteria | 1232 |
| 423 | Ga0501033_0049424 | 3300049570 | Bacteria | 3121 |
| 424 | Ga0501034_0021544 | 3300049571 | Bacteria | 6567 |
| 425 | Ga0501034_0036262 | 3300049571 | Bacteria | 4995 |
| 426 | Ga0501034_0040943 | 3300049571 | Bacteria | 4688 |
| 427 | Ga0501034_0068225 | 3300049571 | Bacteria | 3567 |
| 428 | Ga0501034_0093632 | 3300049571 | Bacteria | 3001 |
| 429 | Ga0501034_0141786 | 3300049571 | Bacteria | 2382 |
| 430 | Ga0501034_0336890 | 3300049571 | Bacteria | 1439 |
| 431 | Ga0501036_0008992 | 3300049572 | Bacteria | 8214 |
| 432 | Ga0501036_0022398 | 3300049572 | Bacteria | 5314 |
| 433 | Ga0501037_0002781 | 3300049573 | Bacteria | 12670 |
| 434 | Ga0501037_0147244 | 3300049573 | Bacteria | 1684 |
| 435 | Ga0501038_0000719 | 3300049574 | Bacteria | 29592 |
| 436 | Ga0501038_0055560 | 3300049574 | Bacteria | 3401 |
| 437 | Ga0501038_0059032 | 3300049574 | Bacteria | 3287 |
| 438 | Ga0501038_0078454 | 3300049574 | Bacteria | 2786 |
| 439 | Ga0501039_0007166 | 3300049575 | Bacteria | 8493 |
| 440 | Ga0501039_0210862 | 3300049575 | Bacteria | 1528 |
| 441 | Ga0501043_0001293 | 3300049579 | Bacteria | 21959 |
| 442 | Ga0501043_0018589 | 3300049579 | Bacteria | 5453 |
| 443 | Ga0501043_0073913 | 3300049579 | Bacteria | 2677 |
| 444 | Ga0501043_0102304 | 3300049579 | Bacteria | 2252 |
| 445 | Ga0501043_0152822 | 3300049579 | Bacteria | 1806 |
| 446 | Ga0501046_0000870 | 3300049580 | Bacteria | 29401 |
| 447 | Ga0501046_0213584 | 3300049580 | Bacteria | 1431 |
| 448 | Ga0501047_0006799 | 3300049581 | Bacteria | 10745 |
| 449 | Ga0501047_0057841 | 3300049581 | Bacteria | 3748 |
| 450 | Ga0501047_0301652 | 3300049581 | Bacteria | 1444 |
| 451 | Ga0501047_0486964 | 3300049581 | Bacteria | 1061 |
| 452 | Ga0501048_0064234 | 3300049582 | Bacteria | 2596 |
| 453 | Ga0501048_0226349 | 3300049582 | Bacteria | 1327 |
| 454 | Ga0501067_0032064 | 3300049583 | Bacteria | 2915 |
| 455 | Ga0501068_0002004 | 3300049584 | Bacteria | 10828 |
| 456 | Ga0501069_0000173 | 3300049585 | Bacteria | 28962 |
| 457 | Ga0501070_0010809 | 3300049586 | Bacteria | 7711 |
| 458 | Ga0501071_0206603 | 3300049587 | Bacteria | 1476 |
| 459 | Ga0501071_0563766 | 3300049587 | Bacteria | 875 |
| 460 | Ga0501072_0359538 | 3300049588 | Bacteria | 1156 |
| 461 | Ga0501073_0005108 | 3300049589 | Bacteria | 9843 |
| 462 | Ga0501073_0025376 | 3300049589 | Bacteria | 4251 |
| 463 | Ga0501074_0018024 | 3300049590 | Bacteria | 5129 |
| 464 | Ga0501077_0175530 | 3300049593 | Bacteria | 1361 |
| 465 | Ga0501235_038440 | 3300049669 | Bacteria | 1091 |
| 466 | Ga0501079_0056713 | 3300049741 | Bacteria | 3023 |
| 467 | Ga0501080_0003033 | 3300049742 | Bacteria | 14816 |
| 468 | Ga0501080_0386393 | 3300049742 | Bacteria | 1261 |
| 469 | Ga0501080_0435063 | 3300049742 | Bacteria | 1177 |
| 470 | Ga0501080_0561802 | 3300049742 | Bacteria | 1016 |
| 471 | Ga0501083_0062191 | 3300049744 | Bacteria | 2491 |
| 472 | Ga0501035_0000761 | 3300049822 | Bacteria | 34698 |
| 473 | Ga0501035_0002936 | 3300049822 | Bacteria | 16408 |
| 474 | Ga0501035_0004337 | 3300049822 | Bacteria | 13460 |
| 475 | Ga0501035_0076286 | 3300049822 | Bacteria | 2964 |
| 476 | Ga0501035_0081566 | 3300049822 | Bacteria | 2855 |
| 477 | Ga0501035_0088379 | 3300049822 | Bacteria | 2730 |
| 478 | Ga0501035_0098864 | 3300049822 | Bacteria | 2562 |
| 479 | Ga0501035_0182226 | 3300049822 | Bacteria | 1809 |
| 480 | Ga0501035_0219717 | 3300049822 | Bacteria | 1623 |
| 481 | Ga0501044_0001378 | 3300049823 | Bacteria | 28512 |
| 482 | Ga0501044_0009708 | 3300049823 | Bacteria | 10469 |
| 483 | Ga0501044_0032797 | 3300049823 | Bacteria | 5459 |
| 484 | Ga0501044_0047292 | 3300049823 | Bacteria | 4450 |
| 485 | Ga0501044_0052558 | 3300049823 | Bacteria | 4197 |
| 486 | Ga0501044_0104048 | 3300049823 | Bacteria | 2853 |
| 487 | Ga0501044_0116371 | 3300049823 | Bacteria | 2679 |
| 488 | Ga0501044_0281915 | 3300049823 | Bacteria | 1595 |
| 489 | Ga0501044_0519168 | 3300049823 | Bacteria | 1091 |
| 490 | nmdc:mga00v17_62245_c1 | 3300050491 | Bacteria | 2295 |
| 491 | nmdc:mga0yw44_120165_c1 | 3300050492 | Bacteria | 1692 |
| 492 | nmdc:mga0yw44_81891_c1 | 3300050492 | Bacteria | 2024 |
| 493 | nmdc:mga0k408_160305_c1 | 3300050493 | Bacteria | 1340 |
| 494 | nmdc:mga06z11_235656_c1 | 3300050494 | Bacteria | 1073 |
| 495 | nmdc:mga05p37_496978_c1 | 3300050507 | Bacteria | 1401 |
| 496 | nmdc:mga08y16_228982_c1 | 3300050511 | Bacteria | 1922 |
| 497 | nmdc:mga0sz30_61644_c1 | 3300050516 | Bacteria | 1603 |
| 498 | Ga0495601_0044228 | 3300053077 | Bacteria | 2799 |
| 499 | Ga0495619_0036333 | 3300053085 | Bacteria | 3207 |
| 500 | Ga0500646_0023416 | 3300053090 | Bacteria | 1656 |
| 501 | Ga0500641_0000215 | 3300053096 | Bacteria | 21838 |
| 502 | Ga0500650_0000740 | 3300053098 | Bacteria | 8834 |
| 503 | Ga0500556_0000096 | 3300053104 | Bacteria | 82203 |
| 504 | Ga0500562_000451 | 3300053108 | Bacteria | 10026 |
| 505 | Ga0500569_017589 | 3300053109 | Bacteria | 1830 |
| 506 | Ga0500592_000483 | 3300053116 | Bacteria | 6589 |
| 507 | Ga0500608_000668 | 3300053122 | Bacteria | 12543 |
| 508 | Ga0500618_000019 | 3300053125 | Bacteria | 161916 |
| 509 | Ga0500618_000118 | 3300053125 | Bacteria | 64472 |
| 510 | Ga0500618_005648 | 3300053125 | Bacteria | 3773 |
| 511 | Ga0500652_000248 | 3300053131 | Bacteria | 20322 |
| 512 | Ga0500568_0000115 | 3300053139 | Bacteria | 72862 |
| 513 | Ga0500568_0000509 | 3300053139 | Bacteria | 28652 |
| 514 | Ga0500577_0135051 | 3300053142 | Bacteria | 1037 |
| 515 | Ga0500590_021736 | 3300053148 | Bacteria | 3329 |
| 516 | Ga0500604_0000069 | 3300053151 | Bacteria | 37014 |
| 517 | Ga0500616_0000108 | 3300053153 | Bacteria | 152917 |
| 518 | Ga0500616_0000835 | 3300053153 | Bacteria | 34593 |
| 519 | Ga0500616_0001606 | 3300053153 | Bacteria | 21050 |
| 520 | Ga0500616_0002508 | 3300053153 | Bacteria | 15198 |
| 521 | Ga0500627_0001228 | 3300053158 | Bacteria | 7064 |
| 522 | Ga0500627_0096673 | 3300053158 | Bacteria | 1324 |
| 523 | Ga0500633_0000138 | 3300053160 | Bacteria | 9646 |
| 524 | Ga0500634_0084591 | 3300053161 | Bacteria | 1625 |
| 525 | Ga0500611_008299 | 3300053727 | Bacteria | 1601 |
| 526 | Ga0501084_0000769 | 3300054114 | Bacteria | 24411 |
| 527 | Ga0501084_0010651 | 3300054114 | Bacteria | 7611 |
| 528 | Ga0590071_005517 | 3300059421 | Bacteria | 3039 |
| 529 | Ga0587091_020514 | 3300059511 | Bacteria | 1148 |
| 530 | Ga0587062_011051 | 3300059639 | Bacteria | 1131 |
| 531 | Ga0587072_021504 | 3300059643 | Bacteria | 1145 |
| 532 | Ga0501082_0016299 | 3300060353 | Bacteria | 6396 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025898 | Ga0207692_10190147 | Ga0207692_101901472 | 230 |
| 2 | 3300003214 | JGI25165J46597_1000007 | JGI25165J46597_100000731 | 243 |
| 3 | 3300025261 | Ga0209233_1000026 | Ga0209233_100002632 | 243 |
| 4 | 3300005563 | Ga0068855_100706410 | Ga0068855_1007064101 | 244 |
| 5 | 3300009093 | Ga0105240_10552493 | Ga0105240_105524932 | 244 |
| 6 | 3300025913 | Ga0207695_10558830 | Ga0207695_105588301 | 244 |
| 7 | 3300026078 | Ga0207702_10230131 | Ga0207702_102301312 | 244 |
| 8 | 3300045051 | Ga0451576_0299115 | Ga0451576_0299115_523_1383 | 244 |
| 9 | 3300049571 | Ga0501034_0093632 | Ga0501034_0093632_481_1236 | 244 |
| 10 | 3300049822 | Ga0501035_0219717 | Ga0501035_0219717_303_1058 | 244 |
| 11 | 3300049823 | Ga0501044_0047292 | Ga0501044_0047292_1856_2611 | 244 |
| 12 | 3300049568 | Ga0501031_0387248 | Ga0501031_0387248_12_767 | 245 |
| 13 | 3300049823 | Ga0501044_0104048 | Ga0501044_0104048_691_1464 | 246 |
| 14 | 3300048924 | Ga0496121_0208404 | Ga0496121_0208404_150_929 | 249 |
| 15 | 3300049587 | Ga0501071_0206603 | Ga0501071_0206603_220_972 | 250 |
| 16 | 3300010159 | Ga0099796_10056641 | Ga0099796_100566411 | 252 |
| 17 | iso_pu_bacteria | 2687453257 | 2688070008 | 252 |
| 18 | iso_pu_bacteria | 2751185897 | 2753763350 | 252 |
| 19 | iso_pu_bacteria | 2941499720 | 2941506566 | 252 |
| 20 | iso_pu_bacteria | 8016522445 | 8016529478 | 252 |
| 21 | iso_pu_bacteria | 8016530956 | 8016534689 | 252 |
| 22 | iso_pu_bacteria | 8016539877 | 8016547906 | 252 |
| 23 | iso_pu_bacteria | 8016548790 | 8016554225 | 252 |
| 24 | iso_pu_bacteria | 8016557553 | 8016562599 | 252 |
| 25 | iso_pu_bacteria | 8016566248 | 8016573039 | 252 |
| 26 | iso_pu_bacteria | 8016575299 | 8016577186 | 252 |
| 27 | iso_pu_bacteria | 8016595262 | 8016600387 | 252 |
| 28 | iso_pu_bacteria | 8019530166 | 8019534455 | 252 |
| 29 | 3300009093 | Ga0105240_10003294 | Ga0105240_1000329426 | 253 |
| 30 | 3300025913 | Ga0207695_10005241 | Ga0207695_100052418 | 253 |
| 31 | 3300046522 | Ga0495643_0121666 | Ga0495643_0121666_543_1307 | 253 |
| 32 | 3300046522 | Ga0495643_0140209 | Ga0495643_0140209_97_858 | 253 |
| 33 | 3300049571 | Ga0501034_0141786 | Ga0501034_0141786_596_1390 | 253 |
| 34 | iso_pu_bacteria | 2510917026 | 2511169692 | 253 |
| 35 | iso_pu_bacteria | 2513237146 | 2513923596 | 253 |
| 36 | iso_pu_bacteria | 2582581299 | 2585228030 | 253 |
| 37 | iso_pu_bacteria | 2585427633 | 2585994195 | 253 |
| 38 | iso_pu_bacteria | 2599185170 | 2599415623 | 253 |
| 39 | iso_pu_bacteria | 2643221634 | 2644195412 | 253 |
| 40 | iso_pu_bacteria | 2894652903 | 2894655114 | 253 |
| 41 | iso_pu_bacteria | 2919171160 | 2919172240 | 253 |
| 42 | iso_pu_bacteria | 2933016740 | 2933019571 | 253 |
| 43 | iso_pu_bacteria | 3005416602 | 3005419833 | 253 |
| 44 | 3300048922 | Ga0496119_0167008 | Ga0496119_0167008_13_783 | 254 |
| 45 | 3300049742 | Ga0501080_0386393 | Ga0501080_0386393_416_1189 | 254 |
| 46 | iso_pu_bacteria | 2513237138 | 2513871530 | 254 |
| 47 | iso_pu_bacteria | 2554235003 | 2554249216 | 254 |
| 48 | iso_pu_bacteria | 2554235003 | 2554249779 | 254 |
| 49 | iso_pu_bacteria | 2582581308 | 2585282755 | 254 |
| 50 | iso_pu_bacteria | 2599185236 | 2599722931 | 254 |
| 51 | iso_pu_bacteria | 2600255279 | 2601612992 | 254 |
| 52 | iso_pu_bacteria | 2600255308 | 2601749726 | 254 |
| 53 | iso_pu_bacteria | 2615840626 | 2616309895 | 254 |
| 54 | iso_pu_bacteria | 2615840698 | 2616550848 | 254 |
| 55 | iso_pu_bacteria | 2643221551 | 2643774685 | 254 |
| 56 | iso_pu_bacteria | 2643221555 | 2643793130 | 254 |
| 57 | iso_pu_bacteria | 2643221599 | 2644005635 | 254 |
| 58 | iso_pu_bacteria | 2643221693 | 2644520073 | 254 |
| 59 | iso_pu_bacteria | 2667528174 | 2671117208 | 254 |
| 60 | iso_pu_bacteria | 2738541293 | 2738804450 | 254 |
| 61 | iso_pu_bacteria | 2808606387 | 2808989805 | 254 |
| 62 | iso_pu_bacteria | 2818991448 | 2819613775 | 254 |
| 63 | iso_pu_bacteria | 2899845264 | 2899848165 | 254 |
| 64 | iso_pu_bacteria | 2920107658 | 2920111879 | 254 |
| 65 | iso_pu_bacteria | 2933594066 | 2933598839 | 254 |
| 66 | iso_pu_bacteria | 2979089926 | 2979091921 | 254 |
| 67 | iso_pu_bacteria | 2979095461 | 2979100864 | 254 |
| 68 | iso_pu_bacteria | 2979100975 | 2979103116 | 254 |
| 69 | iso_pu_bacteria | 2984587000 | 2984588998 | 254 |
| 70 | iso_pu_bacteria | 2984601300 | 2984606482 | 254 |
| 71 | iso_pu_bacteria | 3005445848 | 3005452556 | 254 |
| 72 | iso_pu_bacteria | 8005619151 | 8005626110 | 254 |
| 73 | 3300005844 | Ga0068862_100023064 | Ga0068862_1000230644 | 255 |
| 74 | 3300013306 | Ga0163162_10077655 | Ga0163162_100776552 | 255 |
| 75 | 3300013307 | Ga0157372_10016648 | Ga0157372_100166482 | 255 |
| 76 | 3300025972 | Ga0207668_10152568 | Ga0207668_101525681 | 255 |
| 77 | 3300028380 | Ga0268265_10038671 | Ga0268265_100386712 | 255 |
| 78 | 3300028800 | Ga0265338_10014046 | Ga0265338_100140463 | 255 |
| 79 | 3300030742 | Ga0316183_1079280 | Ga0316183_107928023 | 255 |
| 80 | 3300030744 | Ga0316181_1053827 | Ga0316181_10538278 | 255 |
| 81 | 3300038443 | Ga0395901_0395074 | Ga0395901_0395074_14_784 | 255 |
| 82 | 3300039438 | Ga0436360_0187655 | Ga0436360_0187655_456_1289 | 255 |
| 83 | 3300039447 | Ga0436361_0852213 | Ga0436361_0852213_367_1134 | 255 |
| 84 | 3300039450 | Ga0436363_0599542 | Ga0436363_0599542_1542_2360 | 255 |
| 85 | 3300046558 | Ga0495633_0035246 | Ga0495633_0035246_120_890 | 255 |
| 86 | 3300049587 | Ga0501071_0563766 | Ga0501071_0563766_31_798 | 255 |
| 87 | 3300049593 | Ga0501077_0175530 | Ga0501077_0175530_374_1213 | 255 |
| 88 | iso_pu_bacteria | 2643221599 | 2644005428 | 255 |
| 89 | iso_pu_bacteria | 2808606418 | 2809143512 | 255 |
| 90 | iso_pu_bacteria | 2838035591 | 2838035738 | 255 |
| 91 | iso_pu_bacteria | 2857564685 | 2857568494 | 255 |
| 92 | 3300005334 | Ga0068869_100046108 | Ga0068869_1000461084 | 256 |
| 93 | 3300005336 | Ga0070680_100018410 | Ga0070680_1000184102 | 256 |
| 94 | 3300005355 | Ga0070671_100014711 | Ga0070671_1000147115 | 256 |
| 95 | 3300005364 | Ga0070673_100309432 | Ga0070673_1003094322 | 256 |
| 96 | 3300005367 | Ga0070667_100210760 | Ga0070667_1002107602 | 256 |
| 97 | 3300005455 | Ga0070663_100018359 | Ga0070663_1000183592 | 256 |
| 98 | 3300005458 | Ga0070681_10009722 | Ga0070681_100097222 | 256 |
| 99 | 3300005458 | Ga0070681_10050360 | Ga0070681_100503605 | 256 |
| 100 | 3300005458 | Ga0070681_10052932 | Ga0070681_100529325 | 256 |
| 101 | 3300005530 | Ga0070679_100168601 | Ga0070679_1001686014 | 256 |
| 102 | 3300005530 | Ga0070679_100242190 | Ga0070679_1002421902 | 256 |
| 103 | 3300005539 | Ga0068853_100033372 | Ga0068853_1000333722 | 256 |
| 104 | 3300005548 | Ga0070665_100005211 | Ga0070665_1000052116 | 256 |
| 105 | 3300005548 | Ga0070665_100054166 | Ga0070665_1000541664 | 256 |
| 106 | 3300005563 | Ga0068855_100299976 | Ga0068855_1002999763 | 256 |
| 107 | 3300005617 | Ga0068859_100039259 | Ga0068859_1000392594 | 256 |
| 108 | 3300005618 | Ga0068864_100126788 | Ga0068864_1001267882 | 256 |
| 109 | 3300005841 | Ga0068863_100017047 | Ga0068863_1000170474 | 256 |
| 110 | 3300005843 | Ga0068860_100007748 | Ga0068860_1000077483 | 256 |
| 111 | 3300005843 | Ga0068860_100537278 | Ga0068860_1005372782 | 256 |
| 112 | 3300006038 | Ga0075365_10078362 | Ga0075365_100783622 | 256 |
| 113 | 3300006186 | Ga0075369_10076040 | Ga0075369_100760401 | 256 |
| 114 | 3300006931 | Ga0097620_100039259 | Ga0097620_1000392594 | 256 |
| 115 | 3300009093 | Ga0105240_10093216 | Ga0105240_100932163 | 256 |
| 116 | 3300009094 | Ga0111539_10816202 | Ga0111539_108162022 | 256 |
| 117 | 3300009545 | Ga0105237_10011270 | Ga0105237_1001127010 | 256 |
| 118 | 3300009551 | Ga0105238_10527440 | Ga0105238_105274402 | 256 |
| 119 | 3300010375 | Ga0105239_10001636 | Ga0105239_100016363 | 256 |
| 120 | 3300010375 | Ga0105239_10090153 | Ga0105239_100901533 | 256 |
| 121 | 3300013307 | Ga0157372_10779420 | Ga0157372_107794202 | 256 |
| 122 | 3300014497 | Ga0182008_10000299 | Ga0182008_100002997 | 256 |
| 123 | 3300014968 | Ga0157379_10131101 | Ga0157379_101311013 | 256 |
| 124 | 3300021384 | Ga0213876_10000722 | Ga0213876_100007225 | 256 |
| 125 | 3300025294 | Ga0209025_1001673 | Ga0209025_10016739 | 256 |
| 126 | 3300025294 | Ga0209025_1033646 | Ga0209025_10336462 | 256 |
| 127 | 3300025904 | Ga0207647_10011540 | Ga0207647_100115402 | 256 |
| 128 | 3300025912 | Ga0207707_10011776 | Ga0207707_100117763 | 256 |
| 129 | 3300025912 | Ga0207707_10074419 | Ga0207707_100744192 | 256 |
| 130 | 3300025913 | Ga0207695_10019958 | Ga0207695_100199583 | 256 |
| 131 | 3300025913 | Ga0207695_10048486 | Ga0207695_100484863 | 256 |
| 132 | 3300025914 | Ga0207671_10015821 | Ga0207671_100158214 | 256 |
| 133 | 3300025921 | Ga0207652_10093110 | Ga0207652_100931102 | 256 |
| 134 | 3300025921 | Ga0207652_10300587 | Ga0207652_103005872 | 256 |
| 135 | 3300025924 | Ga0207694_10444588 | Ga0207694_104445882 | 256 |
| 136 | 3300025927 | Ga0207687_10049717 | Ga0207687_100497173 | 256 |
| 137 | 3300025932 | Ga0207690_10000560 | Ga0207690_1000056021 | 256 |
| 138 | 3300025932 | Ga0207690_10026894 | Ga0207690_100268944 | 256 |
| 139 | 3300025944 | Ga0207661_10064175 | Ga0207661_100641752 | 256 |
| 140 | 3300025949 | Ga0207667_10032412 | Ga0207667_100324128 | 256 |
| 141 | 3300025981 | Ga0207640_10471579 | Ga0207640_104715791 | 256 |
| 142 | 3300026023 | Ga0207677_10012976 | Ga0207677_100129764 | 256 |
| 143 | 3300026023 | Ga0207677_10159223 | Ga0207677_101592232 | 256 |
| 144 | 3300026041 | Ga0207639_10039561 | Ga0207639_100395611 | 256 |
| 145 | 3300026067 | Ga0207678_10007267 | Ga0207678_100072676 | 256 |
| 146 | 3300026078 | Ga0207702_10241730 | Ga0207702_102417303 | 256 |
| 147 | 3300026088 | Ga0207641_10071501 | Ga0207641_100715013 | 256 |
| 148 | 3300026095 | Ga0207676_10084321 | Ga0207676_100843212 | 256 |
| 149 | 3300026121 | Ga0207683_10137049 | Ga0207683_101370493 | 256 |
| 150 | 3300027682 | Ga0209971_1001802 | Ga0209971_10018023 | 256 |
| 151 | 3300027876 | Ga0209974_10001618 | Ga0209974_100016185 | 256 |
| 152 | 3300028379 | Ga0268266_10004733 | Ga0268266_100047336 | 256 |
| 153 | 3300028379 | Ga0268266_10061451 | Ga0268266_100614513 | 256 |
| 154 | 3300028381 | Ga0268264_10017332 | Ga0268264_100173323 | 256 |
| 155 | 3300028381 | Ga0268264_10430490 | Ga0268264_104304901 | 256 |
| 156 | 3300028786 | Ga0307517_10108368 | Ga0307517_101083682 | 256 |
| 157 | 3300031548 | Ga0307408_100005956 | Ga0307408_1000059564 | 256 |
| 158 | 3300031548 | Ga0307408_100021693 | Ga0307408_1000216932 | 256 |
| 159 | 3300031731 | Ga0307405_10021259 | Ga0307405_100212592 | 256 |
| 160 | 3300031824 | Ga0307413_10014691 | Ga0307413_100146912 | 256 |
| 161 | 3300031824 | Ga0307413_10071834 | Ga0307413_100718342 | 256 |
| 162 | 3300031824 | Ga0307413_10514519 | Ga0307413_105145191 | 256 |
| 163 | 3300031852 | Ga0307410_10002563 | Ga0307410_100025633 | 256 |
| 164 | 3300031901 | Ga0307406_10007763 | Ga0307406_100077635 | 256 |
| 165 | 3300031901 | Ga0307406_10024470 | Ga0307406_100244702 | 256 |
| 166 | 3300031901 | Ga0307406_10057836 | Ga0307406_100578362 | 256 |
| 167 | 3300031903 | Ga0307407_10005436 | Ga0307407_100054365 | 256 |
| 168 | 3300031911 | Ga0307412_10040892 | Ga0307412_100408923 | 256 |
| 169 | 3300031995 | Ga0307409_100157120 | Ga0307409_1001571202 | 256 |
| 170 | 3300032002 | Ga0307416_100015363 | Ga0307416_1000153632 | 256 |
| 171 | 3300032002 | Ga0307416_100042662 | Ga0307416_1000426623 | 256 |
| 172 | 3300032002 | Ga0307416_100075669 | Ga0307416_1000756693 | 256 |
| 173 | 3300032002 | Ga0307416_100094441 | Ga0307416_1000944413 | 256 |
| 174 | 3300032002 | Ga0307416_100318052 | Ga0307416_1003180522 | 256 |
| 175 | 3300032004 | Ga0307414_10039076 | Ga0307414_100390762 | 256 |
| 176 | 3300032004 | Ga0307414_10129600 | Ga0307414_101296002 | 256 |
| 177 | 3300032005 | Ga0307411_10002464 | Ga0307411_100024643 | 256 |
| 178 | 3300032005 | Ga0307411_10028882 | Ga0307411_100288823 | 256 |
| 179 | 3300032126 | Ga0307415_100017399 | Ga0307415_1000173993 | 256 |
| 180 | 3300032126 | Ga0307415_100058167 | Ga0307415_1000581672 | 256 |
| 181 | 3300032126 | Ga0307415_100149965 | Ga0307415_1001499652 | 256 |
| 182 | 3300032126 | Ga0307415_100223232 | Ga0307415_1002232323 | 256 |
| 183 | 3300035113 | Ga0373936_0023715 | Ga0373936_0023715_1160_1933 | 256 |
| 184 | 3300037418 | Ga0395900_0064281 | Ga0395900_0064281_705_1475 | 256 |
| 185 | 3300037853 | Ga0436364_1210875 | Ga0436364_1210875_6871_7641 | 256 |
| 186 | 3300038443 | Ga0395901_0106778 | Ga0395901_0106778_1217_1987 | 256 |
| 187 | 3300039437 | Ga0436365_1664331 | Ga0436365_1664331_6820_7593 | 256 |
| 188 | 3300039438 | Ga0436360_0139976 | Ga0436360_0139976_41_811 | 256 |
| 189 | 3300039447 | Ga0436361_0120332 | Ga0436361_0120332_212_982 | 256 |
| 190 | 3300039450 | Ga0436363_0983892 | Ga0436363_0983892_113_886 | 256 |
| 191 | 3300042004 | Ga0439445_0001786 | Ga0439445_0001786_3784_4554 | 256 |
| 192 | 3300044684 | Ga0466966_0260678 | Ga0466966_0260678_141_911 | 256 |
| 193 | 3300045976 | Ga0466967_0281495 | Ga0466967_0281495_387_1172 | 256 |
| 194 | 3300046460 | Ga0495638_0012345 | Ga0495638_0012345_3391_4191 | 256 |
| 195 | 3300046501 | Ga0495607_0084043 | Ga0495607_0084043_797_1597 | 256 |
| 196 | 3300046512 | Ga0495610_0010646 | Ga0495610_0010646_2888_3688 | 256 |
| 197 | 3300046513 | Ga0495616_0018893 | Ga0495616_0018893_740_1540 | 256 |
| 198 | 3300046515 | Ga0495620_0088732 | Ga0495620_0088732_342_1142 | 256 |
| 199 | 3300046518 | Ga0495631_0132465 | Ga0495631_0132465_212_1012 | 256 |
| 200 | 3300046520 | Ga0495637_0050020 | Ga0495637_0050020_584_1384 | 256 |
| 201 | 3300046525 | Ga0495663_0014075 | Ga0495663_0014075_167_937 | 256 |
| 202 | 3300046528 | Ga0495642_0126915 | Ga0495642_0126915_267_1037 | 256 |
| 203 | 3300046530 | Ga0495654_0105144 | Ga0495654_0105144_121_921 | 256 |
| 204 | 3300046539 | Ga0495621_0040351 | Ga0495621_0040351_701_1471 | 256 |
| 205 | 3300046558 | Ga0495633_0039557 | Ga0495633_0039557_1258_2058 | 256 |
| 206 | 3300046648 | Ga0495611_0000015 | Ga0495611_0000015_126080_126916 | 256 |
| 207 | 3300046665 | Ga0495661_0002896 | Ga0495661_0002896_8091_8891 | 256 |
| 208 | 3300046684 | Ga0495669_0024527 | Ga0495669_0024527_637_1407 | 256 |
| 209 | 3300046691 | Ga0495670_0088646 | Ga0495670_0088646_658_1428 | 256 |
| 210 | 3300046810 | Ga0495660_0019879 | Ga0495660_0019879_980_1780 | 256 |
| 211 | 3300047472 | Ga0495686_0032214 | Ga0495686_0032214_730_1530 | 256 |
| 212 | 3300048919 | Ga0496116_0171601 | Ga0496116_0171601_206_1006 | 256 |
| 213 | 3300048925 | Ga0496122_0024254 | Ga0496122_0024254_1945_2745 | 256 |
| 214 | 3300048926 | Ga0496123_0078263 | Ga0496123_0078263_579_1379 | 256 |
| 215 | 3300048929 | Ga0496126_0060022 | Ga0496126_0060022_1666_2466 | 256 |
| 216 | 3300049669 | Ga0501235_038440 | Ga0501235_038440_281_1051 | 256 |
| 217 | 3300050492 | nmdc:mga0yw44_120165_c1 | nmdc:mga0yw44_120165_c1_797_1597 | 256 |
| 218 | 3300050492 | nmdc:mga0yw44_81891_c1 | nmdc:mga0yw44_81891_c1_99_929 | 256 |
| 219 | 3300050516 | nmdc:mga0sz30_61644_c1 | nmdc:mga0sz30_61644_c1_69_869 | 256 |
| 220 | 3300053096 | Ga0500641_0000215 | Ga0500641_0000215_4481_5281 | 256 |
| 221 | 3300053098 | Ga0500650_0000740 | Ga0500650_0000740_6788_7588 | 256 |
| 222 | 3300053108 | Ga0500562_000451 | Ga0500562_000451_4703_5503 | 256 |
| 223 | 3300053109 | Ga0500569_017589 | Ga0500569_017589_235_1035 | 256 |
| 224 | 3300053116 | Ga0500592_000483 | Ga0500592_000483_3595_4395 | 256 |
| 225 | 3300053131 | Ga0500652_000248 | Ga0500652_000248_13468_14268 | 256 |
| 226 | 3300053139 | Ga0500568_0000115 | Ga0500568_0000115_7701_8501 | 256 |
| 227 | 3300053151 | Ga0500604_0000069 | Ga0500604_0000069_25152_25952 | 256 |
| 228 | 3300053158 | Ga0500627_0001228 | Ga0500627_0001228_3378_4178 | 256 |
| 229 | 3300053161 | Ga0500634_0084591 | Ga0500634_0084591_254_1054 | 256 |
| 230 | 3300053727 | Ga0500611_008299 | Ga0500611_008299_70_870 | 256 |
| 231 | iso_pu_bacteria | 2643221688 | 2644492142 | 256 |
| 232 | iso_pu_bacteria | 2929154850 | 2929157556 | 256 |
| 233 | iso_pu_bacteria | 2989349275 | 2989350587 | 256 |
| 234 | 3300003215 | JGI25153J46596_10024811 | JGI25153J46596_100248112 | 257 |
| 235 | 3300003323 | rootH1_10057858 | rootH1_100578584 | 257 |
| 236 | 3300003792 | Ga0055540_1006835 | Ga0055540_10068352 | 257 |
| 237 | 3300003794 | Ga0055531_10003632 | Ga0055531_100036328 | 257 |
| 238 | 3300005288 | Ga0065714_10067355 | Ga0065714_1006735512 | 257 |
| 239 | 3300005356 | Ga0070674_100003805 | Ga0070674_1000038054 | 257 |
| 240 | 3300005364 | Ga0070673_100103670 | Ga0070673_1001036704 | 257 |
| 241 | 3300005456 | Ga0070678_100000306 | Ga0070678_10000030615 | 257 |
| 242 | 3300005456 | Ga0070678_100170783 | Ga0070678_1001707832 | 257 |
| 243 | 3300005577 | Ga0068857_100211983 | Ga0068857_1002119832 | 257 |
| 244 | 3300006237 | Ga0097621_100046882 | Ga0097621_1000468823 | 257 |
| 245 | 3300009093 | Ga0105240_10009140 | Ga0105240_100091402 | 257 |
| 246 | 3300009148 | Ga0105243_10000308 | Ga0105243_1000030821 | 257 |
| 247 | 3300009545 | Ga0105237_10000028 | Ga0105237_1000002828 | 257 |
| 248 | 3300013307 | Ga0157372_10515208 | Ga0157372_105152081 | 257 |
| 249 | 3300025233 | Ga0209437_100261 | Ga0209437_10026125 | 257 |
| 250 | 3300025292 | Ga0209676_1013255 | Ga0209676_10132552 | 257 |
| 251 | 3300025294 | Ga0209025_1049308 | Ga0209025_10493082 | 257 |
| 252 | 3300025297 | Ga0209758_1000170 | Ga0209758_100017019 | 257 |
| 253 | 3300025303 | Ga0209051_1001025 | Ga0209051_100102512 | 257 |
| 254 | 3300025907 | Ga0207645_10360171 | Ga0207645_103601711 | 257 |
| 255 | 3300025913 | Ga0207695_10004032 | Ga0207695_100040322 | 257 |
| 256 | 3300025937 | Ga0207669_10002638 | Ga0207669_100026386 | 257 |
| 257 | 3300025960 | Ga0207651_10200640 | Ga0207651_102006403 | 257 |
| 258 | 3300026121 | Ga0207683_10008731 | Ga0207683_100087314 | 257 |
| 259 | 3300026142 | Ga0207698_10097046 | Ga0207698_100970462 | 257 |
| 260 | 3300028794 | Ga0307515_10000569 | Ga0307515_1000056928 | 257 |
| 261 | 3300028794 | Ga0307515_10392928 | Ga0307515_103929281 | 257 |
| 262 | 3300030521 | Ga0307511_10000046 | Ga0307511_1000004645 | 257 |
| 263 | 3300031595 | Ga0265313_10058149 | Ga0265313_100581493 | 257 |
| 264 | 3300037853 | Ga0436364_0801868 | Ga0436364_0801868_140_913 | 257 |
| 265 | 3300039437 | Ga0436365_1140201 | Ga0436365_1140201_740_1525 | 257 |
| 266 | 3300039437 | Ga0436365_1666840 | Ga0436365_1666840_413_1186 | 257 |
| 267 | 3300044694 | Ga0466963_0013078 | Ga0466963_0013078_2604_3380 | 257 |
| 268 | 3300044765 | Ga0466970_0004643 | Ga0466970_0004643_3897_4673 | 257 |
| 269 | 3300044842 | Ga0466957_0062317 | Ga0466957_0062317_165_941 | 257 |
| 270 | 3300045049 | Ga0466959_0227486 | Ga0466959_0227486_118_894 | 257 |
| 271 | 3300045051 | Ga0451576_0255673 | Ga0451576_0255673_780_1553 | 257 |
| 272 | 3300045836 | Ga0466958_0150978 | Ga0466958_0150978_208_984 | 257 |
| 273 | 3300045976 | Ga0466967_0025766 | Ga0466967_0025766_1799_2575 | 257 |
| 274 | 3300046460 | Ga0495638_0000435 | Ga0495638_0000435_38469_39242 | 257 |
| 275 | 3300046474 | Ga0495605_0015613 | Ga0495605_0015613_2946_3719 | 257 |
| 276 | 3300046491 | Ga0495584_0002107 | Ga0495584_0002107_5875_6648 | 257 |
| 277 | 3300046492 | Ga0495585_0000353 | Ga0495585_0000353_31955_32728 | 257 |
| 278 | 3300046500 | Ga0495596_0000680 | Ga0495596_0000680_14091_14864 | 257 |
| 279 | 3300046500 | Ga0495596_0003120 | Ga0495596_0003120_3688_4461 | 257 |
| 280 | 3300046500 | Ga0495596_0007022 | Ga0495596_0007022_1630_2406 | 257 |
| 281 | 3300046506 | Ga0495583_0001156 | Ga0495583_0001156_7701_8474 | 257 |
| 282 | 3300046513 | Ga0495616_0001403 | Ga0495616_0001403_11650_12423 | 257 |
| 283 | 3300046529 | Ga0495652_0265727 | Ga0495652_0265727_248_1021 | 257 |
| 284 | 3300046536 | Ga0495587_0292772 | Ga0495587_0292772_23_796 | 257 |
| 285 | 3300046538 | Ga0495609_0018871 | Ga0495609_0018871_1059_1832 | 257 |
| 286 | 3300046542 | Ga0495597_0038721 | Ga0495597_0038721_1060_1836 | 257 |
| 287 | 3300046557 | Ga0495622_0000023 | Ga0495622_0000023_58428_59201 | 257 |
| 288 | 3300046616 | Ga0495668_0003498 | Ga0495668_0003498_4106_4879 | 257 |
| 289 | 3300046616 | Ga0495668_0044564 | Ga0495668_0044564_1193_1966 | 257 |
| 290 | 3300046660 | Ga0495625_0063484 | Ga0495625_0063484_674_1447 | 257 |
| 291 | 3300046660 | Ga0495625_0112793 | Ga0495625_0112793_214_990 | 257 |
| 292 | 3300047318 | Ga0495636_0025214 | Ga0495636_0025214_1291_2064 | 257 |
| 293 | 3300047320 | Ga0495672_0071824 | Ga0495672_0071824_238_1011 | 257 |
| 294 | 3300047323 | Ga0495683_0000151 | Ga0495683_0000151_32315_33088 | 257 |
| 295 | 3300047323 | Ga0495683_0015726 | Ga0495683_0015726_2285_3061 | 257 |
| 296 | 3300047469 | Ga0495673_0020397 | Ga0495673_0020397_2223_2996 | 257 |
| 297 | 3300047472 | Ga0495686_0127526 | Ga0495686_0127526_584_1360 | 257 |
| 298 | 3300048924 | Ga0496121_0251829 | Ga0496121_0251829_187_960 | 257 |
| 299 | 3300053090 | Ga0500646_0023416 | Ga0500646_0023416_677_1450 | 257 |
| 300 | 3300053139 | Ga0500568_0000509 | Ga0500568_0000509_16581_17354 | 257 |
| 301 | 3300053142 | Ga0500577_0135051 | Ga0500577_0135051_119_892 | 257 |
| 302 | 3300053148 | Ga0500590_021736 | Ga0500590_021736_1779_2552 | 257 |
| 303 | 3300053153 | Ga0500616_0000835 | Ga0500616_0000835_13303_14076 | 257 |
| 304 | 3300053153 | Ga0500616_0001606 | Ga0500616_0001606_11272_12045 | 257 |
| 305 | 3300053153 | Ga0500616_0002508 | Ga0500616_0002508_2949_3722 | 257 |
| 306 | 3300053158 | Ga0500627_0096673 | Ga0500627_0096673_396_1169 | 257 |
| 307 | 3300059511 | Ga0587091_020514 | Ga0587091_020514_197_970 | 257 |
| 308 | 3300059639 | Ga0587062_011051 | Ga0587062_011051_195_968 | 257 |
| 309 | 3300059643 | Ga0587072_021504 | Ga0587072_021504_177_950 | 257 |
| 310 | iso_pu_bacteria | 2513237138 | 2513868138 | 257 |
| 311 | iso_pu_bacteria | 2582581867 | 2585401859 | 257 |
| 312 | iso_pu_bacteria | 2585427590 | 2585820273 | 257 |
| 313 | iso_pu_bacteria | 2615840624 | 2616293014 | 257 |
| 314 | iso_pu_bacteria | 2718217882 | 2719180567 | 257 |
| 315 | iso_pu_bacteria | 2718218009 | 2719731316 | 257 |
| 316 | iso_pu_bacteria | 2718218363 | 2721146661 | 257 |
| 317 | iso_pu_bacteria | 2718218365 | 2721158186 | 257 |
| 318 | iso_pu_bacteria | 2718218366 | 2721163540 | 257 |
| 319 | iso_pu_bacteria | 2721755514 | 2722839710 | 257 |
| 320 | iso_pu_bacteria | 2721755810 | 2724044072 | 257 |
| 321 | iso_pu_bacteria | 2728369365 | 2730163804 | 257 |
| 322 | iso_pu_bacteria | 2728369397 | 2730297818 | 257 |
| 323 | iso_pu_bacteria | 2791355264 | 2793350252 | 257 |
| 324 | iso_pu_bacteria | 2923556063 | 2923560507 | 257 |
| 325 | iso_pu_bacteria | 8005289223 | 8005293677 | 257 |
| 326 | iso_pu_bacteria | 8018127388 | 8018128375 | 257 |
| 327 | 3300002987 | JGI25159J45721_1001040 | JGI25159J45721_100104018 | 258 |
| 328 | 3300002987 | JGI25159J45721_1003776 | JGI25159J45721_10037768 | 258 |
| 329 | 3300003214 | JGI25165J46597_1005525 | JGI25165J46597_10055252 | 258 |
| 330 | 3300003354 | JGI25160J50197_1000252 | JGI25160J50197_100025236 | 258 |
| 331 | 3300003354 | JGI25160J50197_1001444 | JGI25160J50197_100144418 | 258 |
| 332 | 3300003374 | JGI25161J50226_1000185 | JGI25161J50226_100018536 | 258 |
| 333 | 3300003374 | JGI25161J50226_1000795 | JGI25161J50226_10007955 | 258 |
| 334 | 3300003752 | Ga0055539_1006888 | Ga0055539_10068883 | 258 |
| 335 | 3300003792 | Ga0055540_1000439 | Ga0055540_100043921 | 258 |
| 336 | 3300003794 | Ga0055531_10004825 | Ga0055531_100048257 | 258 |
| 337 | 3300003794 | Ga0055531_10011720 | Ga0055531_100117205 | 258 |
| 338 | 3300004625 | Ga0055543_1000249 | Ga0055543_100024936 | 258 |
| 339 | 3300004625 | Ga0055543_1000809 | Ga0055543_100080922 | 258 |
| 340 | 3300005262 | Ga0065165_1000824 | Ga0065165_100082411 | 258 |
| 341 | 3300005262 | Ga0065165_1002494 | Ga0065165_100249422 | 258 |
| 342 | 3300005548 | Ga0070665_100003151 | Ga0070665_1000031519 | 258 |
| 343 | 3300005578 | Ga0068854_100473545 | Ga0068854_1004735451 | 258 |
| 344 | 3300005614 | Ga0068856_100301500 | Ga0068856_1003015001 | 258 |
| 345 | 3300006948 | Ga0099826_10000038 | Ga0099826_1000003843 | 258 |
| 346 | 3300009101 | Ga0105247_10111209 | Ga0105247_101112092 | 258 |
| 347 | 3300009545 | Ga0105237_10000038 | Ga0105237_10000038156 | 258 |
| 348 | 3300009545 | Ga0105237_10199379 | Ga0105237_101993792 | 258 |
| 349 | 3300010375 | Ga0105239_10000065 | Ga0105239_100000659 | 258 |
| 350 | 3300010375 | Ga0105239_10002418 | Ga0105239_1000241818 | 258 |
| 351 | 3300013100 | Ga0157373_10001149 | Ga0157373_100011499 | 258 |
| 352 | 3300013104 | Ga0157370_10000054 | Ga0157370_10000054100 | 258 |
| 353 | 3300025208 | Ga0209436_109442 | Ga0209436_1094424 | 258 |
| 354 | 3300025253 | Ga0209677_100525 | Ga0209677_10052524 | 258 |
| 355 | 3300025261 | Ga0209233_1000214 | Ga0209233_100021433 | 258 |
| 356 | 3300025273 | Ga0209673_1029421 | Ga0209673_10294213 | 258 |
| 357 | 3300025284 | Ga0209130_1000482 | Ga0209130_100048236 | 258 |
| 358 | 3300025284 | Ga0209130_1001325 | Ga0209130_100132527 | 258 |
| 359 | 3300025294 | Ga0209025_1001648 | Ga0209025_10016487 | 258 |
| 360 | 3300025295 | Ga0209564_1015820 | Ga0209564_10158205 | 258 |
| 361 | 3300025299 | Ga0209256_1052691 | Ga0209256_10526911 | 258 |
| 362 | 3300025302 | Ga0207426_1000462 | Ga0207426_100046242 | 258 |
| 363 | 3300025302 | Ga0207426_1001895 | Ga0207426_10018955 | 258 |
| 364 | 3300025303 | Ga0209051_1000192 | Ga0209051_100019213 | 258 |
| 365 | 3300025304 | Ga0209257_1000300 | Ga0209257_1000300104 | 258 |
| 366 | 3300025914 | Ga0207671_10000418 | Ga0207671_100004188 | 258 |
| 367 | 3300027312 | Ga0209371_1023347 | Ga0209371_10233471 | 258 |
| 368 | 3300027666 | Ga0209282_1000093 | Ga0209282_100009333 | 258 |
| 369 | 3300028379 | Ga0268266_10001732 | Ga0268266_1000173211 | 258 |
| 370 | 3300030500 | Ga0268256_1026249 | Ga0268256_10262493 | 258 |
| 371 | 3300031911 | Ga0307412_10040283 | Ga0307412_100402834 | 258 |
| 372 | 3300037418 | Ga0395900_0029423 | Ga0395900_0029423_4096_4872 | 258 |
| 373 | 3300037466 | Ga0395898_0107784 | Ga0395898_0107784_1290_2066 | 258 |
| 374 | 3300037471 | Ga0395905_0098156 | Ga0395905_0098156_1855_2631 | 258 |
| 375 | 3300037471 | Ga0395905_0244977 | Ga0395905_0244977_235_1011 | 258 |
| 376 | 3300037471 | Ga0395905_0687141 | Ga0395905_0687141_119_895 | 258 |
| 377 | 3300039447 | Ga0436361_1059495 | Ga0436361_1059495_1111_1887 | 258 |
| 378 | 3300041413 | Ga0439465_0000751 | Ga0439465_0000751_6281_7057 | 258 |
| 379 | 3300041413 | Ga0439465_0086851 | Ga0439465_0086851_20_796 | 258 |
| 380 | 3300044683 | Ga0466965_0281923 | Ga0466965_0281923_80_856 | 258 |
| 381 | 3300047443 | Ga0495687_065245 | Ga0495687_065245_399_1175 | 258 |
| 382 | 3300047470 | Ga0495681_0000507 | Ga0495681_0000507_15279_16055 | 258 |
| 383 | 3300047472 | Ga0495686_0000895 | Ga0495686_0000895_12053_12832 | 258 |
| 384 | 3300047472 | Ga0495686_0015440 | Ga0495686_0015440_311_1087 | 258 |
| 385 | 3300048903 | Ga0496100_0189635 | Ga0496100_0189635_421_1197 | 258 |
| 386 | 3300048904 | Ga0496101_0086018 | Ga0496101_0086018_580_1356 | 258 |
| 387 | 3300048905 | Ga0496102_0239706 | Ga0496102_0239706_439_1215 | 258 |
| 388 | 3300048919 | Ga0496116_0003190 | Ga0496116_0003190_413_1189 | 258 |
| 389 | 3300048919 | Ga0496116_0029315 | Ga0496116_0029315_258_1034 | 258 |
| 390 | 3300048919 | Ga0496116_0231723 | Ga0496116_0231723_134_910 | 258 |
| 391 | 3300048920 | Ga0496117_0000105 | Ga0496117_0000105_34106_34882 | 258 |
| 392 | 3300048920 | Ga0496117_0001492 | Ga0496117_0001492_24704_25480 | 258 |
| 393 | 3300048920 | Ga0496117_0015700 | Ga0496117_0015700_2062_2838 | 258 |
| 394 | 3300048921 | Ga0496118_0000168 | Ga0496118_0000168_64468_65244 | 258 |
| 395 | 3300048921 | Ga0496118_0002150 | Ga0496118_0002150_18674_19450 | 258 |
| 396 | 3300048921 | Ga0496118_0043064 | Ga0496118_0043064_2640_3416 | 258 |
| 397 | 3300048921 | Ga0496118_0054763 | Ga0496118_0054763_1891_2667 | 258 |
| 398 | 3300048922 | Ga0496119_0000443 | Ga0496119_0000443_18370_19146 | 258 |
| 399 | 3300048922 | Ga0496119_0000887 | Ga0496119_0000887_34286_35062 | 258 |
| 400 | 3300048922 | Ga0496119_0003427 | Ga0496119_0003427_8065_8841 | 258 |
| 401 | 3300048923 | Ga0496120_0000818 | Ga0496120_0000818_17889_18665 | 258 |
| 402 | 3300048923 | Ga0496120_0001956 | Ga0496120_0001956_20434_21210 | 258 |
| 403 | 3300048923 | Ga0496120_0005310 | Ga0496120_0005310_1514_2290 | 258 |
| 404 | 3300048924 | Ga0496121_0007960 | Ga0496121_0007960_11482_12258 | 258 |
| 405 | 3300048924 | Ga0496121_0010573 | Ga0496121_0010573_8060_8836 | 258 |
| 406 | 3300048924 | Ga0496121_0011835 | Ga0496121_0011835_696_1472 | 258 |
| 407 | 3300048924 | Ga0496121_0018333 | Ga0496121_0018333_2978_3754 | 258 |
| 408 | 3300048925 | Ga0496122_0001241 | Ga0496122_0001241_34051_34827 | 258 |
| 409 | 3300048925 | Ga0496122_0002116 | Ga0496122_0002116_10506_11282 | 258 |
| 410 | 3300048925 | Ga0496122_0023636 | Ga0496122_0023636_4016_4792 | 258 |
| 411 | 3300048925 | Ga0496122_0108481 | Ga0496122_0108481_1012_1788 | 258 |
| 412 | 3300048926 | Ga0496123_0001704 | Ga0496123_0001704_10506_11282 | 258 |
| 413 | 3300048927 | Ga0496124_0000254 | Ga0496124_0000254_69368_70144 | 258 |
| 414 | 3300048927 | Ga0496124_0002483 | Ga0496124_0002483_8052_8828 | 258 |
| 415 | 3300048928 | Ga0496125_0005508 | Ga0496125_0005508_6045_6821 | 258 |
| 416 | 3300048929 | Ga0496126_0019649 | Ga0496126_0019649_1848_2624 | 258 |
| 417 | 3300048929 | Ga0496126_0135972 | Ga0496126_0135972_324_1100 | 258 |
| 418 | 3300048929 | Ga0496126_0463257 | Ga0496126_0463257_118_894 | 258 |
| 419 | 3300049569 | Ga0501032_0221206 | Ga0501032_0221206_253_1029 | 258 |
| 420 | 3300049571 | Ga0501034_0021544 | Ga0501034_0021544_3547_4323 | 258 |
| 421 | 3300049574 | Ga0501038_0055560 | Ga0501038_0055560_1114_1890 | 258 |
| 422 | 3300049579 | Ga0501043_0018589 | Ga0501043_0018589_2231_3007 | 258 |
| 423 | 3300049822 | Ga0501035_0081566 | Ga0501035_0081566_2040_2816 | 258 |
| 424 | 3300049822 | Ga0501035_0182226 | Ga0501035_0182226_765_1541 | 258 |
| 425 | 3300049823 | Ga0501044_0116371 | Ga0501044_0116371_1875_2669 | 258 |
| 426 | 3300049823 | Ga0501044_0519168 | Ga0501044_0519168_104_880 | 258 |
| 427 | 3300053122 | Ga0500608_000668 | Ga0500608_000668_6973_7749 | 258 |
| 428 | 3300053125 | Ga0500618_000019 | Ga0500618_000019_157478_158254 | 258 |
| 429 | 3300053125 | Ga0500618_000118 | Ga0500618_000118_40189_40965 | 258 |
| 430 | 3300053125 | Ga0500618_005648 | Ga0500618_005648_2302_3078 | 258 |
| 431 | 3300053153 | Ga0500616_0000108 | Ga0500616_0000108_114460_115236 | 258 |
| 432 | 3300053160 | Ga0500633_0000138 | Ga0500633_0000138_2158_2934 | 258 |
| 433 | iso_pu_bacteria | 2808606387 | 2808990275 | 258 |
| 434 | iso_pu_bacteria | 2857531043 | 2857535829 | 258 |
| 435 | 3300005548 | Ga0070665_100109546 | Ga0070665_1001095462 | 259 |
| 436 | 3300006195 | Ga0075366_10168388 | Ga0075366_101683882 | 259 |
| 437 | 3300017792 | Ga0163161_10036910 | Ga0163161_100369102 | 259 |
| 438 | 3300025924 | Ga0207694_10303046 | Ga0207694_103030463 | 259 |
| 439 | 3300028800 | Ga0265338_10246141 | Ga0265338_102461412 | 259 |
| 440 | 3300046471 | Ga0495650_0000089 | Ga0495650_0000089_100461_101252 | 259 |
| 441 | 3300046471 | Ga0495650_0078312 | Ga0495650_0078312_143_937 | 259 |
| 442 | 3300046474 | Ga0495605_0037226 | Ga0495605_0037226_366_1157 | 259 |
| 443 | 3300046500 | Ga0495596_0000230 | Ga0495596_0000230_3048_3860 | 259 |
| 444 | 3300046507 | Ga0495606_0000104 | Ga0495606_0000104_128456_129235 | 259 |
| 445 | 3300046694 | Ga0495649_0054829 | Ga0495649_0054829_14_793 | 259 |
| 446 | 3300046794 | Ga0495589_0006133 | Ga0495589_0006133_2135_2926 | 259 |
| 447 | 3300047320 | Ga0495672_0048766 | Ga0495672_0048766_203_991 | 259 |
| 448 | 3300047321 | Ga0495676_0103809 | Ga0495676_0103809_578_1384 | 259 |
| 449 | 3300047323 | Ga0495683_0039967 | Ga0495683_0039967_72_863 | 259 |
| 450 | 3300049575 | Ga0501039_0210862 | Ga0501039_0210862_502_1281 | 259 |
| 451 | 3300050493 | nmdc:mga0k408_160305_c1 | nmdc:mga0k408_160305_c1_268_1053 | 259 |
| 452 | 3300059421 | Ga0590071_005517 | Ga0590071_005517_2101_2883 | 259 |
| 453 | 3300005548 | Ga0070665_100035256 | Ga0070665_1000352566 | 260 |
| 454 | 3300006237 | Ga0097621_100057001 | Ga0097621_1000570012 | 260 |
| 455 | 3300006353 | Ga0075370_10023884 | Ga0075370_100238842 | 260 |
| 456 | 3300006358 | Ga0068871_100080721 | Ga0068871_1000807214 | 260 |
| 457 | 3300009176 | Ga0105242_10006722 | Ga0105242_1000672215 | 260 |
| 458 | 3300010375 | Ga0105239_10339940 | Ga0105239_103399402 | 260 |
| 459 | 3300013307 | Ga0157372_10229023 | Ga0157372_102290231 | 260 |
| 460 | 3300025924 | Ga0207694_10190305 | Ga0207694_101903051 | 260 |
| 461 | 3300026035 | Ga0207703_10035945 | Ga0207703_100359456 | 260 |
| 462 | 3300030521 | Ga0307511_10008113 | Ga0307511_100081134 | 260 |
| 463 | 3300031548 | Ga0307408_100006588 | Ga0307408_1000065885 | 260 |
| 464 | 3300031901 | Ga0307406_10009632 | Ga0307406_100096323 | 260 |
| 465 | 3300031995 | Ga0307409_100029655 | Ga0307409_1000296556 | 260 |
| 466 | 3300035114 | Ga0373939_0004485 | Ga0373939_0004485_1297_2079 | 260 |
| 467 | 3300046507 | Ga0495606_0005710 | Ga0495606_0005710_8130_8912 | 260 |
| 468 | 3300046616 | Ga0495668_0031616 | Ga0495668_0031616_359_1141 | 260 |
| 469 | 3300049568 | Ga0501031_0050149 | Ga0501031_0050149_533_1324 | 260 |
| 470 | 3300049569 | Ga0501032_0031140 | Ga0501032_0031140_528_1319 | 260 |
| 471 | 3300049570 | Ga0501033_0049424 | Ga0501033_0049424_1412_2203 | 260 |
| 472 | 3300049571 | Ga0501034_0068225 | Ga0501034_0068225_1591_2382 | 260 |
| 473 | 3300049571 | Ga0501034_0336890 | Ga0501034_0336890_294_1091 | 260 |
| 474 | 3300049573 | Ga0501037_0147244 | Ga0501037_0147244_198_995 | 260 |
| 475 | 3300049574 | Ga0501038_0078454 | Ga0501038_0078454_1052_1843 | 260 |
| 476 | 3300049579 | Ga0501043_0073913 | Ga0501043_0073913_1786_2577 | 260 |
| 477 | 3300049579 | Ga0501043_0152822 | Ga0501043_0152822_521_1318 | 260 |
| 478 | 3300049581 | Ga0501047_0057841 | Ga0501047_0057841_1498_2289 | 260 |
| 479 | 3300049581 | Ga0501047_0301652 | Ga0501047_0301652_549_1346 | 260 |
| 480 | 3300049582 | Ga0501048_0226349 | Ga0501048_0226349_393_1190 | 260 |
| 481 | 3300049589 | Ga0501073_0025376 | Ga0501073_0025376_2738_3583 | 260 |
| 482 | 3300049742 | Ga0501080_0435063 | Ga0501080_0435063_283_1080 | 260 |
| 483 | 3300049742 | Ga0501080_0561802 | Ga0501080_0561802_85_876 | 260 |
| 484 | 3300049822 | Ga0501035_0076286 | Ga0501035_0076286_672_1469 | 260 |
| 485 | 3300049822 | Ga0501035_0088379 | Ga0501035_0088379_1737_2528 | 260 |
| 486 | 3300049822 | Ga0501035_0098864 | Ga0501035_0098864_301_1092 | 260 |
| 487 | 3300049823 | Ga0501044_0052558 | Ga0501044_0052558_2986_3777 | 260 |
| 488 | 3300049823 | Ga0501044_0281915 | Ga0501044_0281915_632_1429 | 260 |
| 489 | 3300053104 | Ga0500556_0000096 | Ga0500556_0000096_39615_40409 | 260 |
| 490 | 3300054114 | Ga0501084_0000769 | Ga0501084_0000769_3761_4552 | 260 |
| 491 | 3300005435 | Ga0070714_100224365 | Ga0070714_1002243651 | 261 |
| 492 | 3300005436 | Ga0070713_100070894 | Ga0070713_1000708942 | 261 |
| 493 | 3300005436 | Ga0070713_100320413 | Ga0070713_1003204131 | 261 |
| 494 | 3300005530 | Ga0070679_100343774 | Ga0070679_1003437742 | 261 |
| 495 | 3300005548 | Ga0070665_100003036 | Ga0070665_1000030369 | 261 |
| 496 | 3300005614 | Ga0068856_100155011 | Ga0068856_1001550113 | 261 |
| 497 | 3300006028 | Ga0070717_10525440 | Ga0070717_105254401 | 261 |
| 498 | 3300006914 | Ga0075436_100322103 | Ga0075436_1003221031 | 261 |
| 499 | 3300007788 | Ga0099795_10007993 | Ga0099795_100079933 | 261 |
| 500 | 3300009093 | Ga0105240_10004022 | Ga0105240_1000402215 | 261 |
| 501 | 3300009093 | Ga0105240_10373983 | Ga0105240_103739831 | 261 |
| 502 | 3300013307 | Ga0157372_10220105 | Ga0157372_102201053 | 261 |
| 503 | 3300014497 | Ga0182008_10124547 | Ga0182008_101245472 | 261 |
| 504 | 3300025915 | Ga0207693_10177596 | Ga0207693_101775962 | 261 |
| 505 | 3300025921 | Ga0207652_10283898 | Ga0207652_102838982 | 261 |
| 506 | 3300026078 | Ga0207702_10106162 | Ga0207702_101061622 | 261 |
| 507 | 3300028379 | Ga0268266_10004368 | Ga0268266_100043689 | 261 |
| 508 | 3300037418 | Ga0395900_0000495 | Ga0395900_0000495_32697_33482 | 261 |
| 509 | 3300037471 | Ga0395905_0132470 | Ga0395905_0132470_534_1319 | 261 |
| 510 | 3300038443 | Ga0395901_0000094 | Ga0395901_0000094_35789_36574 | 261 |
| 511 | 3300039437 | Ga0436365_0969535 | Ga0436365_0969535_297_1115 | 261 |
| 512 | 3300042005 | Ga0439448_0002686 | Ga0439448_0002686_164_949 | 261 |
| 513 | 3300042007 | Ga0439449_0009832 | Ga0439449_0009832_1958_2743 | 261 |
| 514 | 3300042008 | Ga0439450_004212 | Ga0439450_004212_1280_2065 | 261 |
| 515 | 3300042012 | Ga0439455_0008184 | Ga0439455_0008184_507_1292 | 261 |
| 516 | 3300044706 | Ga0466964_0000805 | Ga0466964_0000805_2626_3411 | 261 |
| 517 | 3300045976 | Ga0466967_0151751 | Ga0466967_0151751_389_1174 | 261 |
| 518 | 3300046472 | Ga0495580_0257483 | Ga0495580_0257483_282_1076 | 261 |
| 519 | 3300048915 | Ga0496112_0055478 | Ga0496112_0055478_1078_1872 | 261 |
| 520 | 3300048915 | Ga0496112_0561337 | Ga0496112_0561337_50_862 | 261 |
| 521 | 3300049822 | Ga0501035_0000761 | Ga0501035_0000761_19592_20377 | 261 |
| 522 | 3300049823 | Ga0501044_0001378 | Ga0501044_0001378_22688_23491 | 261 |
| 523 | 3300050507 | nmdc:mga05p37_496978_c1 | nmdc:mga05p37_496978_c1_17_805 | 261 |
| 524 | 3300003771 | Ga0055526_1004525 | Ga0055526_10045253 | 262 |
| 525 | 3300003775 | Ga0055524_1003408 | Ga0055524_10034085 | 262 |
| 526 | 3300003790 | Ga0055528_1000760 | Ga0055528_10007608 | 262 |
| 527 | 3300025273 | Ga0209673_1000165 | Ga0209673_100016526 | 262 |
| 528 | 3300025295 | Ga0209564_1003504 | Ga0209564_100350412 | 262 |
| 529 | 3300025299 | Ga0209256_1000144 | Ga0209256_1000144138 | 262 |
| 530 | 3300025711 | Ga0207696_1000106 | Ga0207696_1000106133 | 262 |
| 531 | 3300026121 | Ga0207683_10008495 | Ga0207683_100084954 | 262 |
| 532 | 3300035172 | Ga0373955_0174033 | Ga0373955_0174033_132_950 | 262 |
| 533 | 3300035724 | Ga0373933_0027778 | Ga0373933_0027778_204_1022 | 262 |
| 534 | 3300036401 | Ga0373937_0056321 | Ga0373937_0056321_537_1355 | 262 |
| 535 | 3300042439 | Ga0439464_0061606 | Ga0439464_0061606_25_834 | 262 |
| 536 | 3300046454 | Ga0495592_0376004 | Ga0495592_0376004_34_852 | 262 |
| 537 | 3300046533 | Ga0495640_0062489 | Ga0495640_0062489_1527_2345 | 262 |
| 538 | 3300046542 | Ga0495597_0014554 | Ga0495597_0014554_1618_2415 | 262 |
| 539 | 3300049588 | Ga0501072_0359538 | Ga0501072_0359538_38_847 | 262 |
| 540 | 3300053077 | Ga0495601_0044228 | Ga0495601_0044228_1495_2313 | 262 |
| 541 | 3300053085 | Ga0495619_0036333 | Ga0495619_0036333_646_1464 | 262 |
| 542 | 3300005439 | Ga0070711_100014279 | Ga0070711_1000142797 | 263 |
| 543 | 3300005458 | Ga0070681_10114615 | Ga0070681_101146152 | 263 |
| 544 | 3300005539 | Ga0068853_100005680 | Ga0068853_10000568011 | 263 |
| 545 | 3300006051 | Ga0075364_10072685 | Ga0075364_100726852 | 263 |
| 546 | 3300006175 | Ga0070712_100242984 | Ga0070712_1002429841 | 263 |
| 547 | 3300010375 | Ga0105239_10000918 | Ga0105239_1000091839 | 263 |
| 548 | 3300025912 | Ga0207707_10427771 | Ga0207707_104277712 | 263 |
| 549 | 3300025916 | Ga0207663_10083199 | Ga0207663_100831993 | 263 |
| 550 | 3300025934 | Ga0207686_10002271 | Ga0207686_1000227121 | 263 |
| 551 | 3300025949 | Ga0207667_10272605 | Ga0207667_102726052 | 263 |
| 552 | 3300026041 | Ga0207639_10004475 | Ga0207639_100044757 | 263 |
| 553 | 3300035118 | Ga0373954_0031902 | Ga0373954_0031902_358_1185 | 263 |
| 554 | 3300035724 | Ga0373933_0018203 | Ga0373933_0018203_1541_2368 | 263 |
| 555 | 3300036401 | Ga0373937_0000909 | Ga0373937_0000909_11349_12176 | 263 |
| 556 | 3300037312 | Ga0395899_0001202 | Ga0395899_0001202_20032_20832 | 263 |
| 557 | 3300037418 | Ga0395900_0000006 | Ga0395900_0000006_412903_413703 | 263 |
| 558 | 3300037466 | Ga0395898_0029609 | Ga0395898_0029609_3032_3832 | 263 |
| 559 | 3300037471 | Ga0395905_0107622 | Ga0395905_0107622_505_1305 | 263 |
| 560 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_456150_456950 | 263 |
| 561 | 3300039437 | Ga0436365_0320300 | Ga0436365_0320300_408_1358 | 263 |
| 562 | 3300039453 | Ga0436362_0887806 | Ga0436362_0887806_1593_2417 | 263 |
| 563 | 3300046535 | Ga0495586_0261947 | Ga0495586_0261947_140_976 | 263 |
| 564 | 3300046664 | Ga0495659_0008291 | Ga0495659_0008291_2456_3256 | 263 |
| 565 | 3300049571 | Ga0501034_0040943 | Ga0501034_0040943_1859_2668 | 263 |
| 566 | 3300049572 | Ga0501036_0022398 | Ga0501036_0022398_887_1696 | 263 |
| 567 | 3300049574 | Ga0501038_0059032 | Ga0501038_0059032_1239_2048 | 263 |
| 568 | 3300049579 | Ga0501043_0102304 | Ga0501043_0102304_1081_1890 | 263 |
| 569 | 3300049580 | Ga0501046_0213584 | Ga0501046_0213584_547_1356 | 263 |
| 570 | 3300049581 | Ga0501047_0486964 | Ga0501047_0486964_140_958 | 263 |
| 571 | 3300049822 | Ga0501035_0004337 | Ga0501035_0004337_4213_5022 | 263 |
| 572 | 3300049823 | Ga0501044_0032797 | Ga0501044_0032797_975_1784 | 263 |
| 573 | 3300050491 | nmdc:mga00v17_62245_c1 | nmdc:mga00v17_62245_c1_432_1247 | 263 |
| 574 | 3300050494 | nmdc:mga06z11_235656_c1 | nmdc:mga06z11_235656_c1_100_906 | 263 |
| 575 | 3300002987 | JGI25159J45721_1000859 | JGI25159J45721_10008596 | 264 |
| 576 | 3300005262 | Ga0065165_1000044 | Ga0065165_100004485 | 264 |
| 577 | 3300005518 | Ga0070699_100213222 | Ga0070699_1002132221 | 264 |
| 578 | 3300005548 | Ga0070665_100357211 | Ga0070665_1003572112 | 264 |
| 579 | 3300009094 | Ga0111539_10215994 | Ga0111539_102159942 | 264 |
| 580 | 3300025284 | Ga0209130_1000089 | Ga0209130_100008935 | 264 |
| 581 | 3300025304 | Ga0209257_1006780 | Ga0209257_10067803 | 264 |
| 582 | 3300025986 | Ga0207658_10024155 | Ga0207658_100241554 | 264 |
| 583 | 3300028379 | Ga0268266_10164644 | Ga0268266_101646443 | 264 |
| 584 | 3300031247 | Ga0265340_10072734 | Ga0265340_100727342 | 264 |
| 585 | 3300049571 | Ga0501034_0036262 | Ga0501034_0036262_1606_2427 | 264 |
| 586 | 3300049572 | Ga0501036_0008992 | Ga0501036_0008992_7166_7987 | 264 |
| 587 | 3300049573 | Ga0501037_0002781 | Ga0501037_0002781_4805_5626 | 264 |
| 588 | 3300049574 | Ga0501038_0000719 | Ga0501038_0000719_4252_5073 | 264 |
| 589 | 3300049575 | Ga0501039_0007166 | Ga0501039_0007166_7196_8017 | 264 |
| 590 | 3300049579 | Ga0501043_0001293 | Ga0501043_0001293_13278_14099 | 264 |
| 591 | 3300049580 | Ga0501046_0000870 | Ga0501046_0000870_5063_5884 | 264 |
| 592 | 3300049581 | Ga0501047_0006799 | Ga0501047_0006799_6666_7487 | 264 |
| 593 | 3300049582 | Ga0501048_0064234 | Ga0501048_0064234_311_1132 | 264 |
| 594 | 3300049583 | Ga0501067_0032064 | Ga0501067_0032064_467_1288 | 264 |
| 595 | 3300049584 | Ga0501068_0002004 | Ga0501068_0002004_4872_5693 | 264 |
| 596 | 3300049585 | Ga0501069_0000173 | Ga0501069_0000173_8825_9646 | 264 |
| 597 | 3300049586 | Ga0501070_0010809 | Ga0501070_0010809_5237_6058 | 264 |
| 598 | 3300049589 | Ga0501073_0005108 | Ga0501073_0005108_4174_4995 | 264 |
| 599 | 3300049590 | Ga0501074_0018024 | Ga0501074_0018024_2645_3466 | 264 |
| 600 | 3300049741 | Ga0501079_0056713 | Ga0501079_0056713_42_863 | 264 |
| 601 | 3300049742 | Ga0501080_0003033 | Ga0501080_0003033_3258_4079 | 264 |
| 602 | 3300049744 | Ga0501083_0062191 | Ga0501083_0062191_995_1816 | 264 |
| 603 | 3300049822 | Ga0501035_0002936 | Ga0501035_0002936_3131_3952 | 264 |
| 604 | 3300049823 | Ga0501044_0009708 | Ga0501044_0009708_5347_6168 | 264 |
| 605 | 3300050511 | nmdc:mga08y16_228982_c1 | nmdc:mga08y16_228982_c1_533_1360 | 264 |
| 606 | 3300054114 | Ga0501084_0010651 | Ga0501084_0010651_1793_2614 | 264 |
| 607 | 3300060353 | Ga0501082_0016299 | Ga0501082_0016299_3568_4389 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9713 | 1 | 257 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9676 | 1 | 257 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9668 | 1 | 257 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9667 | 2 | 257 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9594 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9735 | 2 | 257 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9656 | 1 | 257 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9624 | 2 | 257 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9583 | 1 | 257 | 3.60.10.10 |
| af_P09030_1_268_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9517 | 1 | 257 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436KS41-F1-model_v4 | deleted | 1.001 | 1 | 77 |
|
| AF-A0A2W5ADH5-F1-model_v4 | Exodeoxyribonuclease III | 0.9999 | 1 | 128 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A4Q2FJP5-F1-model_v4 | Exodeoxyribonuclease III | 0.9993 | 1 | 108 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 |
| AF-A0A4R3FGF6-F1-model_v4 | Exodeoxyribonuclease III | 0.9988 | 3 | 224 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A357X4M1-F1-model_v4 | deleted | 0.998 | 28 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar