F468574

General Info

Members Datasets Scaffolds Average Seq Length
606 354 1212 268

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10048110|Ga0081455_100481103
Length 306
Sequence VVISSYRCRPWTFSDGGDDRNGGPTVKVVLFCGGLGLRMRSGNESAPKPMMTIGDRPVLWHIMRYYAHFGHTEFILCLGFGAQAVKNYFLEYRETASNDFVLSKGGGQVELLSSDISDWRITFVDTGMDTQIGERLRRVRRFLDDDDVFLASYGDVLTDAPMDQIVGKVLATDAVGCMLAVKPQASFHVVHVDDGEEVTPVHGFQSAADLPMWVNGGFFVLRQGIFDYLNEGDDLVTQGCERAARDGRMLAMPYRGFWAPMDTLKERSYLEELHRSGASPWELWRKDGGVSRPMPQPLDVAEATAL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
312 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2558860280 Kutzneria sp. 744 Isolate Unclassified
319 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
320 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
321 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
322 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
323 2643221647 Streptomyces sp. Root369 Isolate Unclassified
324 2643221679 Angustibacter sp. Root456 Isolate Unclassified
325 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
326 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
327 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
328 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
329 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
330 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
331 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
332 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
333 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
334 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
335 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
336 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
337 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
338 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
339 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
340 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
341 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
342 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
343 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
344 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
345 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
346 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
347 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
348 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
349 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
350 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
351 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
352 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
353 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
354 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0.33
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 4.46
Rhizosphere 79.54
Stem 0
Stem Tuber 0.17
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10048110 3300005937 Bacteria 3687
2 JGI24735J21928_10038558 3300002067 Bacteria 1398
3 JGI24738J21930_10018868 3300002075 Bacteria 1441
4 JGI25406J46586_10027106 3300003203 Bacteria 2201
5 rootL2_10085518 3300003322 Bacteria 1643
6 Ga0070658_10065849 3300005327 Bacteria 2958
7 Ga0070658_10111923 3300005327 Bacteria 2263
8 Ga0070683_100054182 3300005329 Bacteria 3719
9 Ga0070683_100095081 3300005329 Bacteria 2801
10 Ga0070683_100167999 3300005329 Bacteria 2082
11 Ga0070670_100086586 3300005331 Bacteria 2692
12 Ga0070680_100074809 3300005336 Bacteria 2787
13 Ga0070680_100374598 3300005336 Bacteria 1212
14 Ga0070660_100051408 3300005339 Bacteria 3174
15 Ga0070660_100396550 3300005339 Bacteria 1140
16 Ga0070691_10027077 3300005341 Bacteria 2674
17 Ga0070687_100121657 3300005343 Bacteria 1494
18 Ga0070661_100219056 3300005344 Bacteria 1459
19 Ga0070668_100002153 3300005347 Bacteria 14423
20 Ga0070668_100007994 3300005347 Bacteria 7858
21 Ga0070668_100111351 3300005347 Bacteria 2179
22 Ga0070675_100680914 3300005354 Bacteria 936
23 Ga0070671_100014009 3300005355 Bacteria 6476
24 Ga0070674_100088201 3300005356 Bacteria 2232
25 Ga0070688_100097553 3300005365 Bacteria 1932
26 Ga0070659_100203616 3300005366 Bacteria 1630
27 Ga0070659_100227380 3300005366 Bacteria 1541
28 Ga0070667_100218357 3300005367 Bacteria 1696
29 Ga0070714_100071535 3300005435 Bacteria 2999
30 Ga0070694_100254678 3300005444 Unclassified 1329
31 Ga0070663_100006419 3300005455 Bacteria 7072
32 Ga0070678_100026730 3300005456 Bacteria 3908
33 Ga0070662_100061210 3300005457 Bacteria 2748
34 Ga0070662_100128432 3300005457 Unclassified 1951
35 Ga0070662_100152041 3300005457 Unclassified 1803
36 Ga0070681_10055950 3300005458 Bacteria 3926
37 Ga0070681_10097321 3300005458 Bacteria 2890
38 Ga0068867_100192778 3300005459 Bacteria 1627
39 Ga0070685_10063979 3300005466 Bacteria 2161
40 Ga0070698_100105429 3300005471 Bacteria 2789
41 Ga0070679_100068147 3300005530 Bacteria 3549
42 Ga0070684_100345272 3300005535 Bacteria 1368
43 Ga0070684_100521489 3300005535 Bacteria 1101
44 Ga0070672_100414158 3300005543 Bacteria 1157
45 Ga0070686_100228092 3300005544 Bacteria 1349
46 Ga0070696_100144560 3300005546 Bacteria 1741
47 Ga0070693_100157754 3300005547 Bacteria 1443
48 Ga0070665_100000382 3300005548 Bacteria 65505
49 Ga0070665_100000614 3300005548 Bacteria 48924
50 Ga0070665_100065712 3300005548 Bacteria 3638
51 Ga0068856_100113069 3300005614 Bacteria 2713
52 Ga0068856_100238063 3300005614 Bacteria 1836
53 Ga0070702_100025577 3300005615 Bacteria 3165
54 Ga0070702_100191393 3300005615 Bacteria 1346
55 Ga0070702_100336051 3300005615 Bacteria 1058
56 Ga0068852_100322932 3300005616 Bacteria 1500
57 Ga0068861_100341413 3300005719 Bacteria 1311
58 Ga0068863_100001652 3300005841 Bacteria 22058
59 Ga0068863_100177568 3300005841 Bacteria 2044
60 Ga0068863_100373789 3300005841 Bacteria 1391
61 Ga0068860_100232679 3300005843 Bacteria 1791
62 Ga0081455_10000071 3300005937 Bacteria 110373
63 Ga0081455_10000765 3300005937 Bacteria 41740
64 Ga0081455_10001044 3300005937 Bacteria 34911
65 Ga0081455_10003170 3300005937 Bacteria 19093
66 Ga0081455_10005938 3300005937 Bacteria 13252
67 Ga0081455_10031395 3300005937 Bacteria 4807
68 Ga0081455_10203993 3300005937 Bacteria 1478
69 Ga0081455_10314419 3300005937 Bacteria 1118
70 Ga0081538_10106925 3300005981 Bacteria 1387
71 Ga0081540_1002169 3300005983 Bacteria 16260
72 Ga0081540_1062441 3300005983 Bacteria 1769
73 Ga0081539_10000438 3300005985 Bacteria 88645
74 Ga0081539_10005293 3300005985 Bacteria 13278
75 Ga0081539_10040826 3300005985 Bacteria 2720
76 Ga0075365_10184083 3300006038 Bacteria 1461
77 Ga0075365_10224473 3300006038 Bacteria 1318
78 Ga0075365_10276628 3300006038 Bacteria 1181
79 Ga0075363_100008863 3300006048 Bacteria 4707
80 Ga0075363_100045713 3300006048 Bacteria 2322
81 Ga0075364_10055682 3300006051 Bacteria 2587
82 Ga0075364_10064626 3300006051 Bacteria 2402
83 Ga0075432_10008834 3300006058 Bacteria 3439
84 Ga0075432_10065404 3300006058 Unclassified 1300
85 Ga0070716_100080625 3300006173 Bacteria 1941
86 Ga0070712_100111540 3300006175 Bacteria 2042
87 Ga0075362_10026264 3300006177 Bacteria 2486
88 Ga0075362_10069023 3300006177 Bacteria 1611
89 Ga0075367_10362691 3300006178 Bacteria 915
90 Ga0075370_10002298 3300006353 Bacteria 8815
91 Ga0075370_10027695 3300006353 Bacteria 3147
92 Ga0075428_100075144 3300006844 Bacteria 3690
93 Ga0075428_100508553 3300006844 Unclassified 1289
94 Ga0075431_100006806 3300006847 Bacteria 11354
95 Ga0075433_10011674 3300006852 Bacteria 7074
96 Ga0075434_100043630 3300006871 Bacteria 4447
97 Ga0075434_100099008 3300006871 Unclassified 2921
98 Ga0075434_100190695 3300006871 Bacteria 2070
99 Ga0068865_100097386 3300006881 Bacteria 2147
100 Ga0068865_100138725 3300006881 Bacteria 1831
101 Ga0075436_100159782 3300006914 Bacteria 1588
102 Ga0075435_100102580 3300007076 Bacteria 2371
103 Ga0105251_10066832 3300009011 Bacteria 1680
104 Ga0105240_10186360 3300009093 Bacteria 2444
105 Ga0111539_10001452 3300009094 Bacteria 31649
106 Ga0111539_10006929 3300009094 Bacteria 14548
107 Ga0111539_10014888 3300009094 Bacteria 9696
108 Ga0111539_10059925 3300009094 Bacteria 4512
109 Ga0111539_10334558 3300009094 Bacteria 1763
110 Ga0111539_10432054 3300009094 Bacteria 1533
111 Ga0105245_10049238 3300009098 Bacteria 3773
112 Ga0105245_10193598 3300009098 Bacteria 1949
113 Ga0114129_10016733 3300009147 Bacteria 10445
114 Ga0114129_10138164 3300009147 Bacteria 3343
115 Ga0105243_10161371 3300009148 Bacteria 1933
116 Ga0105243_10262893 3300009148 Bacteria 1546
117 Ga0105243_10483825 3300009148 Bacteria 1169
118 Ga0105242_10185605 3300009176 Bacteria 1837
119 Ga0105248_10614749 3300009177 Bacteria 1226
120 Ga0105237_10144853 3300009545 Bacteria 2370
121 Ga0105238_10114023 3300009551 Bacteria 2682
122 Ga0105238_10281273 3300009551 Unclassified 1645
123 Ga0105238_10687802 3300009551 Bacteria 1034
124 Ga0105249_10020488 3300009553 Bacteria 5911
125 Ga0105249_10123564 3300009553 Bacteria 2462
126 Ga0105249_10375065 3300009553 Bacteria 1447
127 Ga0105249_10795723 3300009553 Bacteria 1009
128 Ga0105239_10156775 3300010375 Unclassified 2543
129 Ga0105239_10215854 3300010375 Bacteria 2151
130 Ga0105246_10096918 3300011119 Bacteria 2139
131 Ga0105246_10279897 3300011119 Bacteria 1338
132 Ga0157342_1002493 3300012507 Bacteria 1499
133 Ga0157371_10282503 3300013102 Bacteria 1199
134 Ga0157370_10023587 3300013104 Bacteria 6106
135 Ga0157369_10063696 3300013105 Bacteria 3972
136 Ga0157369_10173606 3300013105 Bacteria 2270
137 Ga0157369_10434297 3300013105 Bacteria 1360
138 Ga0157369_10709495 3300013105 Bacteria 1036
139 Ga0157374_10205501 3300013296 Bacteria 1930
140 Ga0157378_10189677 3300013297 Bacteria 1938
141 Ga0163162_10152567 3300013306 Bacteria 2429
142 Ga0157372_10130849 3300013307 Bacteria 2887
143 Ga0157372_10231187 3300013307 Bacteria 2144
144 Ga0157372_10472271 3300013307 Bacteria 1462
145 Ga0157375_10094212 3300013308 Bacteria 3063
146 Ga0163163_10372143 3300014325 Bacteria 1486
147 Ga0163163_10861881 3300014325 Unclassified 969
148 Ga0157380_10145437 3300014326 Bacteria 2042
149 Ga0157380_10303674 3300014326 Bacteria 1471
150 Ga0157380_10468360 3300014326 Unclassified 1215
151 Ga0157377_10032360 3300014745 Bacteria 2848
152 Ga0157377_10178080 3300014745 Bacteria 1335
153 Ga0157379_10001752 3300014968 Bacteria 17941
154 Ga0157376_10712522 3300014969 Bacteria 1010
155 Ga0163161_10107386 3300017792 Bacteria 2083
156 Ga0206351_10300250 3300020077 Bacteria 1220
157 Ga0213876_10001304 3300021384 Bacteria 15702
158 Ga0213875_10009871 3300021388 Bacteria 4813
159 Ga0207710_10079497 3300025900 Bacteria 1519
160 Ga0207688_10036404 3300025901 Bacteria 2727
161 Ga0207688_10300307 3300025901 Unclassified 982
162 Ga0207647_10112652 3300025904 Bacteria 1608
163 Ga0207647_10139231 3300025904 Bacteria 1423
164 Ga0207645_10364902 3300025907 Bacteria 968
165 Ga0207705_10063008 3300025909 Bacteria 2679
166 Ga0207707_10023390 3300025912 Bacteria 5405
167 Ga0207695_10572618 3300025913 Bacteria 1011
168 Ga0207693_10345999 3300025915 Bacteria 1164
169 Ga0207663_10002799 3300025916 Bacteria 8408
170 Ga0207660_10330819 3300025917 Bacteria 1218
171 Ga0207660_10409875 3300025917 Bacteria 1092
172 Ga0207662_10023914 3300025918 Bacteria 3513
173 Ga0207657_10097561 3300025919 Bacteria 2443
174 Ga0207657_10101218 3300025919 Bacteria 2391
175 Ga0207649_10109657 3300025920 Bacteria 1842
176 Ga0207652_10011634 3300025921 Bacteria 7098
177 Ga0207652_10028870 3300025921 Bacteria 4631
178 Ga0207694_10245736 3300025924 Bacteria 1463
179 Ga0207659_10539360 3300025926 Bacteria 991
180 Ga0207659_10545293 3300025926 Bacteria 985
181 Ga0207687_10202291 3300025927 Bacteria 1553
182 Ga0207700_10208122 3300025928 Bacteria 1652
183 Ga0207644_10003626 3300025931 Bacteria 10014
184 Ga0207690_10169414 3300025932 Bacteria 1635
185 Ga0207690_10260130 3300025932 Bacteria 1344
186 Ga0207706_10032012 3300025933 Bacteria 4685
187 Ga0207706_10090502 3300025933 Bacteria 2690
188 Ga0207706_10161257 3300025933 Unclassified 1971
189 Ga0207709_10078092 3300025935 Bacteria 2124
190 Ga0207709_10137881 3300025935 Bacteria 1673
191 Ga0207709_10210704 3300025935 Bacteria 1394
192 Ga0207670_10290697 3300025936 Bacteria 1277
193 Ga0207704_10035126 3300025938 Bacteria 2869
194 Ga0207665_10060549 3300025939 Bacteria 2564
195 Ga0207691_10378941 3300025940 Bacteria 1208
196 Ga0207689_10086592 3300025942 Bacteria 2575
197 Ga0207661_10114157 3300025944 Bacteria 2290
198 Ga0207661_10585787 3300025944 Bacteria 1023
199 Ga0207679_10335615 3300025945 Bacteria 1313
200 Ga0207712_10031952 3300025961 Bacteria 3549
201 Ga0207712_10056405 3300025961 Bacteria 2767
202 Ga0207712_10531470 3300025961 Bacteria 1009
203 Ga0207668_10005856 3300025972 Bacteria 7238
204 Ga0207668_10100916 3300025972 Bacteria 2144
205 Ga0207640_10184512 3300025981 Bacteria 1567
206 Ga0207640_10247913 3300025981 Bacteria 1380
207 Ga0207658_10093569 3300025986 Bacteria 2337
208 Ga0207658_10423526 3300025986 Bacteria 1174
209 Ga0207658_10485124 3300025986 Bacteria 1099
210 Ga0207658_10660117 3300025986 Bacteria 943
211 Ga0207677_10071062 3300026023 Bacteria 2455
212 Ga0207677_10108461 3300026023 Bacteria 2062
213 Ga0207639_10256650 3300026041 Bacteria 1527
214 Ga0207678_10000264 3300026067 Bacteria 47439
215 Ga0207678_10028500 3300026067 Bacteria 4875
216 Ga0207708_10240515 3300026075 Bacteria 1456
217 Ga0207702_10494009 3300026078 Bacteria 1192
218 Ga0207641_10000882 3300026088 Bacteria 31324
219 Ga0207641_10031437 3300026088 Bacteria 4403
220 Ga0207641_10075854 3300026088 Bacteria 2905
221 Ga0207641_10546442 3300026088 Bacteria 1129
222 Ga0207648_10151548 3300026089 Bacteria 2046
223 Ga0207676_10028160 3300026095 Bacteria 4194
224 Ga0207674_10013060 3300026116 Bacteria 9246
225 Ga0207674_10266090 3300026116 Bacteria 1662
226 Ga0207675_100100132 3300026118 Bacteria 2730
227 Ga0207683_10014743 3300026121 Bacteria 6654
228 Ga0207683_10093637 3300026121 Bacteria 2677
229 Ga0207683_10297535 3300026121 Bacteria 1476
230 Ga0207698_10129597 3300026142 Bacteria 2153
231 Ga0207698_10205061 3300026142 Bacteria 1769
232 Ga0209371_1006446 3300027312 Bacteria 4343
233 Ga0207428_10011352 3300027907 Bacteria 7878
234 Ga0207428_10036874 3300027907 Bacteria 3983
235 Ga0207428_10054752 3300027907 Bacteria 3176
236 Ga0207428_10065086 3300027907 Bacteria 2877
237 Ga0207428_10108640 3300027907 Bacteria 2136
238 Ga0268266_10000872 3300028379 Bacteria 39233
239 Ga0268266_10054516 3300028379 Bacteria 3435
240 Ga0268266_10472726 3300028379 Bacteria 1194
241 Ga0268264_10142005 3300028381 Bacteria 2142
242 Ga0307517_10030302 3300028786 Bacteria 6349
243 Ga0307515_10000287 3300028794 Bacteria 123976
244 Ga0307515_10093900 3300028794 Bacteria 3713
245 Ga0307515_10141138 3300028794 Bacteria 2583
246 Ga0268256_1004707 3300030500 Bacteria 5563
247 Ga0307511_10000202 3300030521 Bacteria 60026
248 Ga0307511_10000366 3300030521 Bacteria 48192
249 Ga0307511_10000858 3300030521 Bacteria 32373
250 Ga0307511_10124688 3300030521 Bacteria 1577
251 Ga0307512_10016570 3300030522 Bacteria 6799
252 Ga0265327_10000081 3300031251 Bacteria 205988
253 Ga0265327_10025080 3300031251 Bacteria 3484
254 Ga0307513_10057825 3300031456 Bacteria 4127
255 Ga0307513_10124799 3300031456 Bacteria 2533
256 Ga0307509_10010791 3300031507 Bacteria 11138
257 Ga0307408_100012278 3300031548 Bacteria 5673
258 Ga0307408_100057068 3300031548 Bacteria 2833
259 Ga0307408_100751719 3300031548 Bacteria 881
260 Ga0307508_10091978 3300031616 Bacteria 2622
261 Ga0307516_10048068 3300031730 Bacteria 4200
262 Ga0307405_10005378 3300031731 Bacteria 6171
263 Ga0307405_10007394 3300031731 Bacteria 5488
264 Ga0307405_10032130 3300031731 Bacteria 3099
265 Ga0307413_10004410 3300031824 Bacteria 6119
266 Ga0307413_10004713 3300031824 Bacteria 5985
267 Ga0307413_10052762 3300031824 Bacteria 2458
268 Ga0307413_10572964 3300031824 Bacteria 919
269 Ga0307518_10000458 3300031838 Bacteria 31193
270 Ga0307410_10001714 3300031852 Bacteria 10114
271 Ga0307410_10001851 3300031852 Bacteria 9858
272 Ga0307410_10003304 3300031852 Bacteria 8060
273 Ga0307410_10317097 3300031852 Bacteria 1235
274 Ga0307406_10001808 3300031901 Bacteria 11683
275 Ga0307406_10007877 3300031901 Bacteria 5932
276 Ga0307406_10047162 3300031901 Bacteria 2714
277 Ga0307407_10001190 3300031903 Bacteria 9185
278 Ga0307407_10018489 3300031903 Bacteria 3526
279 Ga0307412_10046145 3300031911 Bacteria 2853
280 Ga0307412_10156797 3300031911 Bacteria 1686
281 Ga0307409_100000480 3300031995 Bacteria 17078
282 Ga0307409_100001281 3300031995 Bacteria 12160
283 Ga0307409_100005561 3300031995 Bacteria 7278
284 Ga0307409_100016146 3300031995 Bacteria 4930
285 Ga0307409_100023642 3300031995 Bacteria 4265
286 Ga0307409_100060970 3300031995 Bacteria 2945
287 Ga0307409_100324053 3300031995 Bacteria 1443
288 Ga0307416_100000822 3300032002 Bacteria 16271
289 Ga0307416_100007994 3300032002 Bacteria 6773
290 Ga0307416_100009215 3300032002 Bacteria 6443
291 Ga0307416_100069101 3300032002 Bacteria 2921
292 Ga0307414_10022859 3300032004 Bacteria 3953
293 Ga0307414_10046769 3300032004 Bacteria 2973
294 Ga0307414_10077634 3300032004 Bacteria 2418
295 Ga0307414_10078824 3300032004 Bacteria 2402
296 Ga0307414_10093352 3300032004 Unclassified 2243
297 Ga0307411_10005788 3300032005 Bacteria 6118
298 Ga0307411_10009080 3300032005 Bacteria 5202
299 Ga0307411_10058786 3300032005 Unclassified 2546
300 Ga0307415_100002073 3300032126 Bacteria 9911
301 Ga0307415_100003077 3300032126 Bacteria 8423
302 Ga0307415_100017554 3300032126 Bacteria 4294
303 Ga0307507_10005567 3300033179 Bacteria 20559
304 Ga0307507_10011267 3300033179 Bacteria 11333
305 Ga0307507_10015913 3300033179 Bacteria 8803
306 Ga0307507_10053757 3300033179 Bacteria 3843
307 Ga0307507_10115484 3300033179 Bacteria 2172
308 Ga0307510_10008749 3300033180 Bacteria 12064
309 Ga0307510_10065760 3300033180 Bacteria 3667
310 Ga0307510_10186914 3300033180 Bacteria 1625
311 Ga0373960_0015074 3300035121 Bacteria 1967
312 Ga0373947_0364405 3300035725 Bacteria 971
313 Ga0395898_0013927 3300037466 Bacteria 8264
314 Ga0395905_0015617 3300037471 Bacteria 7215
315 Ga0436364_0939381 3300037853 Bacteria 29915
316 Ga0436364_1338444 3300037853 Bacteria 1761
317 Ga0395901_0026368 3300038443 Bacteria 5966
318 Ga0436365_0257359 3300039437 Bacteria 15022
319 Ga0436365_1285088 3300039437 Bacteria 1320
320 Ga0439466_0041803 3300041411 Bacteria 1528
321 Ga0439465_0000211 3300041413 Bacteria 15604
322 Ga0451845_0161862 3300041501 Bacteria 1336
323 Ga0451853_2166778 3300041512 Bacteria 957
324 Ga0466969_0010625 3300044656 Bacteria 4879
325 Ga0466969_0018315 3300044656 Bacteria 3649
326 Ga0466969_0034029 3300044656 Bacteria 2583
327 Ga0466972_0031819 3300044658 Bacteria 2592
328 Ga0466972_0041688 3300044658 Bacteria 2234
329 Ga0466972_0072180 3300044658 Bacteria 1646
330 Ga0466965_0001146 3300044683 Bacteria 10416
331 Ga0466965_0001422 3300044683 Bacteria 9663
332 Ga0466965_0007627 3300044683 Bacteria 4978
333 Ga0466965_0098144 3300044683 Bacteria 1496
334 Ga0466965_0127343 3300044683 Bacteria 1318
335 Ga0466966_0000443 3300044684 Bacteria 26620
336 Ga0466966_0001534 3300044684 Bacteria 14812
337 Ga0466966_0077174 3300044684 Bacteria 2079
338 Ga0466961_0000821 3300044693 Bacteria 19410
339 Ga0466961_0172619 3300044693 Bacteria 1344
340 Ga0466963_0000202 3300044694 Bacteria 25141
341 Ga0466963_0019105 3300044694 Bacteria 4292
342 Ga0466963_0106079 3300044694 Bacteria 1926
343 Ga0466964_0006729 3300044706 Bacteria 4285
344 Ga0466971_0000228 3300044719 Bacteria 21482
345 Ga0466971_0040452 3300044719 Bacteria 2094
346 Ga0466968_0063670 3300044735 Bacteria 1594
347 Ga0466968_0117567 3300044735 Bacteria 1201
348 Ga0466970_0000544 3300044765 Bacteria 18455
349 Ga0466970_0006105 3300044765 Bacteria 6004
350 Ga0466970_0009830 3300044765 Bacteria 4845
351 Ga0466970_0013885 3300044765 Bacteria 4132
352 Ga0466970_0023106 3300044765 Bacteria 3246
353 Ga0466957_0000536 3300044842 Bacteria 19157
354 Ga0466957_0023398 3300044842 Bacteria 3653
355 Ga0466957_0152444 3300044842 Bacteria 1496
356 Ga0466960_0000188 3300044901 Bacteria 21213
357 Ga0466960_0114217 3300044901 Bacteria 1407
358 Ga0466959_0000724 3300045049 Bacteria 19266
359 Ga0466959_0010987 3300045049 Bacteria 6498
360 Ga0466959_0252160 3300045049 Bacteria 1217
361 Ga0466959_0356799 3300045049 Bacteria 996
362 Ga0451576_0516684 3300045051 Bacteria 1255
363 Ga0466958_0000221 3300045836 Bacteria 21587
364 Ga0466958_0028755 3300045836 Bacteria 3297
365 Ga0466958_0305134 3300045836 Bacteria 1022
366 Ga0466958_0486088 3300045836 Bacteria 801
367 Ga0466967_0000993 3300045976 Bacteria 15444
368 Ga0466967_0027882 3300045976 Bacteria 4705
369 Ga0466967_0112482 3300045976 Bacteria 2503
370 Ga0495592_0001444 3300046454 Bacteria 16508
371 Ga0495592_0021564 3300046454 Bacteria 4900
372 Ga0495629_0012854 3300046459 Bacteria 6055
373 Ga0495638_0003473 3300046460 Bacteria 12379
374 Ga0495638_0018009 3300046460 Bacteria 4700
375 Ga0495638_0063339 3300046460 Bacteria 2280
376 Ga0495641_0148388 3300046461 Bacteria 1048
377 Ga0495651_0011314 3300046462 Bacteria 6857
378 Ga0495580_0225999 3300046472 Bacteria 1285
379 Ga0495605_0015085 3300046474 Bacteria 4213
380 Ga0495662_0000158 3300046476 Bacteria 26589
381 Ga0495664_0087461 3300046477 Bacteria 1872
382 Ga0495594_0198476 3300046499 Bacteria 1143
383 Ga0495596_0049404 3300046500 Bacteria 1649
384 Ga0495607_0005535 3300046501 Bacteria 9013
385 Ga0495583_0179918 3300046506 Bacteria 866
386 Ga0495606_0012975 3300046507 Bacteria 6629
387 Ga0495608_0019751 3300046511 Bacteria 4633
388 Ga0495608_0258203 3300046511 Bacteria 1085
389 Ga0495616_0001883 3300046513 Bacteria 14174
390 Ga0495618_0019413 3300046514 Bacteria 4181
391 Ga0495620_0025047 3300046515 Bacteria 2829
392 Ga0495628_0037034 3300046516 Bacteria 3911
393 Ga0495630_0169402 3300046517 Bacteria 1663
394 Ga0495631_0001286 3300046518 Bacteria 15409
395 Ga0495637_0081139 3300046520 Bacteria 1293
396 Ga0495648_0079738 3300046524 Bacteria 1867
397 Ga0495666_0014854 3300046526 Bacteria 3874
398 Ga0495652_0007176 3300046529 Bacteria 10285
399 Ga0495652_0041576 3300046529 Bacteria 3967
400 Ga0495665_0020759 3300046531 Bacteria 3528
401 Ga0495640_0003763 3300046533 Bacteria 12169
402 Ga0495587_0084135 3300046536 Bacteria 1842
403 Ga0495609_0055968 3300046538 Bacteria 1748
404 Ga0495597_0069945 3300046542 Bacteria 1513
405 Ga0495645_0012565 3300046543 Bacteria 5969
406 Ga0495622_0005442 3300046557 Bacteria 5908
407 Ga0495633_0183631 3300046558 Bacteria 962
408 Ga0495668_0098979 3300046616 Bacteria 1595
409 Ga0495625_0041192 3300046660 Bacteria 3363
410 Ga0495625_0060023 3300046660 Bacteria 2695
411 Ga0495635_0035936 3300046663 Bacteria 3435
412 Ga0495635_0081353 3300046663 Bacteria 2216
413 Ga0495661_0101618 3300046665 Bacteria 1617
414 Ga0495588_0003488 3300046674 Bacteria 6852
415 Ga0495657_0008308 3300046675 Bacteria 7953
416 Ga0495657_0116431 3300046675 Bacteria 1687
417 Ga0495646_0000505 3300046680 Bacteria 20893
418 Ga0495613_0148366 3300046689 Bacteria 1673
419 Ga0495613_0162060 3300046689 Bacteria 1590
420 Ga0495624_0286890 3300046690 Bacteria 993
421 Ga0495649_0032675 3300046694 Bacteria 2865
422 Ga0495589_0039474 3300046794 Bacteria 2358
423 Ga0495581_0017610 3300047315 Bacteria 4149
424 Ga0495604_0002764 3300047317 Bacteria 14079
425 Ga0495636_0012667 3300047318 Bacteria 3339
426 Ga0495676_0381618 3300047321 Bacteria 937
427 Ga0495680_0000492 3300047322 Bacteria 44562
428 Ga0495683_0023293 3300047323 Bacteria 3182
429 Ga0495687_009984 3300047443 Bacteria 5247
430 Ga0495687_017994 3300047443 Bacteria 3505
431 Ga0495685_017421 3300047447 Bacteria 2460
432 Ga0495686_0055804 3300047472 Bacteria 2469
433 Ga0495593_0002931 3300047673 Bacteria 10271
434 Ga0495593_0190916 3300047673 Bacteria 1030
435 Ga0495614_0009419 3300048089 Bacteria 4317
436 Ga0495626_0029572 3300048091 Bacteria 2651
437 Ga0496100_0000227 3300048903 Bacteria 30068
438 Ga0496100_0468908 3300048903 Bacteria 967
439 Ga0496101_0020711 3300048904 Bacteria 4509
440 Ga0496101_0294957 3300048904 Bacteria 1269
441 Ga0496102_0000028 3300048905 Bacteria 224124
442 Ga0496102_0001944 3300048905 Bacteria 17813
443 Ga0496102_0090432 3300048905 Bacteria 2833
444 Ga0496102_0098012 3300048905 Bacteria 2720
445 Ga0496102_0554691 3300048905 Bacteria 1072
446 Ga0496102_0612645 3300048905 Bacteria 1012
447 Ga0496103_0000024 3300048906 Bacteria 223336
448 Ga0496103_0005785 3300048906 Bacteria 7382
449 Ga0496104_0010186 3300048907 Bacteria 8392
450 Ga0496105_0263070 3300048908 Bacteria 1395
451 Ga0496105_0448119 3300048908 Bacteria 1019
452 Ga0496108_0073771 3300048911 Bacteria 2881
453 Ga0496108_0195517 3300048911 Bacteria 1754
454 Ga0496108_0216744 3300048911 Bacteria 1662
455 Ga0496108_0219061 3300048911 Bacteria 1653
456 Ga0496109_0022298 3300048912 Bacteria 5608
457 Ga0496109_0037912 3300048912 Bacteria 4356
458 Ga0496109_0510583 3300048912 Bacteria 1134
459 Ga0496109_0725383 3300048912 Bacteria 932
460 Ga0496111_0155179 3300048914 Bacteria 1699
461 Ga0496113_0054439 3300048916 Bacteria 2996
462 Ga0496113_0388089 3300048916 Bacteria 1121
463 Ga0496116_0000154 3300048919 Bacteria 141052
464 Ga0496117_0000081 3300048920 Bacteria 223343
465 Ga0496117_0002928 3300048920 Bacteria 20653
466 Ga0496118_0000062 3300048921 Bacteria 219267
467 Ga0496118_0002401 3300048921 Bacteria 25289
468 Ga0496118_0003122 3300048921 Bacteria 21226
469 Ga0496119_0001867 3300048922 Bacteria 24344
470 Ga0496119_0002071 3300048922 Bacteria 22677
471 Ga0496119_0035286 3300048922 Bacteria 3279
472 Ga0496120_0027076 3300048923 Bacteria 3532
473 Ga0496121_0000497 3300048924 Bacteria 75061
474 Ga0496121_0002078 3300048924 Bacteria 31616
475 Ga0496122_0045853 3300048925 Bacteria 3392
476 Ga0496122_0183876 3300048925 Bacteria 1242
477 Ga0496124_0008188 3300048927 Bacteria 10966
478 Ga0496124_0034461 3300048927 Bacteria 4443
479 Ga0496125_0040421 3300048928 Bacteria 4001
480 Ga0496126_0000148 3300048929 Bacteria 163288
481 Ga0501033_0013029 3300049570 Bacteria 6341
482 Ga0501033_0025915 3300049570 Bacteria 4415
483 Ga0501034_0013535 3300049571 Bacteria 8397
484 Ga0501034_0272880 3300049571 Bacteria 1632
485 Ga0501037_0019443 3300049573 Bacteria 5010
486 Ga0501038_0097025 3300049574 Bacteria 2459
487 Ga0501038_0187041 3300049574 Bacteria 1668
488 Ga0501039_0115596 3300049575 Bacteria 2100
489 Ga0501040_0075198 3300049576 Bacteria 2334
490 Ga0501040_0087120 3300049576 Bacteria 2168
491 Ga0501041_0086559 3300049577 Bacteria 1933
492 Ga0501041_0114545 3300049577 Bacteria 1674
493 Ga0501041_0302058 3300049577 Bacteria 1009
494 Ga0501042_0077172 3300049578 Bacteria 2385
495 Ga0501043_0036119 3300049579 Bacteria 3887
496 Ga0501043_0058861 3300049579 Bacteria 3015
497 Ga0501043_0157731 3300049579 Bacteria 1774
498 Ga0501043_0500013 3300049579 Bacteria 908
499 Ga0501046_0000862 3300049580 Bacteria 29490
500 Ga0501046_0583287 3300049580 Bacteria 794
501 Ga0501047_0172255 3300049581 Bacteria 2033
502 Ga0501047_0347125 3300049581 Bacteria 1321
503 Ga0501047_0434520 3300049581 Bacteria 1143
504 Ga0501047_0452895 3300049581 Bacteria 1112
505 Ga0501048_0231374 3300049582 Bacteria 1311
506 Ga0501067_0136759 3300049583 Bacteria 1364
507 Ga0501070_0000670 3300049586 Bacteria 31581
508 Ga0501070_0135610 3300049586 Bacteria 2033
509 Ga0501071_0232372 3300049587 Unclassified 1389
510 Ga0501072_0006498 3300049588 Bacteria 8905
511 Ga0501073_0007897 3300049589 Bacteria 7894
512 Ga0501073_0192790 3300049589 Bacteria 1410
513 Ga0501074_0026683 3300049590 Bacteria 4188
514 Ga0501074_0211417 3300049590 Bacteria 1382
515 Ga0501075_0025138 3300049591 Bacteria 4375
516 Ga0501075_0262725 3300049591 Bacteria 1316
517 Ga0501076_0051833 3300049592 Bacteria 3249
518 Ga0501076_0387356 3300049592 Bacteria 1149
519 Ga0501077_0083925 3300049593 Bacteria 2019
520 Ga0501079_0108708 3300049741 Bacteria 2153
521 Ga0501268_050530 3300049765 Bacteria 804
522 Ga0501035_0012227 3300049822 Bacteria 7936
523 Ga0501035_0081328 3300049822 Bacteria 2859
524 Ga0501035_0552930 3300049822 Bacteria 942
525 Ga0501044_0003161 3300049823 Bacteria 18611
526 Ga0501044_0006394 3300049823 Bacteria 13020
527 Ga0501044_0353094 3300049823 Bacteria 1389
528 Ga0501045_0021932 3300049824 Bacteria 4570
529 Ga0501045_0181144 3300049824 Bacteria 1570
530 Ga0501045_0276592 3300049824 Bacteria 1250
531 nmdc:mga03683_21517_c1 3300050489 Bacteria 2488
532 nmdc:mga03n38_87696_c1 3300050490 Bacteria 1475
533 nmdc:mga00v17_115416_c1 3300050491 Bacteria 1706
534 nmdc:mga00v17_298980_c1 3300050491 Bacteria 1045
535 nmdc:mga00v17_62275_c1 3300050491 Bacteria 2295
536 nmdc:mga0yw44_192253_c1 3300050492 Bacteria 1346
537 nmdc:mga0yw44_200118_c1 3300050492 Bacteria 1319
538 nmdc:mga0yw44_356099_c1 3300050492 Bacteria 986
539 nmdc:mga07m45_12526_c2 3300050496 Bacteria 3736
540 nmdc:mga07m45_73145_c1 3300050496 Bacteria 1952
541 nmdc:mga05p37_402172_c1 3300050507 Unclassified 1599
542 nmdc:mga05p37_64896_c1 3300050507 Bacteria 4493
543 nmdc:mga09592_83576_c1 3300050508 Bacteria 2721
544 nmdc:mga06r32_44_c2 3300050510 Bacteria 16441
545 nmdc:mga08y16_26126_c1 3300050511 Bacteria 6159
546 nmdc:mga08y16_751232_c1 3300050511 Bacteria 971
547 nmdc:mga08y16_8150_c1 3300050511 Bacteria 10963
548 nmdc:mga08y16_85079_c1 3300050511 Bacteria 3296
549 nmdc:mga0n895_16760_c1 3300050512 Bacteria 6733
550 nmdc:mga0n895_45601_c1 3300050512 Bacteria 4278
551 nmdc:mga0rr50_157145_c1 3300050513 Bacteria 1843
552 nmdc:mga08x19_421635_c1 3300050514 Bacteria 937
553 nmdc:mga0a205_163362_c1 3300050515 Unclassified 2123
554 nmdc:mga0a205_2905_c1 3300050515 Bacteria 15159
555 Ga0495601_0017257 3300053077 Bacteria 4380
556 Ga0500610_0003072 3300053079 Bacteria 6321
557 Ga0500610_0137469 3300053079 Bacteria 1237
558 Ga0500560_023793 3300053107 Bacteria 1780
559 Ga0500562_001934 3300053108 Bacteria 5191
560 Ga0500616_0000530 3300053153 Bacteria 47939
561 Ga0500616_0023088 3300053153 Bacteria 3469
562 Ga0500624_007153 3300053157 Bacteria 1528
563 Ga0501084_0116936 3300054114 Unclassified 2242
564 Ga0501084_0146786 3300054114 Bacteria 1987
565 Ga0587071_031444 3300060344 Bacteria 1024
566 Ga0466962_0000169 3300061719 Bacteria 27711
567 Ga0466962_0017324 3300061719 Bacteria 3469
568 Ga0466962_0026734 3300061719 Bacteria 2771
569 2559426320 2558860280 Bacteria 11429938
570 2559428507 2558860280 Bacteria 11429938
571 2585304230 2582581313 Bacteria 10042643
572 2585315293 2582581314 Bacteria 11452267
573 2586064634 2585427649 Bacteria 9053857
574 2616693816 2616644814 Bacteria 11555299
575 2644270445 2643221647 Bacteria 10741251
576 2644446847 2643221679 Bacteria 3839507
577 2644456125 2643221681 Bacteria 3707866
578 2785373302 2784746768 Bacteria 10036182
579 2791913826 2791354901 Bacteria 8322202
580 2793977012 2791355406 Bacteria 11364898
581 2799184534 2799112218 Bacteria 4315149
582 2809586142 2808606522 Bacteria 9488490
583 2816509501 2816332139 Bacteria 9138787
584 2837185732 2837183177 Bacteria 4637169
585 2877677609 2877676314 Bacteria 9512378
586 2891399122 2891395885 Bacteria 9251614
587 2895432758 2895427314 Bacteria 13147766
588 2899373792 2899370129 Bacteria 6781179
589 2915768478 2915768154 Bacteria 8424322
590 2917741220 2917736166 Bacteria 9690793
591 2947226371 2947224130 Bacteria 9938529
592 2954382367 2954380949 Bacteria 10050426
593 2954693185 2954691527 Bacteria 10720516
594 2954708282 2954701450 Bacteria 10834262
595 2954712855 2954711539 Bacteria 10867210
596 2954722812 2954721474 Bacteria 10456478
597 2954739016 2954731030 Bacteria 10243860
598 2954741724 2954740390 Bacteria 10229294
599 2954757874 2954749733 Bacteria 10366972
600 2954760703 2954759201 Bacteria 9358192
601 3006498439 3006493962 Bacteria 8825450
602 8003316454 8003314358 Bacteria 10575343
603 8047900692 8047893842 Bacteria 11723082
604 8048358210 8048356638 Bacteria 11044339
605 8048377634 8048369669 Bacteria 11666822
606 8048386733 8048379754 Bacteria 11877923
607 Ga0081455_10048110
608 JGI24735J21928_10038558
609 JGI24738J21930_10018868
610 JGI25406J46586_10027106
611 rootL2_10085518
612 Ga0070658_10065849
613 Ga0070658_10111923
614 Ga0070683_100054182
615 Ga0070683_100095081
616 Ga0070683_100167999
617 Ga0070670_100086586
618 Ga0070680_100074809
619 Ga0070680_100374598
620 Ga0070660_100051408
621 Ga0070660_100396550
622 Ga0070691_10027077
623 Ga0070687_100121657
624 Ga0070661_100219056
625 Ga0070668_100002153
626 Ga0070668_100007994
627 Ga0070668_100111351
628 Ga0070675_100680914
629 Ga0070671_100014009
630 Ga0070674_100088201
631 Ga0070688_100097553
632 Ga0070659_100203616
633 Ga0070659_100227380
634 Ga0070667_100218357
635 Ga0070714_100071535
636 Ga0070694_100254678
637 Ga0070663_100006419
638 Ga0070678_100026730
639 Ga0070662_100061210
640 Ga0070662_100128432
641 Ga0070662_100152041
642 Ga0070681_10055950
643 Ga0070681_10097321
644 Ga0068867_100192778
645 Ga0070685_10063979
646 Ga0070698_100105429
647 Ga0070679_100068147
648 Ga0070684_100345272
649 Ga0070684_100521489
650 Ga0070672_100414158
651 Ga0070686_100228092
652 Ga0070696_100144560
653 Ga0070693_100157754
654 Ga0070665_100000382
655 Ga0070665_100000614
656 Ga0070665_100065712
657 Ga0068856_100113069
658 Ga0068856_100238063
659 Ga0070702_100025577
660 Ga0070702_100191393
661 Ga0070702_100336051
662 Ga0068852_100322932
663 Ga0068861_100341413
664 Ga0068863_100001652
665 Ga0068863_100177568
666 Ga0068863_100373789
667 Ga0068860_100232679
668 Ga0081455_10000071
669 Ga0081455_10000765
670 Ga0081455_10001044
671 Ga0081455_10003170
672 Ga0081455_10005938
673 Ga0081455_10031395
674 Ga0081455_10203993
675 Ga0081455_10314419
676 Ga0081538_10106925
677 Ga0081540_1002169
678 Ga0081540_1062441
679 Ga0081539_10000438
680 Ga0081539_10005293
681 Ga0081539_10040826
682 Ga0075365_10184083
683 Ga0075365_10224473
684 Ga0075365_10276628
685 Ga0075363_100008863
686 Ga0075363_100045713
687 Ga0075364_10055682
688 Ga0075364_10064626
689 Ga0075432_10008834
690 Ga0075432_10065404
691 Ga0070716_100080625
692 Ga0070712_100111540
693 Ga0075362_10026264
694 Ga0075362_10069023
695 Ga0075367_10362691
696 Ga0075370_10002298
697 Ga0075370_10027695
698 Ga0075428_100075144
699 Ga0075428_100508553
700 Ga0075431_100006806
701 Ga0075433_10011674
702 Ga0075434_100043630
703 Ga0075434_100099008
704 Ga0075434_100190695
705 Ga0068865_100097386
706 Ga0068865_100138725
707 Ga0075436_100159782
708 Ga0075435_100102580
709 Ga0105251_10066832
710 Ga0105240_10186360
711 Ga0111539_10001452
712 Ga0111539_10006929
713 Ga0111539_10014888
714 Ga0111539_10059925
715 Ga0111539_10334558
716 Ga0111539_10432054
717 Ga0105245_10049238
718 Ga0105245_10193598
719 Ga0114129_10016733
720 Ga0114129_10138164
721 Ga0105243_10161371
722 Ga0105243_10262893
723 Ga0105243_10483825
724 Ga0105242_10185605
725 Ga0105248_10614749
726 Ga0105237_10144853
727 Ga0105238_10114023
728 Ga0105238_10281273
729 Ga0105238_10687802
730 Ga0105249_10020488
731 Ga0105249_10123564
732 Ga0105249_10375065
733 Ga0105249_10795723
734 Ga0105239_10156775
735 Ga0105239_10215854
736 Ga0105246_10096918
737 Ga0105246_10279897
738 Ga0157342_1002493
739 Ga0157371_10282503
740 Ga0157370_10023587
741 Ga0157369_10063696
742 Ga0157369_10173606
743 Ga0157369_10434297
744 Ga0157369_10709495
745 Ga0157374_10205501
746 Ga0157378_10189677
747 Ga0163162_10152567
748 Ga0157372_10130849
749 Ga0157372_10231187
750 Ga0157372_10472271
751 Ga0157375_10094212
752 Ga0163163_10372143
753 Ga0163163_10861881
754 Ga0157380_10145437
755 Ga0157380_10303674
756 Ga0157380_10468360
757 Ga0157377_10032360
758 Ga0157377_10178080
759 Ga0157379_10001752
760 Ga0157376_10712522
761 Ga0163161_10107386
762 Ga0206351_10300250
763 Ga0213876_10001304
764 Ga0213875_10009871
765 Ga0207710_10079497
766 Ga0207688_10036404
767 Ga0207688_10300307
768 Ga0207647_10112652
769 Ga0207647_10139231
770 Ga0207645_10364902
771 Ga0207705_10063008
772 Ga0207707_10023390
773 Ga0207695_10572618
774 Ga0207693_10345999
775 Ga0207663_10002799
776 Ga0207660_10330819
777 Ga0207660_10409875
778 Ga0207662_10023914
779 Ga0207657_10097561
780 Ga0207657_10101218
781 Ga0207649_10109657
782 Ga0207652_10011634
783 Ga0207652_10028870
784 Ga0207694_10245736
785 Ga0207659_10539360
786 Ga0207659_10545293
787 Ga0207687_10202291
788 Ga0207700_10208122
789 Ga0207644_10003626
790 Ga0207690_10169414
791 Ga0207690_10260130
792 Ga0207706_10032012
793 Ga0207706_10090502
794 Ga0207706_10161257
795 Ga0207709_10078092
796 Ga0207709_10137881
797 Ga0207709_10210704
798 Ga0207670_10290697
799 Ga0207704_10035126
800 Ga0207665_10060549
801 Ga0207691_10378941
802 Ga0207689_10086592
803 Ga0207661_10114157
804 Ga0207661_10585787
805 Ga0207679_10335615
806 Ga0207712_10031952
807 Ga0207712_10056405
808 Ga0207712_10531470
809 Ga0207668_10005856
810 Ga0207668_10100916
811 Ga0207640_10184512
812 Ga0207640_10247913
813 Ga0207658_10093569
814 Ga0207658_10423526
815 Ga0207658_10485124
816 Ga0207658_10660117
817 Ga0207677_10071062
818 Ga0207677_10108461
819 Ga0207639_10256650
820 Ga0207678_10000264
821 Ga0207678_10028500
822 Ga0207708_10240515
823 Ga0207702_10494009
824 Ga0207641_10000882
825 Ga0207641_10031437
826 Ga0207641_10075854
827 Ga0207641_10546442
828 Ga0207648_10151548
829 Ga0207676_10028160
830 Ga0207674_10013060
831 Ga0207674_10266090
832 Ga0207675_100100132
833 Ga0207683_10014743
834 Ga0207683_10093637
835 Ga0207683_10297535
836 Ga0207698_10129597
837 Ga0207698_10205061
838 Ga0209371_1006446
839 Ga0207428_10011352
840 Ga0207428_10036874
841 Ga0207428_10054752
842 Ga0207428_10065086
843 Ga0207428_10108640
844 Ga0268266_10000872
845 Ga0268266_10054516
846 Ga0268266_10472726
847 Ga0268264_10142005
848 Ga0307517_10030302
849 Ga0307515_10000287
850 Ga0307515_10093900
851 Ga0307515_10141138
852 Ga0268256_1004707
853 Ga0307511_10000202
854 Ga0307511_10000366
855 Ga0307511_10000858
856 Ga0307511_10124688
857 Ga0307512_10016570
858 Ga0265327_10000081
859 Ga0265327_10025080
860 Ga0307513_10057825
861 Ga0307513_10124799
862 Ga0307509_10010791
863 Ga0307408_100012278
864 Ga0307408_100057068
865 Ga0307408_100751719
866 Ga0307508_10091978
867 Ga0307516_10048068
868 Ga0307405_10005378
869 Ga0307405_10007394
870 Ga0307405_10032130
871 Ga0307413_10004410
872 Ga0307413_10004713
873 Ga0307413_10052762
874 Ga0307413_10572964
875 Ga0307518_10000458
876 Ga0307410_10001714
877 Ga0307410_10001851
878 Ga0307410_10003304
879 Ga0307410_10317097
880 Ga0307406_10001808
881 Ga0307406_10007877
882 Ga0307406_10047162
883 Ga0307407_10001190
884 Ga0307407_10018489
885 Ga0307412_10046145
886 Ga0307412_10156797
887 Ga0307409_100000480
888 Ga0307409_100001281
889 Ga0307409_100005561
890 Ga0307409_100016146
891 Ga0307409_100023642
892 Ga0307409_100060970
893 Ga0307409_100324053
894 Ga0307416_100000822
895 Ga0307416_100007994
896 Ga0307416_100009215
897 Ga0307416_100069101
898 Ga0307414_10022859
899 Ga0307414_10046769
900 Ga0307414_10077634
901 Ga0307414_10078824
902 Ga0307414_10093352
903 Ga0307411_10005788
904 Ga0307411_10009080
905 Ga0307411_10058786
906 Ga0307415_100002073
907 Ga0307415_100003077
908 Ga0307415_100017554
909 Ga0307507_10005567
910 Ga0307507_10011267
911 Ga0307507_10015913
912 Ga0307507_10053757
913 Ga0307507_10115484
914 Ga0307510_10008749
915 Ga0307510_10065760
916 Ga0307510_10186914
917 Ga0373960_0015074
918 Ga0373947_0364405
919 Ga0395898_0013927
920 Ga0395905_0015617
921 Ga0436364_0939381
922 Ga0436364_1338444
923 Ga0395901_0026368
924 Ga0436365_0257359
925 Ga0436365_1285088
926 Ga0439466_0041803
927 Ga0439465_0000211
928 Ga0451845_0161862
929 Ga0451853_2166778
930 Ga0466969_0010625
931 Ga0466969_0018315
932 Ga0466969_0034029
933 Ga0466972_0031819
934 Ga0466972_0041688
935 Ga0466972_0072180
936 Ga0466965_0001146
937 Ga0466965_0001422
938 Ga0466965_0007627
939 Ga0466965_0098144
940 Ga0466965_0127343
941 Ga0466966_0000443
942 Ga0466966_0001534
943 Ga0466966_0077174
944 Ga0466961_0000821
945 Ga0466961_0172619
946 Ga0466963_0000202
947 Ga0466963_0019105
948 Ga0466963_0106079
949 Ga0466964_0006729
950 Ga0466971_0000228
951 Ga0466971_0040452
952 Ga0466968_0063670
953 Ga0466968_0117567
954 Ga0466970_0000544
955 Ga0466970_0006105
956 Ga0466970_0009830
957 Ga0466970_0013885
958 Ga0466970_0023106
959 Ga0466957_0000536
960 Ga0466957_0023398
961 Ga0466957_0152444
962 Ga0466960_0000188
963 Ga0466960_0114217
964 Ga0466959_0000724
965 Ga0466959_0010987
966 Ga0466959_0252160
967 Ga0466959_0356799
968 Ga0451576_0516684
969 Ga0466958_0000221
970 Ga0466958_0028755
971 Ga0466958_0305134
972 Ga0466958_0486088
973 Ga0466967_0000993
974 Ga0466967_0027882
975 Ga0466967_0112482
976 Ga0495592_0001444
977 Ga0495592_0021564
978 Ga0495629_0012854
979 Ga0495638_0003473
980 Ga0495638_0018009
981 Ga0495638_0063339
982 Ga0495641_0148388
983 Ga0495651_0011314
984 Ga0495580_0225999
985 Ga0495605_0015085
986 Ga0495662_0000158
987 Ga0495664_0087461
988 Ga0495594_0198476
989 Ga0495596_0049404
990 Ga0495607_0005535
991 Ga0495583_0179918
992 Ga0495606_0012975
993 Ga0495608_0019751
994 Ga0495608_0258203
995 Ga0495616_0001883
996 Ga0495618_0019413
997 Ga0495620_0025047
998 Ga0495628_0037034
999 Ga0495630_0169402
1000 Ga0495631_0001286
1001 Ga0495637_0081139
1002 Ga0495648_0079738
1003 Ga0495666_0014854
1004 Ga0495652_0007176
1005 Ga0495652_0041576
1006 Ga0495665_0020759
1007 Ga0495640_0003763
1008 Ga0495587_0084135
1009 Ga0495609_0055968
1010 Ga0495597_0069945
1011 Ga0495645_0012565
1012 Ga0495622_0005442
1013 Ga0495633_0183631
1014 Ga0495668_0098979
1015 Ga0495625_0041192
1016 Ga0495625_0060023
1017 Ga0495635_0035936
1018 Ga0495635_0081353
1019 Ga0495661_0101618
1020 Ga0495588_0003488
1021 Ga0495657_0008308
1022 Ga0495657_0116431
1023 Ga0495646_0000505
1024 Ga0495613_0148366
1025 Ga0495613_0162060
1026 Ga0495624_0286890
1027 Ga0495649_0032675
1028 Ga0495589_0039474
1029 Ga0495581_0017610
1030 Ga0495604_0002764
1031 Ga0495636_0012667
1032 Ga0495676_0381618
1033 Ga0495680_0000492
1034 Ga0495683_0023293
1035 Ga0495687_009984
1036 Ga0495687_017994
1037 Ga0495685_017421
1038 Ga0495686_0055804
1039 Ga0495593_0002931
1040 Ga0495593_0190916
1041 Ga0495614_0009419
1042 Ga0495626_0029572
1043 Ga0496100_0000227
1044 Ga0496100_0468908
1045 Ga0496101_0020711
1046 Ga0496101_0294957
1047 Ga0496102_0000028
1048 Ga0496102_0001944
1049 Ga0496102_0090432
1050 Ga0496102_0098012
1051 Ga0496102_0554691
1052 Ga0496102_0612645
1053 Ga0496103_0000024
1054 Ga0496103_0005785
1055 Ga0496104_0010186
1056 Ga0496105_0263070
1057 Ga0496105_0448119
1058 Ga0496108_0073771
1059 Ga0496108_0195517
1060 Ga0496108_0216744
1061 Ga0496108_0219061
1062 Ga0496109_0022298
1063 Ga0496109_0037912
1064 Ga0496109_0510583
1065 Ga0496109_0725383
1066 Ga0496111_0155179
1067 Ga0496113_0054439
1068 Ga0496113_0388089
1069 Ga0496116_0000154
1070 Ga0496117_0000081
1071 Ga0496117_0002928
1072 Ga0496118_0000062
1073 Ga0496118_0002401
1074 Ga0496118_0003122
1075 Ga0496119_0001867
1076 Ga0496119_0002071
1077 Ga0496119_0035286
1078 Ga0496120_0027076
1079 Ga0496121_0000497
1080 Ga0496121_0002078
1081 Ga0496122_0045853
1082 Ga0496122_0183876
1083 Ga0496124_0008188
1084 Ga0496124_0034461
1085 Ga0496125_0040421
1086 Ga0496126_0000148
1087 Ga0501033_0013029
1088 Ga0501033_0025915
1089 Ga0501034_0013535
1090 Ga0501034_0272880
1091 Ga0501037_0019443
1092 Ga0501038_0097025
1093 Ga0501038_0187041
1094 Ga0501039_0115596
1095 Ga0501040_0075198
1096 Ga0501040_0087120
1097 Ga0501041_0086559
1098 Ga0501041_0114545
1099 Ga0501041_0302058
1100 Ga0501042_0077172
1101 Ga0501043_0036119
1102 Ga0501043_0058861
1103 Ga0501043_0157731
1104 Ga0501043_0500013
1105 Ga0501046_0000862
1106 Ga0501046_0583287
1107 Ga0501047_0172255
1108 Ga0501047_0347125
1109 Ga0501047_0434520
1110 Ga0501047_0452895
1111 Ga0501048_0231374
1112 Ga0501067_0136759
1113 Ga0501070_0000670
1114 Ga0501070_0135610
1115 Ga0501071_0232372
1116 Ga0501072_0006498
1117 Ga0501073_0007897
1118 Ga0501073_0192790
1119 Ga0501074_0026683
1120 Ga0501074_0211417
1121 Ga0501075_0025138
1122 Ga0501075_0262725
1123 Ga0501076_0051833
1124 Ga0501076_0387356
1125 Ga0501077_0083925
1126 Ga0501079_0108708
1127 Ga0501268_050530
1128 Ga0501035_0012227
1129 Ga0501035_0081328
1130 Ga0501035_0552930
1131 Ga0501044_0003161
1132 Ga0501044_0006394
1133 Ga0501044_0353094
1134 Ga0501045_0021932
1135 Ga0501045_0181144
1136 Ga0501045_0276592
1137 nmdc:mga03683_21517_c1
1138 nmdc:mga03n38_87696_c1
1139 nmdc:mga00v17_115416_c1
1140 nmdc:mga00v17_298980_c1
1141 nmdc:mga00v17_62275_c1
1142 nmdc:mga0yw44_192253_c1
1143 nmdc:mga0yw44_200118_c1
1144 nmdc:mga0yw44_356099_c1
1145 nmdc:mga07m45_12526_c2
1146 nmdc:mga07m45_73145_c1
1147 nmdc:mga05p37_402172_c1
1148 nmdc:mga05p37_64896_c1
1149 nmdc:mga09592_83576_c1
1150 nmdc:mga06r32_44_c2
1151 nmdc:mga08y16_26126_c1
1152 nmdc:mga08y16_751232_c1
1153 nmdc:mga08y16_8150_c1
1154 nmdc:mga08y16_85079_c1
1155 nmdc:mga0n895_16760_c1
1156 nmdc:mga0n895_45601_c1
1157 nmdc:mga0rr50_157145_c1
1158 nmdc:mga08x19_421635_c1
1159 nmdc:mga0a205_163362_c1
1160 nmdc:mga0a205_2905_c1
1161 Ga0495601_0017257
1162 Ga0500610_0003072
1163 Ga0500610_0137469
1164 Ga0500560_023793
1165 Ga0500562_001934
1166 Ga0500616_0000530
1167 Ga0500616_0023088
1168 Ga0500624_007153
1169 Ga0501084_0116936
1170 Ga0501084_0146786
1171 Ga0587071_031444
1172 Ga0466962_0000169
1173 Ga0466962_0017324
1174 Ga0466962_0026734
1175 2559426320
1176 2559428507
1177 2585304230
1178 2585315293
1179 2586064634
1180 2616693816
1181 2644270445
1182 2644446847
1183 2644456125
1184 2785373302
1185 2791913826
1186 2793977012
1187 2799184534
1188 2809586142
1189 2816509501
1190 2837185732
1191 2877677609
1192 2891399122
1193 2895432758
1194 2899373792
1195 2915768478
1196 2917741220
1197 2947226371
1198 2954382367
1199 2954693185
1200 2954708282
1201 2954712855
1202 2954722812
1203 2954739016
1204 2954741724
1205 2954757874
1206 2954760703
1207 3006498439
1208 8003316454
1209 8047900692
1210 8048358210
1211 8048377634
1212 8048386733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

27

275

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8351 2 255
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8286 2 255
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8227 2 255
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8129 2 255
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8086 1 250
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8286 2 255 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8129 2 255 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.807 91 231 3.90.550.10
af_Q9M2S0_1_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7736 1 243 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7702 1 250 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V5YUL8-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9563 41 260 GO:0047343
AF-B5GZD7-F1-model_v4 Transferase (EC 2.7.7.33) 0.953 1 263 GO:0047343
AF-A0A7H0I1E1-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9526 1 264 GO:0047343
AF-A0A378TBJ6-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9514 1 257 GO:0009058
GO:0047343
AF-K0F1F9-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9505 1 257 GO:0009058
GO:0047343

Map