F468601

General Info

Members Datasets Scaffolds Average Seq Length
606 307 1212 128

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10962302|Ga0207664_109623022
Length 148
Sequence VSVLVLVVDDEPDVEQLFRQQFRRDLRAQRFVMDFAISAADALARIASTIEQSLILILSDINMPGMTGLEMLPKVKELRPDVPVIMITAYGDPETKRKAIEGGAEGLLTKPIDFSLLRLEKVDIGSRSQCCLNDLKNHDHYDAQNREG

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
302 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
305 2791355199
306 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
307 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.33
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0.5
Rhizoplane 9.57
Rhizosphere 76.57
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10962302 3300025929 Bacteria 765
2 JGI25404J52841_10010417 3300003659 Bacteria 2000
3 JGI25404J52841_10048176 3300003659 Bacteria 897
4 Ga0058859_11248642 3300004798 Bacteria 610
5 Ga0070658_10066954 3300005327 Bacteria 2934
6 Ga0070683_100004896 3300005329 Bacteria 11103
7 Ga0070690_100297803 3300005330 Bacteria 1156
8 Ga0070680_100171284 3300005336 Bacteria 1827
9 Ga0070680_100318286 3300005336 Bacteria 1320
10 Ga0070682_100072649 3300005337 Bacteria 2205
11 Ga0070682_100917847 3300005337 Bacteria 721
12 Ga0070660_100018257 3300005339 Bacteria 5123
13 Ga0070691_10062364 3300005341 Bacteria 1795
14 Ga0070687_100848474 3300005343 Bacteria 651
15 Ga0070668_100718740 3300005347 Bacteria 882
16 Ga0070671_100141949 3300005355 Bacteria 2027
17 Ga0070671_100426660 3300005355 Bacteria 1136
18 Ga0070674_100016806 3300005356 Bacteria 4590
19 Ga0070688_101290794 3300005365 Bacteria 589
20 Ga0070659_101758163 3300005366 Bacteria 555
21 Ga0070709_10117330 3300005434 Bacteria 1798
22 Ga0070709_10645712 3300005434 Bacteria 819
23 Ga0070714_100321176 3300005435 Bacteria 1448
24 Ga0070714_100422502 3300005435 Bacteria 1263
25 Ga0070714_101419597 3300005435 Bacteria 678
26 Ga0070713_100206408 3300005436 Bacteria 1777
27 Ga0070713_100279941 3300005436 Bacteria 1530
28 Ga0070710_10771085 3300005437 Bacteria 685
29 Ga0070711_100163298 3300005439 Bacteria 1690
30 Ga0070711_100183559 3300005439 Bacteria 1603
31 Ga0070711_100833482 3300005439 Bacteria 784
32 Ga0070663_100078009 3300005455 Bacteria 2427
33 Ga0070663_101336924 3300005455 Bacteria 633
34 Ga0070663_101392128 3300005455 Bacteria 621
35 Ga0070678_100180749 3300005456 Bacteria 1726
36 Ga0070678_100787404 3300005456 Bacteria 863
37 Ga0070681_10135815 3300005458 Bacteria 2390
38 Ga0070681_10180909 3300005458 Bacteria 2030
39 Ga0070681_10494718 3300005458 Bacteria 1136
40 Ga0068867_100965603 3300005459 Bacteria 771
41 Ga0068867_101519772 3300005459 Bacteria 624
42 Ga0070699_100670530 3300005518 Bacteria 947
43 Ga0070679_100016325 3300005530 Bacteria 7157
44 Ga0070679_100066255 3300005530 Bacteria 3600
45 Ga0070679_100234918 3300005530 Bacteria 1792
46 Ga0070684_100366268 3300005535 Bacteria 1327
47 Ga0070684_101661087 3300005535 Bacteria 603
48 Ga0070697_100053931 3300005536 Bacteria 3268
49 Ga0068853_100079772 3300005539 Bacteria 2863
50 Ga0068853_100107231 3300005539 Bacteria 2477
51 Ga0068853_100276391 3300005539 Bacteria 1548
52 Ga0068853_100353946 3300005539 Bacteria 1366
53 Ga0068853_101781892 3300005539 Bacteria 597
54 Ga0070693_100260272 3300005547 Bacteria 1154
55 Ga0070665_100216958 3300005548 Bacteria 1914
56 Ga0068855_100039885 3300005563 Bacteria 5574
57 Ga0068855_100702051 3300005563 Bacteria 1082
58 Ga0070664_100532983 3300005564 Bacteria 1085
59 Ga0068857_100021961 3300005577 Bacteria 5617
60 Ga0068857_100592368 3300005577 Bacteria 1047
61 Ga0068856_100428649 3300005614 Bacteria 1343
62 Ga0070702_100529047 3300005615 Bacteria 871
63 Ga0068852_100206109 3300005616 Bacteria 1863
64 Ga0068851_10017152 3300005834 Bacteria 3474
65 Ga0068851_10493641 3300005834 Bacteria 733
66 Ga0068851_10677955 3300005834 Bacteria 633
67 Ga0068870_10243592 3300005840 Bacteria 1111
68 Ga0068863_100150190 3300005841 Bacteria 2229
69 Ga0068858_102055464 3300005842 Bacteria 565
70 Ga0081455_10012283 3300005937 Bacteria 8546
71 Ga0081455_10507020 3300005937 Bacteria 809
72 Ga0081455_10712324 3300005937 Bacteria 638
73 Ga0081540_1013944 3300005983 Bacteria 5188
74 Ga0081540_1029724 3300005983 Bacteria 3039
75 Ga0081539_10017333 3300005985 Bacteria 5064
76 Ga0070717_10092594 3300006028 Bacteria 2554
77 Ga0070717_10692556 3300006028 Bacteria 926
78 Ga0075365_10009946 3300006038 Bacteria 5508
79 Ga0075365_10212742 3300006038 Bacteria 1355
80 Ga0075365_10334787 3300006038 Bacteria 1066
81 Ga0075368_10070476 3300006042 Bacteria 1411
82 Ga0075368_10351676 3300006042 Bacteria 641
83 Ga0075363_100158439 3300006048 Bacteria 1281
84 Ga0075364_10029680 3300006051 Bacteria 3508
85 Ga0075364_10766431 3300006051 Bacteria 658
86 Ga0070715_10448516 3300006163 Bacteria 728
87 Ga0070716_101025448 3300006173 Bacteria 654
88 Ga0070716_101172262 3300006173 Bacteria 616
89 Ga0070712_100071309 3300006175 Bacteria 2485
90 Ga0075362_10028967 3300006177 Bacteria 2383
91 Ga0075367_10051170 3300006178 Bacteria 2441
92 Ga0075367_10062020 3300006178 Bacteria 2232
93 Ga0075369_10004698 3300006186 Bacteria 5066
94 Ga0075369_10487966 3300006186 Bacteria 585
95 Ga0075366_10210813 3300006195 Bacteria 1183
96 Ga0097621_100184152 3300006237 Bacteria 1806
97 Ga0097621_100413703 3300006237 Bacteria 1209
98 Ga0097621_100990670 3300006237 Bacteria 786
99 Ga0068871_101907294 3300006358 Bacteria 565
100 Ga0075428_100033723 3300006844 Bacteria 5650
101 Ga0075431_101271965 3300006847 Bacteria 697
102 Ga0075434_100610485 3300006871 Bacteria 1110
103 Ga0068865_100237397 3300006881 Bacteria 1433
104 Ga0099794_10131546 3300007265 Bacteria 1264
105 Ga0099794_10159810 3300007265 Bacteria 1146
106 Ga0099794_10248732 3300007265 Bacteria 916
107 Ga0099795_10230628 3300007788 Bacteria 792
108 Ga0099795_10243573 3300007788 Bacteria 773
109 Ga0099795_10312778 3300007788 Bacteria 694
110 Ga0105240_10046937 3300009093 Bacteria 5468
111 Ga0105240_10075256 3300009093 Bacteria 4164
112 Ga0105240_10338050 3300009093 Bacteria 1711
113 Ga0105240_10533594 3300009093 Bacteria 1300
114 Ga0111539_10030804 3300009094 Bacteria 6521
115 Ga0111539_12140682 3300009094 Bacteria 649
116 Ga0105245_11456845 3300009098 Bacteria 735
117 Ga0105247_10191422 3300009101 Bacteria 1370
118 Ga0105247_10475308 3300009101 Bacteria 906
119 Ga0114129_13340846 3300009147 Bacteria 518
120 Ga0105242_10082205 3300009176 Bacteria 2695
121 Ga0105242_11464738 3300009176 Bacteria 712
122 Ga0105248_10279366 3300009177 Bacteria 1880
123 Ga0105248_11008719 3300009177 Bacteria 940
124 Ga0105237_10023353 3300009545 Bacteria 6338
125 Ga0105237_10083900 3300009545 Bacteria 3176
126 Ga0105238_10030376 3300009551 Bacteria 5500
127 Ga0105238_10224828 3300009551 Bacteria 1853
128 Ga0105238_10272440 3300009551 Bacteria 1673
129 Ga0105238_10512553 3300009551 Bacteria 1201
130 Ga0105238_10663696 3300009551 Bacteria 1053
131 Ga0105238_11187506 3300009551 Bacteria 787
132 Ga0099796_10014654 3300010159 Bacteria 2271
133 Ga0099796_10017182 3300010159 Bacteria 2150
134 Ga0099796_10043909 3300010159 Bacteria 1525
135 Ga0099796_10125395 3300010159 Bacteria 991
136 Ga0099796_10162464 3300010159 Bacteria 886
137 Ga0105239_10068235 3300010375 Bacteria 3908
138 Ga0105246_10120513 3300011119 Bacteria 1943
139 Ga0105246_10155899 3300011119 Bacteria 1734
140 Ga0105246_10539746 3300011119 Bacteria 997
141 Ga0105246_12289458 3300011119 Bacteria 528
142 Ga0157370_10062009 3300013104 Bacteria 3547
143 Ga0157370_10128014 3300013104 Bacteria 2370
144 Ga0157370_10322034 3300013104 Bacteria 1426
145 Ga0157370_10728679 3300013104 Bacteria 904
146 Ga0157369_10025890 3300013105 Bacteria 6508
147 Ga0157369_10110252 3300013105 Bacteria 2926
148 Ga0157374_10017162 3300013296 Bacteria 6371
149 Ga0157374_10449744 3300013296 Bacteria 1289
150 Ga0157374_10741041 3300013296 Bacteria 997
151 Ga0157374_11394672 3300013296 Bacteria 723
152 Ga0157374_11858863 3300013296 Bacteria 628
153 Ga0157378_10863511 3300013297 Bacteria 934
154 Ga0157378_11820469 3300013297 Bacteria 657
155 Ga0163162_11063373 3300013306 Bacteria 916
156 Ga0163162_12120803 3300013306 Bacteria 645
157 Ga0157372_10277885 3300013307 Bacteria 1947
158 Ga0157372_10301223 3300013307 Bacteria 1865
159 Ga0157372_10361659 3300013307 Bacteria 1691
160 Ga0157375_10007349 3300013308 Bacteria 9643
161 Ga0157375_10118950 3300013308 Bacteria 2749
162 Ga0163163_10070808 3300014325 Bacteria 3473
163 Ga0163163_11292879 3300014325 Bacteria 791
164 Ga0163163_11415520 3300014325 Bacteria 757
165 Ga0163163_11443132 3300014325 Bacteria 750
166 Ga0157380_10497144 3300014326 Bacteria 1184
167 Ga0157379_10504156 3300014968 Bacteria 1122
168 Ga0157379_11348679 3300014968 Bacteria 690
169 Ga0157376_10206542 3300014969 Bacteria 1811
170 Ga0163161_10298933 3300017792 Bacteria 1267
171 Ga0154015_1505921 3300020610 Bacteria 676
172 Ga0213873_10054970 3300021358 Bacteria 1064
173 Ga0213872_10076399 3300021361 Bacteria 1507
174 Ga0213874_10206029 3300021377 Bacteria 709
175 Ga0213876_10040597 3300021384 Bacteria 2458
176 Ga0213876_10061348 3300021384 Bacteria 1984
177 Ga0213876_10392564 3300021384 Bacteria 738
178 Ga0213876_10397063 3300021384 Bacteria 733
179 Ga0213871_10118745 3300021441 Bacteria 787
180 Ga0207697_10201531 3300025315 Bacteria 875
181 Ga0207656_10009528 3300025321 Bacteria 3608
182 Ga0207656_10543064 3300025321 Bacteria 592
183 Ga0207656_10620274 3300025321 Bacteria 552
184 Ga0207692_10066513 3300025898 Bacteria 1884
185 Ga0207692_10249089 3300025898 Bacteria 1064
186 Ga0207692_10318295 3300025898 Bacteria 951
187 Ga0207688_10114222 3300025901 Bacteria 1570
188 Ga0207680_10266117 3300025903 Bacteria 1188
189 Ga0207647_10135675 3300025904 Bacteria 1444
190 Ga0207685_10132999 3300025905 Bacteria 1106
191 Ga0207685_10208937 3300025905 Bacteria 922
192 Ga0207643_10602752 3300025908 Bacteria 707
193 Ga0207705_10196961 3300025909 Bacteria 1525
194 Ga0207705_10809931 3300025909 Bacteria 727
195 Ga0207684_10148561 3300025910 Bacteria 2016
196 Ga0207707_10007729 3300025912 Bacteria 9359
197 Ga0207707_10109326 3300025912 Bacteria 2417
198 Ga0207707_10302263 3300025912 Bacteria 1383
199 Ga0207707_10353897 3300025912 Bacteria 1265
200 Ga0207695_10022569 3300025913 Bacteria 7139
201 Ga0207695_10150444 3300025913 Bacteria 2267
202 Ga0207695_10301541 3300025913 Bacteria 1493
203 Ga0207695_10389771 3300025913 Bacteria 1278
204 Ga0207671_10038606 3300025914 Bacteria 3539
205 Ga0207671_10056048 3300025914 Bacteria 2920
206 Ga0207671_10590834 3300025914 Bacteria 885
207 Ga0207693_10020497 3300025915 Bacteria 5258
208 Ga0207693_10581690 3300025915 Bacteria 872
209 Ga0207663_10035834 3300025916 Bacteria 2980
210 Ga0207663_10084141 3300025916 Bacteria 2092
211 Ga0207663_10211496 3300025916 Bacteria 1406
212 Ga0207663_11100402 3300025916 Bacteria 639
213 Ga0207660_10002854 3300025917 Bacteria 11294
214 Ga0207660_10213279 3300025917 Bacteria 1513
215 Ga0207660_10536202 3300025917 Bacteria 951
216 Ga0207657_10011792 3300025919 Bacteria 8654
217 Ga0207649_10311148 3300025920 Bacteria 1154
218 Ga0207652_10002796 3300025921 Bacteria 14640
219 Ga0207652_10021439 3300025921 Bacteria 5332
220 Ga0207652_10037302 3300025921 Bacteria 4114
221 Ga0207652_10323159 3300025921 Bacteria 1393
222 Ga0207652_10429912 3300025921 Bacteria 1191
223 Ga0207694_10022565 3300025924 Bacteria 4775
224 Ga0207694_10100287 3300025924 Bacteria 2294
225 Ga0207694_10116834 3300025924 Bacteria 2126
226 Ga0207694_10318083 3300025924 Bacteria 1284
227 Ga0207694_10832486 3300025924 Bacteria 780
228 Ga0207650_11532883 3300025925 Unclassified 566
229 Ga0207687_10121957 3300025927 Bacteria 1951
230 Ga0207700_10010389 3300025928 Bacteria 5871
231 Ga0207700_10048645 3300025928 Bacteria 3150
232 Ga0207700_10167800 3300025928 Bacteria 1828
233 Ga0207664_10114422 3300025929 Bacteria 2248
234 Ga0207664_10448004 3300025929 Bacteria 1152
235 Ga0207664_10456512 3300025929 Bacteria 1141
236 Ga0207644_10425516 3300025931 Bacteria 1088
237 Ga0207690_11329230 3300025932 Bacteria 601
238 Ga0207686_10435747 3300025934 Bacteria 1005
239 Ga0207686_11116406 3300025934 Bacteria 643
240 Ga0207686_11197755 3300025934 Bacteria 622
241 Ga0207704_10156273 3300025938 Bacteria 1617
242 Ga0207665_10098595 3300025939 Bacteria 2036
243 Ga0207665_10674255 3300025939 Bacteria 812
244 Ga0207665_10971203 3300025939 Bacteria 675
245 Ga0207691_10169440 3300025940 Bacteria 1913
246 Ga0207711_10317946 3300025941 Bacteria 1438
247 Ga0207689_10285187 3300025942 Bacteria 1367
248 Ga0207661_10004383 3300025944 Bacteria 9894
249 Ga0207661_10109168 3300025944 Bacteria 2337
250 Ga0207679_10072238 3300025945 Bacteria 2606
251 Ga0207679_10463557 3300025945 Bacteria 1125
252 Ga0207667_10009416 3300025949 Bacteria 11505
253 Ga0207667_10031376 3300025949 Bacteria 5736
254 Ga0207667_10510434 3300025949 Bacteria 1218
255 Ga0207667_10928829 3300025949 Bacteria 861
256 Ga0207651_10416409 3300025960 Bacteria 1146
257 Ga0207668_11929206 3300025972 Bacteria 532
258 Ga0207677_10065016 3300026023 Bacteria 2543
259 Ga0207639_10012431 3300026041 Bacteria 5928
260 Ga0207639_10177523 3300026041 Bacteria 1809
261 Ga0207639_10963282 3300026041 Bacteria 799
262 Ga0207678_10116175 3300026067 Bacteria 2283
263 Ga0207702_10206776 3300026078 Bacteria 1823
264 Ga0207641_10717437 3300026088 Bacteria 985
265 Ga0207648_10566920 3300026089 Bacteria 1044
266 Ga0207648_11105154 3300026089 Bacteria 744
267 Ga0207676_10085923 3300026095 Bacteria 2568
268 Ga0207676_10713577 3300026095 Bacteria 973
269 Ga0207674_10011961 3300026116 Bacteria 9726
270 Ga0207674_10029348 3300026116 Bacteria 5790
271 Ga0207674_10593455 3300026116 Bacteria 1070
272 Ga0207675_100223063 3300026118 Bacteria 1816
273 Ga0207683_10016779 3300026121 Bacteria 6232
274 Ga0207698_10087430 3300026142 Bacteria 2539
275 Ga0207698_10153208 3300026142 Bacteria 2004
276 Ga0209179_1065651 3300027512 Bacteria 791
277 Ga0209588_1003149 3300027671 Bacteria 4549
278 Ga0209588_1135842 3300027671 Bacteria 783
279 Ga0209813_10052213 3300027866 Bacteria 1281
280 Ga0207428_10589423 3300027907 Bacteria 802
281 Ga0268266_10066664 3300028379 Bacteria 3114
282 Ga0268266_10715486 3300028379 Bacteria 965
283 Ga0268265_10079925 3300028380 Bacteria 2577
284 Ga0268264_11053246 3300028381 Bacteria 821
285 Ga0307517_10003796 3300028786 Bacteria 23466
286 Ga0307517_10188152 3300028786 Bacteria 1317
287 Ga0307515_10055458 3300028794 Bacteria 5790
288 Ga0307515_10124540 3300028794 Bacteria 2891
289 Ga0265330_10017182 3300031235 Bacteria 3335
290 Ga0265330_10056564 3300031235 Bacteria 1712
291 Ga0265330_10148391 3300031235 Bacteria 996
292 Ga0265332_10012171 3300031238 Bacteria 3817
293 Ga0265325_10010596 3300031241 Bacteria 5329
294 Ga0265340_10422419 3300031247 Bacteria 588
295 Ga0265339_10059676 3300031249 Bacteria 2057
296 Ga0265339_10310830 3300031249 Bacteria 750
297 Ga0265331_10110106 3300031250 Bacteria 1263
298 Ga0307513_10222490 3300031456 Bacteria 1707
299 Ga0307408_100529722 3300031548 Bacteria 1036
300 Ga0307508_10055990 3300031616 Bacteria 3493
301 Ga0307508_10125803 3300031616 Bacteria 2166
302 Ga0265314_10128423 3300031711 Bacteria 1584
303 Ga0265342_10113946 3300031712 Bacteria 1528
304 Ga0307516_10003332 3300031730 Bacteria 20787
305 Ga0307516_10172001 3300031730 Bacteria 1906
306 Ga0307516_10524749 3300031730 Bacteria 838
307 Ga0307406_10710984 3300031901 Bacteria 840
308 Ga0307412_10442018 3300031911 Bacteria 1069
309 Ga0307415_101322901 3300032126 Bacteria 683
310 Ga0307510_10440144 3300033180 Bacteria 745
311 Ga0373930_0007290 3300034816 Bacteria 1899
312 Ga0373938_0140056 3300034957 Bacteria 637
313 Ga0373928_0008069 3300035084 Bacteria 2039
314 Ga0373929_0064001 3300035085 Bacteria 867
315 Ga0373934_0015043 3300035086 Bacteria 2934
316 Ga0373934_0034733 3300035086 Bacteria 1982
317 Ga0373934_0225716 3300035086 Bacteria 773
318 Ga0373940_0048379 3300035088 Bacteria 1188
319 Ga0373944_0296957 3300035089 Bacteria 606
320 Ga0373936_0023939 3300035113 Bacteria 2382
321 Ga0373936_0235166 3300035113 Bacteria 816
322 Ga0373953_0029411 3300035117 Bacteria 2124
323 Ga0373953_0031812 3300035117 Bacteria 2054
324 Ga0373954_0008043 3300035118 Bacteria 4621
325 Ga0373956_0017583 3300035119 Bacteria 3016
326 Ga0373956_0173692 3300035119 Bacteria 1017
327 Ga0373960_0033807 3300035121 Bacteria 1443
328 Ga0373955_0100524 3300035172 Bacteria 1659
329 Ga0373955_0196427 3300035172 Bacteria 1200
330 Ga0373955_0773746 3300035172 Bacteria 590
331 Ga0373962_0055846 3300035242 Bacteria 1148
332 Ga0373924_0034973 3300035410 Bacteria 2036
333 Ga0373931_0000924 3300035691 Bacteria 12355
334 Ga0373935_0450868 3300035692 Bacteria 929
335 Ga0373927_0003808 3300035695 Bacteria 10700
336 Ga0373927_0044584 3300035695 Bacteria 2869
337 Ga0373927_0657776 3300035695 Bacteria 692
338 Ga0373933_0207895 3300035724 Bacteria 1253
339 Ga0373933_0443148 3300035724 Bacteria 849
340 Ga0373933_0465311 3300035724 Bacteria 827
341 Ga0373947_0020729 3300035725 Bacteria 3799
342 Ga0373947_0305174 3300035725 Bacteria 1062
343 Ga0373947_0556701 3300035725 Bacteria 781
344 Ga0373937_0036187 3300036401 Bacteria 4497
345 Ga0373937_0043846 3300036401 Bacteria 4085
346 Ga0373937_1290809 3300036401 Bacteria 678
347 Ga0373925_0041443 3300037068 Bacteria 3413
348 Ga0373925_0209241 3300037068 Bacteria 1554
349 Ga0373925_0257146 3300037068 Bacteria 1402
350 Ga0373925_1051890 3300037068 Bacteria 670
351 Ga0395899_0224183 3300037312 Bacteria 1301
352 Ga0395899_0257172 3300037312 Bacteria 1196
353 Ga0395900_0001786 3300037418 Bacteria 24649
354 Ga0395900_0057271 3300037418 Bacteria 4012
355 Ga0395900_1602840 3300037418 Bacteria 562
356 Ga0395898_0012666 3300037466 Bacteria 8717
357 Ga0395898_0026555 3300037466 Bacteria 5824
358 Ga0395898_0026583 3300037466 Bacteria 5821
359 Ga0395905_0273206 3300037471 Bacteria 1576
360 Ga0395901_0009084 3300038443 Bacteria 10062
361 Ga0395901_0095686 3300038443 Bacteria 3112
362 Ga0436365_0038117 3300039437 Bacteria 61158
363 Ga0436365_0189031 3300039437 Bacteria 2873
364 Ga0436365_0692062 3300039437 Bacteria 1183
365 Ga0436365_0901531 3300039437 Bacteria 888
366 Ga0436365_1640165 3300039437 Bacteria 1638
367 Ga0436365_1734989 3300039437 Bacteria 662
368 Ga0436365_1883235 3300039437 Bacteria 1936
369 Ga0436360_0489569 3300039438 Bacteria 594
370 Ga0436360_0726828 3300039438 Bacteria 1041
371 Ga0436361_0457278 3300039447 Bacteria 1633
372 Ga0436361_0817874 3300039447 Bacteria 706
373 Ga0436361_1148887 3300039447 Bacteria 632
374 Ga0436363_0105806 3300039450 Bacteria 542
375 Ga0436363_0128754 3300039450 Bacteria 1372
376 Ga0436363_0528043 3300039450 Bacteria 1015
377 Ga0436363_1266616 3300039450 Bacteria 743
378 Ga0436362_0825933 3300039453 Bacteria 534
379 Ga0436362_1248820 3300039453 Bacteria 1679
380 Ga0439465_0144822 3300041413 Bacteria 846
381 Ga0451800_0621748 3300041459 Bacteria 536
382 Ga0451802_0468916 3300041460 Bacteria 914
383 Ga0451839_0360770 3300041496 Bacteria 912
384 Ga0451845_0488764 3300041501 Bacteria 900
385 Ga0451845_0950922 3300041501 Bacteria 1019
386 Ga0451853_1146106 3300041512 Bacteria 911
387 Ga0451853_1672742 3300041512 Bacteria 1093
388 Ga0451853_2213080 3300041512 Bacteria 549
389 Ga0439458_0046899 3300042157 Bacteria 1059
390 Ga0439459_0116425 3300042438 Bacteria 669
391 Ga0466972_0000202 3300044658 Bacteria 43714
392 Ga0466968_0001004 3300044735 Bacteria 9934
393 Ga0495592_0039612 3300046454 Bacteria 3539
394 Ga0495592_0773890 3300046454 Bacteria 572
395 Ga0495629_0028164 3300046459 Bacteria 3989
396 Ga0495629_0167575 3300046459 Bacteria 1525
397 Ga0495638_0556815 3300046460 Bacteria 569
398 Ga0495651_0021811 3300046462 Bacteria 4979
399 Ga0495651_0062006 3300046462 Bacteria 2861
400 Ga0495651_0188215 3300046462 Bacteria 1454
401 Ga0495651_0200986 3300046462 Bacteria 1394
402 Ga0495653_0031573 3300046463 Bacteria 4209
403 Ga0495580_0461897 3300046472 Bacteria 851
404 Ga0495582_0473777 3300046473 Bacteria 723
405 Ga0495605_0357588 3300046474 Bacteria 612
406 Ga0495639_0020740 3300046475 Bacteria 2872
407 Ga0495662_0074488 3300046476 Bacteria 1647
408 Ga0495662_0337790 3300046476 Bacteria 740
409 Ga0495664_0123960 3300046477 Bacteria 1563
410 Ga0495664_0141422 3300046477 Bacteria 1459
411 Ga0495664_0234256 3300046477 Bacteria 1111
412 Ga0495664_0386411 3300046477 Bacteria 841
413 Ga0495585_0355090 3300046492 Bacteria 712
414 Ga0495596_0265921 3300046500 Bacteria 666
415 Ga0495606_0077330 3300046507 Bacteria 2078
416 Ga0495608_0013051 3300046511 Bacteria 5764
417 Ga0495608_0055730 3300046511 Bacteria 2612
418 Ga0495616_0186225 3300046513 Bacteria 920
419 Ga0495616_0383735 3300046513 Bacteria 580
420 Ga0495618_0096437 3300046514 Bacteria 1891
421 Ga0495618_0594281 3300046514 Bacteria 659
422 Ga0495620_0095264 3300046515 Bacteria 1191
423 Ga0495620_0257639 3300046515 Bacteria 665
424 Ga0495628_0007080 3300046516 Bacteria 9714
425 Ga0495628_0268092 3300046516 Bacteria 1271
426 Ga0495628_0426831 3300046516 Bacteria 965
427 Ga0495630_0049243 3300046517 Bacteria 3154
428 Ga0495630_0267933 3300046517 Bacteria 1305
429 Ga0495630_0546522 3300046517 Bacteria 888
430 Ga0495652_0012414 3300046529 Bacteria 7683
431 Ga0495652_0077289 3300046529 Bacteria 2760
432 Ga0495640_0057072 3300046533 Bacteria 2665
433 Ga0495640_0252094 3300046533 Bacteria 1105
434 Ga0495586_0235018 3300046535 Bacteria 1044
435 Ga0495587_0009370 3300046536 Bacteria 6276
436 Ga0495587_0014435 3300046536 Bacteria 4955
437 Ga0495587_0019066 3300046536 Bacteria 4250
438 Ga0495587_0256996 3300046536 Bacteria 982
439 Ga0495609_0443136 3300046538 Bacteria 516
440 Ga0495645_0018792 3300046543 Bacteria 4971
441 Ga0495645_0041943 3300046543 Bacteria 3336
442 Ga0495645_0583649 3300046543 Bacteria 689
443 Ga0495645_0593694 3300046543 Bacteria 682
444 Ga0495667_0008553 3300046559 Bacteria 6947
445 Ga0495667_0226658 3300046559 Bacteria 1192
446 Ga0495656_0105520 3300046615 Bacteria 1310
447 Ga0495656_0189183 3300046615 Bacteria 1016
448 Ga0495668_0245191 3300046616 Bacteria 981
449 Ga0495668_0285622 3300046616 Bacteria 904
450 Ga0495634_0017862 3300046642 Bacteria 5056
451 Ga0495634_0091641 3300046642 Bacteria 1973
452 Ga0495634_0270141 3300046642 Bacteria 1035
453 Ga0495625_0199604 3300046660 Bacteria 1321
454 Ga0495625_0812376 3300046660 Bacteria 543
455 Ga0495635_0029411 3300046663 Bacteria 3820
456 Ga0495635_0049263 3300046663 Bacteria 2903
457 Ga0495657_0018269 3300046675 Bacteria 5078
458 Ga0495657_0055973 3300046675 Bacteria 2629
459 Ga0495599_0008568 3300046678 Bacteria 6225
460 Ga0495599_0017417 3300046678 Bacteria 4467
461 Ga0495623_0009283 3300046679 Bacteria 6386
462 Ga0495623_0273655 3300046679 Bacteria 942
463 Ga0495646_0106537 3300046680 Bacteria 1600
464 Ga0495646_0446206 3300046680 Bacteria 668
465 Ga0495658_0282095 3300046683 Bacteria 1048
466 Ga0495658_0304988 3300046683 Bacteria 1008
467 Ga0495669_0094058 3300046684 Bacteria 1387
468 Ga0495669_0141560 3300046684 Bacteria 1135
469 Ga0495613_0179816 3300046689 Bacteria 1498
470 Ga0495613_0624847 3300046689 Bacteria 715
471 Ga0495624_0509105 3300046690 Bacteria 720
472 Ga0495670_0120088 3300046691 Bacteria 1365
473 Ga0495649_0067764 3300046694 Bacteria 1915
474 Ga0495600_0015077 3300046809 Bacteria 4880
475 Ga0495604_0067829 3300047317 Bacteria 2709
476 Ga0495604_0079851 3300047317 Bacteria 2452
477 Ga0495674_0016362 3300047319 Bacteria 6917
478 Ga0495674_0215079 3300047319 Bacteria 1591
479 Ga0495674_0232429 3300047319 Bacteria 1521
480 Ga0495674_0290849 3300047319 Bacteria 1336
481 Ga0495676_0982480 3300047321 Bacteria 539
482 Ga0495680_0118798 3300047322 Bacteria 1953
483 Ga0495680_0786355 3300047322 Bacteria 622
484 Ga0495680_0788047 3300047322 Bacteria 622
485 Ga0495675_0078827 3300047444 Bacteria 2074
486 Ga0495675_0266358 3300047444 Bacteria 1025
487 Ga0495675_0439683 3300047444 Bacteria 756
488 Ga0495684_0005345 3300047471 Bacteria 9999
489 Ga0495684_0751216 3300047471 Bacteria 642
490 Ga0495593_0075538 3300047673 Bacteria 1747
491 Ga0495602_0020884 3300048088 Bacteria 6461
492 Ga0495602_0170627 3300048088 Bacteria 1689
493 Ga0495602_1022432 3300048088 Bacteria 544
494 Ga0496100_0004404 3300048903 Bacteria 7461
495 Ga0496100_0077962 3300048903 Bacteria 2229
496 Ga0496101_0005057 3300048904 Bacteria 8385
497 Ga0496101_0027090 3300048904 Bacteria 3988
498 Ga0496101_0180912 3300048904 Bacteria 1624
499 Ga0496101_0511440 3300048904 Bacteria 949
500 Ga0496101_0806898 3300048904 Bacteria 740
501 Ga0496102_0002285 3300048905 Bacteria 16370
502 Ga0496102_0067841 3300048905 Bacteria 3272
503 Ga0496102_1800951 3300048905 Bacteria 529
504 Ga0496103_0004847 3300048906 Bacteria 8126
505 Ga0496103_0066107 3300048906 Bacteria 2257
506 Ga0496103_0885078 3300048906 Bacteria 560
507 Ga0496104_0019474 3300048907 Bacteria 6210
508 Ga0496104_0471556 3300048907 Bacteria 1167
509 Ga0496104_0519350 3300048907 Bacteria 1102
510 Ga0496104_0665048 3300048907 Bacteria 950
511 Ga0496105_0010932 3300048908 Bacteria 7150
512 Ga0496105_0267408 3300048908 Bacteria 1381
513 Ga0496106_0113909 3300048909 Bacteria 2108
514 Ga0496106_0346867 3300048909 Bacteria 1192
515 Ga0496106_0408293 3300048909 Bacteria 1092
516 Ga0496106_0783547 3300048909 Bacteria 757
517 Ga0496107_0036999 3300048910 Bacteria 3502
518 Ga0496107_0094167 3300048910 Bacteria 2191
519 Ga0496108_0047914 3300048911 Bacteria 3573
520 Ga0496108_0081179 3300048911 Bacteria 2748
521 Ga0496108_0085167 3300048911 Bacteria 2682
522 Ga0496108_0213780 3300048911 Bacteria 1674
523 Ga0496108_0662291 3300048911 Bacteria 907
524 Ga0496108_1320991 3300048911 Bacteria 606
525 Ga0496109_0018602 3300048912 Bacteria 6104
526 Ga0496109_0134309 3300048912 Bacteria 2311
527 Ga0496109_0323236 3300048912 Bacteria 1456
528 Ga0496110_0066439 3300048913 Bacteria 3189
529 Ga0496110_0098247 3300048913 Bacteria 2623
530 Ga0496110_0400927 3300048913 Bacteria 1250
531 Ga0496110_0472225 3300048913 Bacteria 1143
532 Ga0496111_0008867 3300048914 Bacteria 6684
533 Ga0496111_0102608 3300048914 Bacteria 2103
534 Ga0496111_0112632 3300048914 Bacteria 2004
535 Ga0496112_0008822 3300048915 Bacteria 9048
536 Ga0496112_0045027 3300048915 Bacteria 4325
537 Ga0496112_0327681 3300048915 Bacteria 1475
538 Ga0496112_0773796 3300048915 Bacteria 885
539 Ga0496113_0136651 3300048916 Bacteria 1926
540 Ga0496113_1514436 3300048916 Bacteria 517
541 Ga0496114_0002859 3300048917 Bacteria 13241
542 Ga0496114_0031958 3300048917 Bacteria 4330
543 Ga0496114_0418217 3300048917 Bacteria 1187
544 Ga0496114_0575527 3300048917 Bacteria 994
545 Ga0496114_0947922 3300048917 Bacteria 743
546 Ga0496114_1217938 3300048917 Bacteria 639
547 Ga0496115_0020282 3300048918 Bacteria 5126
548 Ga0496115_0027394 3300048918 Bacteria 4456
549 Ga0496115_0114857 3300048918 Bacteria 2213
550 Ga0496121_0004207 3300048924 Bacteria 19640
551 Ga0496121_0023126 3300048924 Bacteria 6000
552 Ga0496126_0017149 3300048929 Bacteria 7221
553 Ga0496126_0091543 3300048929 Bacteria 2674
554 Ga0496126_0110537 3300048929 Bacteria 2394
555 Ga0496126_0336301 3300048929 Bacteria 1238
556 Ga0496126_0976249 3300048929 Bacteria 637
557 Ga0501067_0025845 3300049583 Bacteria 3254
558 Ga0501069_0169304 3300049585 Bacteria 1260
559 nmdc:mga03683_135177_c1 3300050489 Bacteria 1105
560 nmdc:mga03683_52658_c1 3300050489 Bacteria 1702
561 nmdc:mga03n38_743057_c1 3300050490 Bacteria 568
562 nmdc:mga03n38_95986_c1 3300050490 Bacteria 1421
563 nmdc:mga00v17_395717_c1 3300050491 Bacteria 898
564 nmdc:mga00v17_39948_c1 3300050491 Bacteria 2812
565 nmdc:mga0yw44_21300_c1 3300050492 Bacteria 3614
566 nmdc:mga0yw44_235987_c1 3300050492 Bacteria 1215
567 nmdc:mga0k408_119231_c1 3300050493 Bacteria 1562
568 nmdc:mga0k408_413091_c1 3300050493 Bacteria 803
569 nmdc:mga06z11_266679_c1 3300050494 Bacteria 1012
570 nmdc:mga06z11_595713_c1 3300050494 Bacteria 672
571 nmdc:mga04h51_18926_c1 3300050495 Bacteria 1363
572 nmdc:mga04h51_457600_c1 3300050495 Bacteria 541
573 nmdc:mga05p37_680078_c1 3300050507 Bacteria 1147
574 nmdc:mga08y16_132711_c1 3300050511 Bacteria 2589
575 nmdc:mga0n895_215841_c1 3300050512 Bacteria 1948
576 nmdc:mga0sz30_217008_c1 3300050516 Bacteria 850
577 nmdc:mga0sz30_3764_c1 3300050516 Bacteria 5464
578 Ga0495601_0032040 3300053077 Bacteria 3270
579 Ga0495601_0055537 3300053077 Bacteria 2507
580 Ga0495601_0153479 3300053077 Bacteria 1504
581 Ga0495601_0229016 3300053077 Bacteria 1214
582 Ga0495601_1031577 3300053077 Bacteria 516
583 Ga0495612_0036189 3300053078 Bacteria 2003
584 Ga0495612_0147845 3300053078 Bacteria 1021
585 Ga0495612_0358433 3300053078 Bacteria 659
586 Ga0495655_0011048 3300053083 Bacteria 1802
587 Ga0495655_0040942 3300053083 Bacteria 1182
588 Ga0495595_0007271 3300053084 Bacteria 4529
589 Ga0495595_0072530 3300053084 Bacteria 1629
590 Ga0495595_0254570 3300053084 Bacteria 879
591 Ga0495595_0398809 3300053084 Bacteria 697
592 Ga0495619_0012784 3300053085 Bacteria 5285
593 Ga0495619_0039240 3300053085 Bacteria 3091
594 Ga0495619_0093002 3300053085 Bacteria 2043
595 Ga0500566_0175942 3300053094 Bacteria 1102
596 Ga0500595_028770 3300053119 Bacteria 1892
597 Ga0500564_237100 3300053138 Bacteria 730
598 Ga0500568_0114396 3300053139 Bacteria 1007
599 Ga0500603_109953 3300053150 Bacteria 827
600 Ga0500603_214640 3300053150 Bacteria 613
601 Ga0500619_275598 3300053154 Bacteria 548
602 Ga0500627_0140031 3300053158 Bacteria 1093
603 2524469251 2524023210 Bacteria 9029266
604 2793084181
605 2922368542 2922361189 Bacteria 7436256
606 2922387482 2922386360 Bacteria 7017218
607 Ga0207664_10962302
608 JGI25404J52841_10010417
609 JGI25404J52841_10048176
610 Ga0058859_11248642
611 Ga0070658_10066954
612 Ga0070683_100004896
613 Ga0070690_100297803
614 Ga0070680_100171284
615 Ga0070680_100318286
616 Ga0070682_100072649
617 Ga0070682_100917847
618 Ga0070660_100018257
619 Ga0070691_10062364
620 Ga0070687_100848474
621 Ga0070668_100718740
622 Ga0070671_100141949
623 Ga0070671_100426660
624 Ga0070674_100016806
625 Ga0070688_101290794
626 Ga0070659_101758163
627 Ga0070709_10117330
628 Ga0070709_10645712
629 Ga0070714_100321176
630 Ga0070714_100422502
631 Ga0070714_101419597
632 Ga0070713_100206408
633 Ga0070713_100279941
634 Ga0070710_10771085
635 Ga0070711_100163298
636 Ga0070711_100183559
637 Ga0070711_100833482
638 Ga0070663_100078009
639 Ga0070663_101336924
640 Ga0070663_101392128
641 Ga0070678_100180749
642 Ga0070678_100787404
643 Ga0070681_10135815
644 Ga0070681_10180909
645 Ga0070681_10494718
646 Ga0068867_100965603
647 Ga0068867_101519772
648 Ga0070699_100670530
649 Ga0070679_100016325
650 Ga0070679_100066255
651 Ga0070679_100234918
652 Ga0070684_100366268
653 Ga0070684_101661087
654 Ga0070697_100053931
655 Ga0068853_100079772
656 Ga0068853_100107231
657 Ga0068853_100276391
658 Ga0068853_100353946
659 Ga0068853_101781892
660 Ga0070693_100260272
661 Ga0070665_100216958
662 Ga0068855_100039885
663 Ga0068855_100702051
664 Ga0070664_100532983
665 Ga0068857_100021961
666 Ga0068857_100592368
667 Ga0068856_100428649
668 Ga0070702_100529047
669 Ga0068852_100206109
670 Ga0068851_10017152
671 Ga0068851_10493641
672 Ga0068851_10677955
673 Ga0068870_10243592
674 Ga0068863_100150190
675 Ga0068858_102055464
676 Ga0081455_10012283
677 Ga0081455_10507020
678 Ga0081455_10712324
679 Ga0081540_1013944
680 Ga0081540_1029724
681 Ga0081539_10017333
682 Ga0070717_10092594
683 Ga0070717_10692556
684 Ga0075365_10009946
685 Ga0075365_10212742
686 Ga0075365_10334787
687 Ga0075368_10070476
688 Ga0075368_10351676
689 Ga0075363_100158439
690 Ga0075364_10029680
691 Ga0075364_10766431
692 Ga0070715_10448516
693 Ga0070716_101025448
694 Ga0070716_101172262
695 Ga0070712_100071309
696 Ga0075362_10028967
697 Ga0075367_10051170
698 Ga0075367_10062020
699 Ga0075369_10004698
700 Ga0075369_10487966
701 Ga0075366_10210813
702 Ga0097621_100184152
703 Ga0097621_100413703
704 Ga0097621_100990670
705 Ga0068871_101907294
706 Ga0075428_100033723
707 Ga0075431_101271965
708 Ga0075434_100610485
709 Ga0068865_100237397
710 Ga0099794_10131546
711 Ga0099794_10159810
712 Ga0099794_10248732
713 Ga0099795_10230628
714 Ga0099795_10243573
715 Ga0099795_10312778
716 Ga0105240_10046937
717 Ga0105240_10075256
718 Ga0105240_10338050
719 Ga0105240_10533594
720 Ga0111539_10030804
721 Ga0111539_12140682
722 Ga0105245_11456845
723 Ga0105247_10191422
724 Ga0105247_10475308
725 Ga0114129_13340846
726 Ga0105242_10082205
727 Ga0105242_11464738
728 Ga0105248_10279366
729 Ga0105248_11008719
730 Ga0105237_10023353
731 Ga0105237_10083900
732 Ga0105238_10030376
733 Ga0105238_10224828
734 Ga0105238_10272440
735 Ga0105238_10512553
736 Ga0105238_10663696
737 Ga0105238_11187506
738 Ga0099796_10014654
739 Ga0099796_10017182
740 Ga0099796_10043909
741 Ga0099796_10125395
742 Ga0099796_10162464
743 Ga0105239_10068235
744 Ga0105246_10120513
745 Ga0105246_10155899
746 Ga0105246_10539746
747 Ga0105246_12289458
748 Ga0157370_10062009
749 Ga0157370_10128014
750 Ga0157370_10322034
751 Ga0157370_10728679
752 Ga0157369_10025890
753 Ga0157369_10110252
754 Ga0157374_10017162
755 Ga0157374_10449744
756 Ga0157374_10741041
757 Ga0157374_11394672
758 Ga0157374_11858863
759 Ga0157378_10863511
760 Ga0157378_11820469
761 Ga0163162_11063373
762 Ga0163162_12120803
763 Ga0157372_10277885
764 Ga0157372_10301223
765 Ga0157372_10361659
766 Ga0157375_10007349
767 Ga0157375_10118950
768 Ga0163163_10070808
769 Ga0163163_11292879
770 Ga0163163_11415520
771 Ga0163163_11443132
772 Ga0157380_10497144
773 Ga0157379_10504156
774 Ga0157379_11348679
775 Ga0157376_10206542
776 Ga0163161_10298933
777 Ga0154015_1505921
778 Ga0213873_10054970
779 Ga0213872_10076399
780 Ga0213874_10206029
781 Ga0213876_10040597
782 Ga0213876_10061348
783 Ga0213876_10392564
784 Ga0213876_10397063
785 Ga0213871_10118745
786 Ga0207697_10201531
787 Ga0207656_10009528
788 Ga0207656_10543064
789 Ga0207656_10620274
790 Ga0207692_10066513
791 Ga0207692_10249089
792 Ga0207692_10318295
793 Ga0207688_10114222
794 Ga0207680_10266117
795 Ga0207647_10135675
796 Ga0207685_10132999
797 Ga0207685_10208937
798 Ga0207643_10602752
799 Ga0207705_10196961
800 Ga0207705_10809931
801 Ga0207684_10148561
802 Ga0207707_10007729
803 Ga0207707_10109326
804 Ga0207707_10302263
805 Ga0207707_10353897
806 Ga0207695_10022569
807 Ga0207695_10150444
808 Ga0207695_10301541
809 Ga0207695_10389771
810 Ga0207671_10038606
811 Ga0207671_10056048
812 Ga0207671_10590834
813 Ga0207693_10020497
814 Ga0207693_10581690
815 Ga0207663_10035834
816 Ga0207663_10084141
817 Ga0207663_10211496
818 Ga0207663_11100402
819 Ga0207660_10002854
820 Ga0207660_10213279
821 Ga0207660_10536202
822 Ga0207657_10011792
823 Ga0207649_10311148
824 Ga0207652_10002796
825 Ga0207652_10021439
826 Ga0207652_10037302
827 Ga0207652_10323159
828 Ga0207652_10429912
829 Ga0207694_10022565
830 Ga0207694_10100287
831 Ga0207694_10116834
832 Ga0207694_10318083
833 Ga0207694_10832486
834 Ga0207650_11532883
835 Ga0207687_10121957
836 Ga0207700_10010389
837 Ga0207700_10048645
838 Ga0207700_10167800
839 Ga0207664_10114422
840 Ga0207664_10448004
841 Ga0207664_10456512
842 Ga0207644_10425516
843 Ga0207690_11329230
844 Ga0207686_10435747
845 Ga0207686_11116406
846 Ga0207686_11197755
847 Ga0207704_10156273
848 Ga0207665_10098595
849 Ga0207665_10674255
850 Ga0207665_10971203
851 Ga0207691_10169440
852 Ga0207711_10317946
853 Ga0207689_10285187
854 Ga0207661_10004383
855 Ga0207661_10109168
856 Ga0207679_10072238
857 Ga0207679_10463557
858 Ga0207667_10009416
859 Ga0207667_10031376
860 Ga0207667_10510434
861 Ga0207667_10928829
862 Ga0207651_10416409
863 Ga0207668_11929206
864 Ga0207677_10065016
865 Ga0207639_10012431
866 Ga0207639_10177523
867 Ga0207639_10963282
868 Ga0207678_10116175
869 Ga0207702_10206776
870 Ga0207641_10717437
871 Ga0207648_10566920
872 Ga0207648_11105154
873 Ga0207676_10085923
874 Ga0207676_10713577
875 Ga0207674_10011961
876 Ga0207674_10029348
877 Ga0207674_10593455
878 Ga0207675_100223063
879 Ga0207683_10016779
880 Ga0207698_10087430
881 Ga0207698_10153208
882 Ga0209179_1065651
883 Ga0209588_1003149
884 Ga0209588_1135842
885 Ga0209813_10052213
886 Ga0207428_10589423
887 Ga0268266_10066664
888 Ga0268266_10715486
889 Ga0268265_10079925
890 Ga0268264_11053246
891 Ga0307517_10003796
892 Ga0307517_10188152
893 Ga0307515_10055458
894 Ga0307515_10124540
895 Ga0265330_10017182
896 Ga0265330_10056564
897 Ga0265330_10148391
898 Ga0265332_10012171
899 Ga0265325_10010596
900 Ga0265340_10422419
901 Ga0265339_10059676
902 Ga0265339_10310830
903 Ga0265331_10110106
904 Ga0307513_10222490
905 Ga0307408_100529722
906 Ga0307508_10055990
907 Ga0307508_10125803
908 Ga0265314_10128423
909 Ga0265342_10113946
910 Ga0307516_10003332
911 Ga0307516_10172001
912 Ga0307516_10524749
913 Ga0307406_10710984
914 Ga0307412_10442018
915 Ga0307415_101322901
916 Ga0307510_10440144
917 Ga0373930_0007290
918 Ga0373938_0140056
919 Ga0373928_0008069
920 Ga0373929_0064001
921 Ga0373934_0015043
922 Ga0373934_0034733
923 Ga0373934_0225716
924 Ga0373940_0048379
925 Ga0373944_0296957
926 Ga0373936_0023939
927 Ga0373936_0235166
928 Ga0373953_0029411
929 Ga0373953_0031812
930 Ga0373954_0008043
931 Ga0373956_0017583
932 Ga0373956_0173692
933 Ga0373960_0033807
934 Ga0373955_0100524
935 Ga0373955_0196427
936 Ga0373955_0773746
937 Ga0373962_0055846
938 Ga0373924_0034973
939 Ga0373931_0000924
940 Ga0373935_0450868
941 Ga0373927_0003808
942 Ga0373927_0044584
943 Ga0373927_0657776
944 Ga0373933_0207895
945 Ga0373933_0443148
946 Ga0373933_0465311
947 Ga0373947_0020729
948 Ga0373947_0305174
949 Ga0373947_0556701
950 Ga0373937_0036187
951 Ga0373937_0043846
952 Ga0373937_1290809
953 Ga0373925_0041443
954 Ga0373925_0209241
955 Ga0373925_0257146
956 Ga0373925_1051890
957 Ga0395899_0224183
958 Ga0395899_0257172
959 Ga0395900_0001786
960 Ga0395900_0057271
961 Ga0395900_1602840
962 Ga0395898_0012666
963 Ga0395898_0026555
964 Ga0395898_0026583
965 Ga0395905_0273206
966 Ga0395901_0009084
967 Ga0395901_0095686
968 Ga0436365_0038117
969 Ga0436365_0189031
970 Ga0436365_0692062
971 Ga0436365_0901531
972 Ga0436365_1640165
973 Ga0436365_1734989
974 Ga0436365_1883235
975 Ga0436360_0489569
976 Ga0436360_0726828
977 Ga0436361_0457278
978 Ga0436361_0817874
979 Ga0436361_1148887
980 Ga0436363_0105806
981 Ga0436363_0128754
982 Ga0436363_0528043
983 Ga0436363_1266616
984 Ga0436362_0825933
985 Ga0436362_1248820
986 Ga0439465_0144822
987 Ga0451800_0621748
988 Ga0451802_0468916
989 Ga0451839_0360770
990 Ga0451845_0488764
991 Ga0451845_0950922
992 Ga0451853_1146106
993 Ga0451853_1672742
994 Ga0451853_2213080
995 Ga0439458_0046899
996 Ga0439459_0116425
997 Ga0466972_0000202
998 Ga0466968_0001004
999 Ga0495592_0039612
1000 Ga0495592_0773890
1001 Ga0495629_0028164
1002 Ga0495629_0167575
1003 Ga0495638_0556815
1004 Ga0495651_0021811
1005 Ga0495651_0062006
1006 Ga0495651_0188215
1007 Ga0495651_0200986
1008 Ga0495653_0031573
1009 Ga0495580_0461897
1010 Ga0495582_0473777
1011 Ga0495605_0357588
1012 Ga0495639_0020740
1013 Ga0495662_0074488
1014 Ga0495662_0337790
1015 Ga0495664_0123960
1016 Ga0495664_0141422
1017 Ga0495664_0234256
1018 Ga0495664_0386411
1019 Ga0495585_0355090
1020 Ga0495596_0265921
1021 Ga0495606_0077330
1022 Ga0495608_0013051
1023 Ga0495608_0055730
1024 Ga0495616_0186225
1025 Ga0495616_0383735
1026 Ga0495618_0096437
1027 Ga0495618_0594281
1028 Ga0495620_0095264
1029 Ga0495620_0257639
1030 Ga0495628_0007080
1031 Ga0495628_0268092
1032 Ga0495628_0426831
1033 Ga0495630_0049243
1034 Ga0495630_0267933
1035 Ga0495630_0546522
1036 Ga0495652_0012414
1037 Ga0495652_0077289
1038 Ga0495640_0057072
1039 Ga0495640_0252094
1040 Ga0495586_0235018
1041 Ga0495587_0009370
1042 Ga0495587_0014435
1043 Ga0495587_0019066
1044 Ga0495587_0256996
1045 Ga0495609_0443136
1046 Ga0495645_0018792
1047 Ga0495645_0041943
1048 Ga0495645_0583649
1049 Ga0495645_0593694
1050 Ga0495667_0008553
1051 Ga0495667_0226658
1052 Ga0495656_0105520
1053 Ga0495656_0189183
1054 Ga0495668_0245191
1055 Ga0495668_0285622
1056 Ga0495634_0017862
1057 Ga0495634_0091641
1058 Ga0495634_0270141
1059 Ga0495625_0199604
1060 Ga0495625_0812376
1061 Ga0495635_0029411
1062 Ga0495635_0049263
1063 Ga0495657_0018269
1064 Ga0495657_0055973
1065 Ga0495599_0008568
1066 Ga0495599_0017417
1067 Ga0495623_0009283
1068 Ga0495623_0273655
1069 Ga0495646_0106537
1070 Ga0495646_0446206
1071 Ga0495658_0282095
1072 Ga0495658_0304988
1073 Ga0495669_0094058
1074 Ga0495669_0141560
1075 Ga0495613_0179816
1076 Ga0495613_0624847
1077 Ga0495624_0509105
1078 Ga0495670_0120088
1079 Ga0495649_0067764
1080 Ga0495600_0015077
1081 Ga0495604_0067829
1082 Ga0495604_0079851
1083 Ga0495674_0016362
1084 Ga0495674_0215079
1085 Ga0495674_0232429
1086 Ga0495674_0290849
1087 Ga0495676_0982480
1088 Ga0495680_0118798
1089 Ga0495680_0786355
1090 Ga0495680_0788047
1091 Ga0495675_0078827
1092 Ga0495675_0266358
1093 Ga0495675_0439683
1094 Ga0495684_0005345
1095 Ga0495684_0751216
1096 Ga0495593_0075538
1097 Ga0495602_0020884
1098 Ga0495602_0170627
1099 Ga0495602_1022432
1100 Ga0496100_0004404
1101 Ga0496100_0077962
1102 Ga0496101_0005057
1103 Ga0496101_0027090
1104 Ga0496101_0180912
1105 Ga0496101_0511440
1106 Ga0496101_0806898
1107 Ga0496102_0002285
1108 Ga0496102_0067841
1109 Ga0496102_1800951
1110 Ga0496103_0004847
1111 Ga0496103_0066107
1112 Ga0496103_0885078
1113 Ga0496104_0019474
1114 Ga0496104_0471556
1115 Ga0496104_0519350
1116 Ga0496104_0665048
1117 Ga0496105_0010932
1118 Ga0496105_0267408
1119 Ga0496106_0113909
1120 Ga0496106_0346867
1121 Ga0496106_0408293
1122 Ga0496106_0783547
1123 Ga0496107_0036999
1124 Ga0496107_0094167
1125 Ga0496108_0047914
1126 Ga0496108_0081179
1127 Ga0496108_0085167
1128 Ga0496108_0213780
1129 Ga0496108_0662291
1130 Ga0496108_1320991
1131 Ga0496109_0018602
1132 Ga0496109_0134309
1133 Ga0496109_0323236
1134 Ga0496110_0066439
1135 Ga0496110_0098247
1136 Ga0496110_0400927
1137 Ga0496110_0472225
1138 Ga0496111_0008867
1139 Ga0496111_0102608
1140 Ga0496111_0112632
1141 Ga0496112_0008822
1142 Ga0496112_0045027
1143 Ga0496112_0327681
1144 Ga0496112_0773796
1145 Ga0496113_0136651
1146 Ga0496113_1514436
1147 Ga0496114_0002859
1148 Ga0496114_0031958
1149 Ga0496114_0418217
1150 Ga0496114_0575527
1151 Ga0496114_0947922
1152 Ga0496114_1217938
1153 Ga0496115_0020282
1154 Ga0496115_0027394
1155 Ga0496115_0114857
1156 Ga0496121_0004207
1157 Ga0496121_0023126
1158 Ga0496126_0017149
1159 Ga0496126_0091543
1160 Ga0496126_0110537
1161 Ga0496126_0336301
1162 Ga0496126_0976249
1163 Ga0501067_0025845
1164 Ga0501069_0169304
1165 nmdc:mga03683_135177_c1
1166 nmdc:mga03683_52658_c1
1167 nmdc:mga03n38_743057_c1
1168 nmdc:mga03n38_95986_c1
1169 nmdc:mga00v17_395717_c1
1170 nmdc:mga00v17_39948_c1
1171 nmdc:mga0yw44_21300_c1
1172 nmdc:mga0yw44_235987_c1
1173 nmdc:mga0k408_119231_c1
1174 nmdc:mga0k408_413091_c1
1175 nmdc:mga06z11_266679_c1
1176 nmdc:mga06z11_595713_c1
1177 nmdc:mga04h51_18926_c1
1178 nmdc:mga04h51_457600_c1
1179 nmdc:mga05p37_680078_c1
1180 nmdc:mga08y16_132711_c1
1181 nmdc:mga0n895_215841_c1
1182 nmdc:mga0sz30_217008_c1
1183 nmdc:mga0sz30_3764_c1
1184 Ga0495601_0032040
1185 Ga0495601_0055537
1186 Ga0495601_0153479
1187 Ga0495601_0229016
1188 Ga0495601_1031577
1189 Ga0495612_0036189
1190 Ga0495612_0147845
1191 Ga0495612_0358433
1192 Ga0495655_0011048
1193 Ga0495655_0040942
1194 Ga0495595_0007271
1195 Ga0495595_0072530
1196 Ga0495595_0254570
1197 Ga0495595_0398809
1198 Ga0495619_0012784
1199 Ga0495619_0039240
1200 Ga0495619_0093002
1201 Ga0500566_0175942
1202 Ga0500595_028770
1203 Ga0500564_237100
1204 Ga0500568_0114396
1205 Ga0500603_109953
1206 Ga0500603_214640
1207 Ga0500619_275598
1208 Ga0500627_0140031
1209 2524469251
1210 2793084181
1211 2922368542
1212 2922387482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9187 2 123
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.9166 1 126
4kfc-assembly1.cif.gz_A crystal structure of a hyperactive mutant of response regulator kdpe complexed to its promoter dna 0.9165 1 127
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9139 4 129
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9082 4 127
ID Description Score Start End Superfamily
af_Q5A4X5_425_557_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9217 5 123 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.921 1 123 3.40.50.2300
af_O14283_368_529_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9097 4 129 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9096 1 127 3.40.50.2300
3cfyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9076 1 128 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A508SUI7-F1-model_v4 Transcriptional regulatory protein ZraR 0.9574 1 129 GO:0000160
AF-A0A850E3H7-F1-model_v4 deleted 0.9545 1 129
AF-A0A4Q0R710-F1-model_v4 deleted 0.9526 1 129
AF-A0A060IIQ4-F1-model_v4 Response regulator CheY-like domain-containing protein 0.9505 1 129 GO:0000160
AF-A0A0S6UHU8-F1-model_v4 Type 4 fimbriae expression regulatory protein pilR 0.9494 1 129 GO:0000160

Map