F468297

General Info

Members Datasets Scaffolds Average Seq Length
603 319 1206 392

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0017470|Ga0373934_0017470_392_1636
Length 414
Sequence MAASDQAGPGHQASRAQPSERAVIAGVTELLPTLRQRAQETEDARVVPAESVKSLEETGFFRLLQPRSAGGLEADPVTFFTAVRLIASACGSTGWVASVIGVHPWQLALFPQQAQDDVWGADPATRMSSSYAPTGKAKLVKGDGEVGGGGYTLNGRWSFSSGCDHASWVLLGGIVTDDEGKPVDFCTFLLPASDYTIDDVWDTVGLRGTGSNDIVVNNAFVPGHRALSFTGVTKIACPGHQVNTGALYRIPFGSIFSYAITTPIIGMATGAYAAHIDYQRQRVRASYVGQRSAEDPFAQVRIAEAAGLIDAAWLALERDMTELMDHARNDRKIPLPLRLRTRRDQVTGTGQAIRAVDLLFENSGGRALKLGTPIQRFWRDAHAGRVHAINDPERALSMFGRGEFGHDVPPDAMF

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
186 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
294 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
295 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
296 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
297 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
298 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
299 2643221561 Nocardioides sp. Root151 Isolate Unclassified
300 2643221576 Nocardioides sp. Root614 Isolate Unclassified
301 2643221590 Nocardioides sp. Root682 Isolate Unclassified
302 2643221604 Nocardioides sp. Root190 Isolate Unclassified
303 2643221615 Nocardioides sp. Root224 Isolate Unclassified
304 2643221617 Nocardioides sp. Root79 Isolate Unclassified
305 2643221620 Nocardioides sp. Root240 Isolate Unclassified
306 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
307 2643221696 Nocardioides sp. Root140 Isolate Unclassified
308 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
309 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
310 2738541305 Nocardioides sp. CF167 Isolate Unclassified
311 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
312 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
313 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
314 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
315 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
316 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
317 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
318 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
319 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 0.33
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 3.81
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0017470 3300035086 Bacteria 2738
2 JGI24737J22298_10017841 3300001990 Bacteria 2283
3 JGI25406J46586_10008352 3300003203 Bacteria 4693
4 Ga0070658_10064987 3300005327 Bacteria 2977
5 Ga0070683_100176084 3300005329 Bacteria 2030
6 Ga0070690_100122042 3300005330 Bacteria 1750
7 Ga0070666_10015790 3300005335 Bacteria 4822
8 Ga0070680_100088945 3300005336 Bacteria 2555
9 Ga0070682_100086912 3300005337 Bacteria 2037
10 Ga0068868_100042816 3300005338 Bacteria 3536
11 Ga0070660_100236496 3300005339 Bacteria 1487
12 Ga0070689_100061590 3300005340 Bacteria 2919
13 Ga0070668_100000642 3300005347 Bacteria 23581
14 Ga0070669_100083113 3300005353 Bacteria 2388
15 Ga0070671_100060336 3300005355 Bacteria 3158
16 Ga0070673_100047724 3300005364 Bacteria 3334
17 Ga0070659_100168610 3300005366 Bacteria 1792
18 Ga0070659_100222040 3300005366 Bacteria 1560
19 Ga0070709_10001154 3300005434 Bacteria 14514
20 Ga0070714_100000570 3300005435 Bacteria 26508
21 Ga0070714_100001784 3300005435 Bacteria 15666
22 Ga0070714_100011233 3300005435 Bacteria 7100
23 Ga0070714_100091015 3300005435 Bacteria 2672
24 Ga0070714_100159875 3300005435 Bacteria 2037
25 Ga0070714_100322714 3300005435 Bacteria 1444
26 Ga0070714_100330345 3300005435 Bacteria 1428
27 Ga0070713_100003560 3300005436 Bacteria 10287
28 Ga0070713_100023693 3300005436 Bacteria 4769
29 Ga0070713_100081372 3300005436 Bacteria 2763
30 Ga0070713_100119003 3300005436 Bacteria 2313
31 Ga0070710_10002653 3300005437 Bacteria 8498
32 Ga0070710_10029794 3300005437 Bacteria 2931
33 Ga0070710_10107581 3300005437 Bacteria 1670
34 Ga0070711_100004061 3300005439 Bacteria 8602
35 Ga0070711_100085178 3300005439 Bacteria 2263
36 Ga0070708_100091777 3300005445 Bacteria 2766
37 Ga0070708_100267544 3300005445 Bacteria 1607
38 Ga0070708_100421555 3300005445 Bacteria 1259
39 Ga0070663_100013123 3300005455 Bacteria 5267
40 Ga0070663_100033267 3300005455 Bacteria 3560
41 Ga0070681_10189177 3300005458 Bacteria 1978
42 Ga0070685_10048892 3300005466 Bacteria 2438
43 Ga0070706_100049901 3300005467 Bacteria 3861
44 Ga0070706_100062479 3300005467 Bacteria 3441
45 Ga0070707_100002696 3300005468 Bacteria 16886
46 Ga0070707_100013400 3300005468 Bacteria 7668
47 Ga0070707_100014613 3300005468 Bacteria 7361
48 Ga0070707_100059471 3300005468 Bacteria 3666
49 Ga0070707_100177974 3300005468 Bacteria 2073
50 Ga0070698_100001196 3300005471 Bacteria 28804
51 Ga0070698_100014548 3300005471 Bacteria 8307
52 Ga0070698_100050051 3300005471 Bacteria 4262
53 Ga0070698_100070860 3300005471 Bacteria 3497
54 Ga0070699_100000764 3300005518 Bacteria 29736
55 Ga0070684_100203360 3300005535 Bacteria 1804
56 Ga0070697_100138843 3300005536 Bacteria 2043
57 Ga0070697_100158023 3300005536 Bacteria 1914
58 Ga0068853_100061775 3300005539 Bacteria 3241
59 Ga0068853_100092674 3300005539 Bacteria 2658
60 Ga0070695_100063880 3300005545 Bacteria 2394
61 Ga0070696_100025465 3300005546 Bacteria 4023
62 Ga0068855_100175203 3300005563 Bacteria 2427
63 Ga0070664_100138393 3300005564 Bacteria 2142
64 Ga0068854_100203239 3300005578 Bacteria 1558
65 Ga0068856_100109735 3300005614 Bacteria 2756
66 Ga0068856_100234807 3300005614 Bacteria 1849
67 Ga0068852_100003383 3300005616 Bacteria 11137
68 Ga0068864_100149947 3300005618 Bacteria 2111
69 Ga0068866_10149124 3300005718 Bacteria 1352
70 Ga0068863_100166412 3300005841 Bacteria 2114
71 Ga0068863_100184281 3300005841 Bacteria 2004
72 Ga0068858_100053683 3300005842 Bacteria 3728
73 Ga0068860_100000410 3300005843 Bacteria 55852
74 Ga0068860_100013888 3300005843 Bacteria 7896
75 Ga0081455_10001381 3300005937 Bacteria 30015
76 Ga0081539_10000086 3300005985 Bacteria 217801
77 Ga0081539_10018371 3300005985 Bacteria 4856
78 Ga0070717_10024099 3300006028 Bacteria 4829
79 Ga0070717_10038636 3300006028 Bacteria 3880
80 Ga0070717_10048705 3300006028 Bacteria 3477
81 Ga0070717_10196424 3300006028 Bacteria 1765
82 Ga0070717_10201151 3300006028 Bacteria 1745
83 Ga0070717_10254280 3300006028 Bacteria 1553
84 Ga0070717_10263107 3300006028 Bacteria 1526
85 Ga0075365_10016005 3300006038 Bacteria 4549
86 Ga0075365_10194380 3300006038 Bacteria 1420
87 Ga0075368_10003683 3300006042 Bacteria 5145
88 Ga0075368_10033200 3300006042 Bacteria 2007
89 Ga0075363_100009178 3300006048 Bacteria 4644
90 Ga0075364_10005745 3300006051 Bacteria 7234
91 Ga0075364_10014973 3300006051 Bacteria 4801
92 Ga0075364_10077354 3300006051 Bacteria 2196
93 Ga0070715_10022144 3300006163 Bacteria 2474
94 Ga0070716_100011939 3300006173 Bacteria 4388
95 Ga0070712_100041918 3300006175 Bacteria 3145
96 Ga0070712_100100400 3300006175 Bacteria 2138
97 Ga0075362_10026730 3300006177 Bacteria 2467
98 Ga0075370_10044218 3300006353 Bacteria 2518
99 Ga0075370_10090641 3300006353 Bacteria 1763
100 Ga0075428_100026332 3300006844 Bacteria 6438
101 Ga0075431_100012552 3300006847 Bacteria 8551
102 Ga0075431_100099704 3300006847 Bacteria 2997
103 Ga0075431_100291137 3300006847 Bacteria 1652
104 Ga0075434_100007704 3300006871 Bacteria 9967
105 Ga0075429_100009538 3300006880 Bacteria 8419
106 Ga0075436_100099122 3300006914 Bacteria 2028
107 Ga0105245_10007729 3300009098 Bacteria 9417
108 Ga0105245_10018045 3300009098 Bacteria 6165
109 Ga0105245_10322970 3300009098 Bacteria 1521
110 Ga0105247_10031518 3300009101 Bacteria 3218
111 Ga0105247_10058228 3300009101 Bacteria 2390
112 Ga0114129_10022901 3300009147 Bacteria 8860
113 Ga0114129_10408249 3300009147 Bacteria 1789
114 Ga0105243_10133037 3300009148 Bacteria 2113
115 Ga0105241_10093182 3300009174 Bacteria 2380
116 Ga0105241_10162075 3300009174 Bacteria 1839
117 Ga0105242_10044041 3300009176 Bacteria 3612
118 Ga0105248_10055560 3300009177 Bacteria 4441
119 Ga0105248_10133139 3300009177 Bacteria 2805
120 Ga0105237_10082723 3300009545 Bacteria 3201
121 Ga0105249_10133712 3300009553 Bacteria 2371
122 Ga0105239_10187614 3300010375 Bacteria 2314
123 Ga0105246_10016655 3300011119 Bacteria 4657
124 Ga0157342_1001929 3300012507 Bacteria 1616
125 Ga0157371_10053759 3300013102 Bacteria 2860
126 Ga0157369_10017060 3300013105 Bacteria 8158
127 Ga0157378_10059272 3300013297 Bacteria 3415
128 Ga0157372_10527673 3300013307 Bacteria 1376
129 Ga0163163_10013062 3300014325 Bacteria 7585
130 Ga0163163_10056165 3300014325 Bacteria 3891
131 Ga0163163_10294737 3300014325 Bacteria 1674
132 Ga0157380_10062938 3300014326 Bacteria 2974
133 Ga0157377_10037385 3300014745 Bacteria 2674
134 Ga0157379_10011411 3300014968 Bacteria 7754
135 Ga0207653_10006897 3300025885 Bacteria 3543
136 Ga0207692_10001536 3300025898 Bacteria 8669
137 Ga0207692_10024372 3300025898 Bacteria 2812
138 Ga0207692_10040373 3300025898 Bacteria 2302
139 Ga0207692_10095617 3300025898 Bacteria 1620
140 Ga0207647_10008349 3300025904 Bacteria 7428
141 Ga0207685_10049234 3300025905 Bacteria 1618
142 Ga0207699_10020410 3300025906 Bacteria 3551
143 Ga0207699_10026142 3300025906 Bacteria 3213
144 Ga0207699_10147636 3300025906 Bacteria 1552
145 Ga0207699_10176909 3300025906 Bacteria 1432
146 Ga0207643_10011348 3300025908 Bacteria 4811
147 Ga0207684_10004936 3300025910 Bacteria 12444
148 Ga0207684_10040924 3300025910 Bacteria 3929
149 Ga0207684_10213836 3300025910 Bacteria 1663
150 Ga0207654_10115046 3300025911 Bacteria 1680
151 Ga0207695_10251872 3300025913 Bacteria 1665
152 Ga0207663_10011400 3300025916 Bacteria 4773
153 Ga0207663_10060103 3300025916 Bacteria 2407
154 Ga0207663_10120280 3300025916 Bacteria 1797
155 Ga0207662_10004985 3300025918 Bacteria 7026
156 Ga0207657_10008019 3300025919 Bacteria 10769
157 Ga0207657_10168323 3300025919 Bacteria 1777
158 Ga0207657_10224944 3300025919 Bacteria 1502
159 Ga0207646_10005717 3300025922 Bacteria 13042
160 Ga0207646_10007233 3300025922 Bacteria 11321
161 Ga0207646_10060115 3300025922 Bacteria 3394
162 Ga0207646_10210352 3300025922 Bacteria 1757
163 Ga0207694_10054589 3300025924 Bacteria 3100
164 Ga0207694_10263037 3300025924 Bacteria 1413
165 Ga0207687_10014576 3300025927 Bacteria 5145
166 Ga0207700_10015661 3300025928 Bacteria 5011
167 Ga0207700_10017204 3300025928 Bacteria 4824
168 Ga0207700_10017422 3300025928 Bacteria 4798
169 Ga0207700_10062695 3300025928 Bacteria 2824
170 Ga0207700_10247630 3300025928 Bacteria 1521
171 Ga0207664_10005175 3300025929 Bacteria 8889
172 Ga0207664_10013984 3300025929 Bacteria 5785
173 Ga0207664_10017910 3300025929 Bacteria 5204
174 Ga0207664_10030189 3300025929 Bacteria 4138
175 Ga0207664_10039524 3300025929 Bacteria 3663
176 Ga0207664_10049227 3300025929 Bacteria 3317
177 Ga0207664_10066374 3300025929 Bacteria 2892
178 Ga0207664_10077639 3300025929 Bacteria 2691
179 Ga0207664_10096905 3300025929 Bacteria 2429
180 Ga0207664_10107765 3300025929 Bacteria 2312
181 Ga0207664_10135138 3300025929 Bacteria 2080
182 Ga0207664_10317230 3300025929 Bacteria 1375
183 Ga0207690_10060432 3300025932 Bacteria 2572
184 Ga0207669_10106632 3300025937 Bacteria 1867
185 Ga0207665_10017264 3300025939 Bacteria 4742
186 Ga0207665_10042519 3300025939 Bacteria 3037
187 Ga0207665_10142294 3300025939 Bacteria 1712
188 Ga0207689_10003922 3300025942 Bacteria 13542
189 Ga0207661_10280698 3300025944 Bacteria 1489
190 Ga0207679_10010916 3300025945 Bacteria 5859
191 Ga0207667_10017308 3300025949 Bacteria 8117
192 Ga0207667_10289225 3300025949 Bacteria 1674
193 Ga0207668_10002146 3300025972 Bacteria 11505
194 Ga0207668_10011928 3300025972 Bacteria 5302
195 Ga0207658_10187630 3300025986 Bacteria 1716
196 Ga0207677_10043228 3300026023 Bacteria 2994
197 Ga0207677_10076265 3300026023 Bacteria 2386
198 Ga0207703_10061619 3300026035 Bacteria 3071
199 Ga0207639_10047386 3300026041 Bacteria 3248
200 Ga0207639_10132672 3300026041 Bacteria 2064
201 Ga0207678_10005834 3300026067 Bacteria 10977
202 Ga0207678_10027630 3300026067 Bacteria 4952
203 Ga0207708_10014233 3300026075 Bacteria 5950
204 Ga0207708_10152449 3300026075 Bacteria 1820
205 Ga0207702_10072371 3300026078 Bacteria 2971
206 Ga0207676_10072382 3300026095 Bacteria 2771
207 Ga0207675_100016824 3300026118 Bacteria 6832
208 Ga0207675_100263342 3300026118 Bacteria 1671
209 Ga0207683_10003942 3300026121 Bacteria 12878
210 Ga0207698_10102741 3300026142 Bacteria 2373
211 Ga0209813_10021816 3300027866 Bacteria 1804
212 Ga0268266_10274768 3300028379 Bacteria 1565
213 Ga0268264_10000155 3300028381 Bacteria 156029
214 Ga0268264_10078407 3300028381 Bacteria 2817
215 Ga0268264_10167726 3300028381 Bacteria 1983
216 Ga0268264_10318702 3300028381 Bacteria 1469
217 Ga0265337_1000562 3300028556 Bacteria 19510
218 Ga0265326_10003273 3300028558 Bacteria 5338
219 Ga0265319_1003722 3300028563 Bacteria 7836
220 Ga0265334_10001608 3300028573 Bacteria 10847
221 Ga0265323_10005530 3300028653 Bacteria 5366
222 Ga0265336_10002575 3300028666 Bacteria 7412
223 Ga0265336_10004427 3300028666 Bacteria 5315
224 Ga0307517_10061247 3300028786 Bacteria 3565
225 Ga0307515_10000192 3300028794 Bacteria 149030
226 Ga0307515_10006596 3300028794 Bacteria 23161
227 Ga0307515_10023361 3300028794 Bacteria 10839
228 Ga0307515_10023982 3300028794 Bacteria 10656
229 Ga0265338_10001286 3300028800 Bacteria 41166
230 Ga0265338_10012392 3300028800 Bacteria 9721
231 Ga0307511_10000710 3300030521 Bacteria 35487
232 Ga0307512_10011862 3300030522 Bacteria 8235
233 Ga0307512_10025132 3300030522 Bacteria 5284
234 Ga0265320_10010522 3300031240 Bacteria 5505
235 Ga0265339_10021613 3300031249 Bacteria 3739
236 Ga0265316_10004139 3300031344 Bacteria 14517
237 Ga0307513_10007180 3300031456 Bacteria 14468
238 Ga0307509_10010476 3300031507 Bacteria 11349
239 Ga0265313_10033810 3300031595 Bacteria 2594
240 Ga0307508_10005172 3300031616 Bacteria 12489
241 Ga0307508_10016687 3300031616 Bacteria 6682
242 Ga0307508_10065510 3300031616 Bacteria 3201
243 Ga0265314_10020889 3300031711 Bacteria 5047
244 Ga0265342_10002027 3300031712 Bacteria 18022
245 Ga0307516_10001960 3300031730 Bacteria 28187
246 Ga0307516_10018627 3300031730 Bacteria 7210
247 Ga0307516_10087317 3300031730 Bacteria 2953
248 Ga0307413_10089426 3300031824 Bacteria 2001
249 Ga0307413_10123552 3300031824 Bacteria 1758
250 Ga0307414_10170901 3300032004 Bacteria 1738
251 Ga0307415_100001831 3300032126 Bacteria 10426
252 Ga0307415_100020508 3300032126 Bacteria 4038
253 Ga0307507_10014654 3300033179 Bacteria 9324
254 Ga0316212_1002246 3300033547 Bacteria 2743
255 Ga0373948_0003054 3300034817 Bacteria 2537
256 Ga0373950_0012198 3300034818 Bacteria 1416
257 Ga0373926_0002418 3300035083 Bacteria 5916
258 Ga0373926_0012522 3300035083 Bacteria 2868
259 Ga0373926_0042178 3300035083 Bacteria 1631
260 Ga0373928_0006227 3300035084 Bacteria 2292
261 Ga0373940_0001991 3300035088 Bacteria 3865
262 Ga0373944_0007878 3300035089 Bacteria 2867
263 Ga0373949_0002005 3300035090 Bacteria 5435
264 Ga0373951_0006183 3300035091 Bacteria 2747
265 Ga0373952_0004632 3300035092 Bacteria 2498
266 Ga0373923_0019756 3300035111 Bacteria 2611
267 Ga0373932_0009608 3300035112 Bacteria 2327
268 Ga0373936_0001965 3300035113 Bacteria 7603
269 Ga0373936_0004348 3300035113 Bacteria 5356
270 Ga0373936_0033028 3300035113 Bacteria 2049
271 Ga0373941_0007715 3300035115 Bacteria 2644
272 Ga0373945_0000063 3300035116 Bacteria 23921
273 Ga0373945_0005414 3300035116 Bacteria 4084
274 Ga0373953_0012778 3300035117 Bacteria 2981
275 Ga0373954_0004140 3300035118 Bacteria 6212
276 Ga0373956_0008351 3300035119 Bacteria 4189
277 Ga0373956_0028041 3300035119 Bacteria 2448
278 Ga0373957_0001854 3300035120 Bacteria 5858
279 Ga0373957_0009269 3300035120 Bacteria 3216
280 Ga0373957_0022048 3300035120 Bacteria 2266
281 Ga0373943_0006467 3300035170 Bacteria 5262
282 Ga0373946_0002355 3300035171 Bacteria 6680
283 Ga0373955_0004276 3300035172 Bacteria 6310
284 Ga0373955_0006902 3300035172 Bacteria 5191
285 Ga0373955_0011472 3300035172 Bacteria 4225
286 Ga0373955_0035511 3300035172 Bacteria 2640
287 Ga0373942_0000165 3300035207 Bacteria 16207
288 Ga0373962_0021876 3300035242 Bacteria 1691
289 Ga0373924_0006572 3300035410 Bacteria 4168
290 Ga0373924_0014245 3300035410 Bacteria 3002
291 Ga0373931_0213426 3300035691 Bacteria 1159
292 Ga0373935_0006081 3300035692 Bacteria 7177
293 Ga0373935_0010347 3300035692 Bacteria 5595
294 Ga0373935_0027858 3300035692 Bacteria 3491
295 Ga0373927_0001934 3300035695 Bacteria 15296
296 Ga0373933_0003594 3300035724 Bacteria 8612
297 Ga0373933_0005089 3300035724 Bacteria 7169
298 Ga0373933_0037092 3300035724 Bacteria 2858
299 Ga0373933_0052521 3300035724 Bacteria 2439
300 Ga0373933_0062470 3300035724 Bacteria 2249
301 Ga0373933_0124188 3300035724 Bacteria 1618
302 Ga0373947_0000011 3300035725 Bacteria 160778
303 Ga0373947_0000952 3300035725 Bacteria 17638
304 Ga0373947_0001869 3300035725 Bacteria 12839
305 Ga0373947_0058970 3300035725 Bacteria 2326
306 Ga0373937_0041749 3300036401 Bacteria 4184
307 Ga0373937_0047667 3300036401 Bacteria 3922
308 Ga0373937_0056951 3300036401 Bacteria 3589
309 Ga0373937_0084328 3300036401 Bacteria 2939
310 Ga0373937_0123759 3300036401 Bacteria 2411
311 Ga0372808_000114 3300036459 Bacteria 4202
312 Ga0372808_004314 3300036459 Bacteria 1807
313 Ga0373925_0000072 3300037068 Bacteria 106707
314 Ga0373925_0002590 3300037068 Bacteria 14378
315 Ga0373925_0007631 3300037068 Bacteria 7878
316 Ga0373925_0099768 3300037068 Bacteria 2230
317 Ga0395900_0023945 3300037418 Bacteria 6247
318 Ga0395900_0114385 3300037418 Bacteria 2769
319 Ga0395898_0096601 3300037466 Bacteria 2838
320 Ga0436364_0690278 3300037853 Bacteria 5198
321 Ga0436364_1422257 3300037853 Bacteria 1361
322 Ga0395901_0172038 3300038443 Bacteria 2272
323 Ga0395901_0338593 3300038443 Bacteria 1554
324 Ga0451793_0535357 3300041452 Bacteria 7523
325 Ga0451833_0215925 3300041491 Bacteria 6583
326 Ga0451843_1022262 3300041509 Bacteria 2393
327 Ga0451853_0390109 3300041512 Bacteria 9634
328 Ga0439431_0017807 3300041997 Bacteria 1674
329 Ga0439452_027813 3300042010 Bacteria 1417
330 Ga0466969_0010807 3300044656 Bacteria 4836
331 Ga0466972_0014962 3300044658 Bacteria 3881
332 Ga0466965_0017059 3300044683 Bacteria 3466
333 Ga0466965_0019370 3300044683 Bacteria 3267
334 Ga0466965_0035271 3300044683 Bacteria 2450
335 Ga0466965_0045200 3300044683 Bacteria 2177
336 Ga0466966_0001650 3300044684 Bacteria 14382
337 Ga0466966_0012869 3300044684 Bacteria 5541
338 Ga0466966_0021303 3300044684 Bacteria 4257
339 Ga0466966_0033145 3300044684 Bacteria 3345
340 Ga0466966_0040362 3300044684 Bacteria 3004
341 Ga0466966_0083926 3300044684 Bacteria 1982
342 Ga0466961_0004276 3300044693 Bacteria 8940
343 Ga0466961_0016413 3300044693 Bacteria 4758
344 Ga0466961_0021602 3300044693 Bacteria 4141
345 Ga0466961_0022184 3300044693 Bacteria 4084
346 Ga0466961_0039976 3300044693 Bacteria 3006
347 Ga0466961_0085174 3300044693 Bacteria 1999
348 Ga0466961_0105489 3300044693 Bacteria 1774
349 Ga0466963_0059827 3300044694 Bacteria 2543
350 Ga0466963_0074315 3300044694 Bacteria 2292
351 Ga0466963_0086500 3300044694 Bacteria 2130
352 Ga0466970_0023693 3300044765 Bacteria 3208
353 Ga0466970_0032971 3300044765 Bacteria 2737
354 Ga0466970_0055576 3300044765 Bacteria 2114
355 Ga0466970_0084852 3300044765 Bacteria 1715
356 Ga0466957_0090615 3300044842 Bacteria 1915
357 Ga0466960_0004437 3300044901 Bacteria 5484
358 Ga0466960_0006092 3300044901 Bacteria 4822
359 Ga0466959_0011146 3300045049 Bacteria 6452
360 Ga0466959_0011833 3300045049 Bacteria 6282
361 Ga0466958_0001690 3300045836 Bacteria 10637
362 Ga0466958_0008621 3300045836 Bacteria 5659
363 Ga0466958_0079511 3300045836 Bacteria 2016
364 Ga0466958_0111356 3300045836 Bacteria 1709
365 Ga0466958_0169354 3300045836 Bacteria 1383
366 Ga0466967_0002377 3300045976 Bacteria 11654
367 Ga0466967_0004350 3300045976 Bacteria 9535
368 Ga0466967_0010208 3300045976 Bacteria 7027
369 Ga0466967_0022161 3300045976 Bacteria 5176
370 Ga0466967_0054752 3300045976 Bacteria 3513
371 Ga0466967_0062607 3300045976 Bacteria 3303
372 Ga0466967_0157090 3300045976 Bacteria 2131
373 Ga0466967_0251545 3300045976 Bacteria 1688
374 Ga0495592_0000831 3300046454 Bacteria 21457
375 Ga0495592_0012576 3300046454 Bacteria 6433
376 Ga0495592_0036341 3300046454 Bacteria 3710
377 Ga0495592_0058949 3300046454 Bacteria 2829
378 Ga0495592_0066105 3300046454 Bacteria 2646
379 Ga0495603_0026491 3300046455 Bacteria 3502
380 Ga0495603_0075296 3300046455 Bacteria 1981
381 Ga0495603_0087384 3300046455 Bacteria 1824
382 Ga0495629_0011493 3300046459 Bacteria 6431
383 Ga0495629_0014137 3300046459 Bacteria 5750
384 Ga0495629_0111035 3300046459 Bacteria 1911
385 Ga0495641_0011080 3300046461 Bacteria 5163
386 Ga0495641_0013867 3300046461 Bacteria 4393
387 Ga0495651_0022366 3300046462 Bacteria 4914
388 Ga0495651_0025204 3300046462 Bacteria 4628
389 Ga0495651_0035323 3300046462 Bacteria 3892
390 Ga0495653_0007038 3300046463 Bacteria 9230
391 Ga0495653_0092287 3300046463 Bacteria 2211
392 Ga0495653_0110620 3300046463 Bacteria 1974
393 Ga0495580_0012950 3300046472 Bacteria 6385
394 Ga0495580_0028064 3300046472 Bacteria 4093
395 Ga0495582_0030572 3300046473 Bacteria 2956
396 Ga0495639_0029292 3300046475 Bacteria 2443
397 Ga0495662_0023447 3300046476 Bacteria 2980
398 Ga0495664_0000220 3300046477 Bacteria 27274
399 Ga0495664_0017525 3300046477 Bacteria 4095
400 Ga0495664_0035491 3300046477 Bacteria 2936
401 Ga0495664_0045305 3300046477 Bacteria 2608
402 Ga0495594_0087990 3300046499 Bacteria 1739
403 Ga0495594_0095368 3300046499 Bacteria 1670
404 Ga0495608_0006046 3300046511 Bacteria 8603
405 Ga0495608_0009916 3300046511 Bacteria 6650
406 Ga0495608_0022625 3300046511 Bacteria 4310
407 Ga0495608_0118775 3300046511 Bacteria 1696
408 Ga0495628_0035616 3300046516 Bacteria 3998
409 Ga0495628_0070078 3300046516 Bacteria 2734
410 Ga0495628_0079477 3300046516 Bacteria 2550
411 Ga0495628_0105280 3300046516 Bacteria 2173
412 Ga0495628_0172550 3300046516 Bacteria 1639
413 Ga0495630_0007758 3300046517 Bacteria 7683
414 Ga0495630_0012136 3300046517 Bacteria 6247
415 Ga0495630_0054191 3300046517 Bacteria 3004
416 Ga0495666_0005324 3300046526 Bacteria 6488
417 Ga0495666_0036890 3300046526 Bacteria 2379
418 Ga0495652_0017216 3300046529 Bacteria 6453
419 Ga0495652_0033278 3300046529 Bacteria 4501
420 Ga0495652_0138475 3300046529 Bacteria 1917
421 Ga0495665_0007638 3300046531 Bacteria 5854
422 Ga0495665_0017714 3300046531 Bacteria 3830
423 Ga0495640_0017105 3300046533 Bacteria 5410
424 Ga0495640_0033600 3300046533 Bacteria 3642
425 Ga0495640_0045983 3300046533 Bacteria 3027
426 Ga0495587_0010978 3300046536 Bacteria 5745
427 Ga0495587_0012217 3300046536 Bacteria 5421
428 Ga0495587_0024741 3300046536 Bacteria 3676
429 Ga0495667_0006400 3300046559 Bacteria 7985
430 Ga0495667_0007944 3300046559 Bacteria 7193
431 Ga0495667_0008522 3300046559 Bacteria 6959
432 Ga0495667_0040864 3300046559 Bacteria 3077
433 Ga0495667_0043456 3300046559 Bacteria 2977
434 Ga0495634_0026821 3300046642 Bacteria 4016
435 Ga0495634_0049158 3300046642 Bacteria 2837
436 Ga0495634_0067641 3300046642 Bacteria 2362
437 Ga0495634_0080422 3300046642 Bacteria 2132
438 Ga0495635_0002796 3300046663 Bacteria 11958
439 Ga0495635_0006437 3300046663 Bacteria 8188
440 Ga0495635_0027417 3300046663 Bacteria 3962
441 Ga0495635_0056149 3300046663 Bacteria 2711
442 Ga0495635_0069286 3300046663 Bacteria 2418
443 Ga0495635_0080743 3300046663 Bacteria 2225
444 Ga0495588_0050901 3300046674 Bacteria 2132
445 Ga0495657_0007413 3300046675 Bacteria 8477
446 Ga0495657_0020546 3300046675 Bacteria 4745
447 Ga0495599_0015523 3300046678 Bacteria 4728
448 Ga0495599_0033814 3300046678 Bacteria 3213
449 Ga0495599_0034543 3300046678 Bacteria 3176
450 Ga0495599_0103092 3300046678 Bacteria 1778
451 Ga0495623_0022658 3300046679 Bacteria 4054
452 Ga0495623_0045035 3300046679 Bacteria 2803
453 Ga0495646_0021320 3300046680 Bacteria 4095
454 Ga0495646_0080341 3300046680 Bacteria 1902
455 Ga0495658_0050333 3300046683 Bacteria 2356
456 Ga0495658_0051301 3300046683 Bacteria 2337
457 Ga0495669_0045736 3300046684 Bacteria 1952
458 Ga0495613_0018025 3300046689 Bacteria 5262
459 Ga0495613_0043773 3300046689 Bacteria 3312
460 Ga0495613_0140259 3300046689 Bacteria 1727
461 Ga0495600_0003949 3300046809 Bacteria 8809
462 Ga0495600_0023362 3300046809 Bacteria 3977
463 Ga0495600_0036524 3300046809 Bacteria 3193
464 Ga0495600_0044802 3300046809 Bacteria 2885
465 Ga0495600_0124411 3300046809 Bacteria 1677
466 Ga0495581_0017623 3300047315 Bacteria 4148
467 Ga0495581_0019788 3300047315 Bacteria 3909
468 Ga0495581_0068202 3300047315 Bacteria 2056
469 Ga0495604_0021065 3300047317 Bacteria 5201
470 Ga0495604_0021793 3300047317 Bacteria 5114
471 Ga0495604_0025955 3300047317 Bacteria 4666
472 Ga0495604_0027873 3300047317 Bacteria 4492
473 Ga0495674_0003143 3300047319 Bacteria 16039
474 Ga0495674_0030062 3300047319 Bacteria 4942
475 Ga0495676_0017043 3300047321 Bacteria 6428
476 Ga0495676_0158643 3300047321 Bacteria 1602
477 Ga0495680_0004344 3300047322 Bacteria 13578
478 Ga0495680_0007513 3300047322 Bacteria 9981
479 Ga0495680_0016778 3300047322 Bacteria 6278
480 Ga0495680_0044307 3300047322 Bacteria 3518
481 Ga0495680_0050841 3300047322 Bacteria 3239
482 Ga0495680_0154019 3300047322 Bacteria 1673
483 Ga0495675_0001647 3300047444 Bacteria 13373
484 Ga0495675_0020600 3300047444 Bacteria 4197
485 Ga0495675_0034359 3300047444 Bacteria 3237
486 Ga0495684_0010271 3300047471 Bacteria 7238
487 Ga0495684_0016550 3300047471 Bacteria 5680
488 Ga0495684_0031130 3300047471 Bacteria 4095
489 Ga0495684_0076200 3300047471 Bacteria 2547
490 Ga0495593_0012025 3300047673 Bacteria 4961
491 Ga0495593_0037528 3300047673 Bacteria 2620
492 Ga0495602_0007219 3300048088 Bacteria 11640
493 Ga0495602_0130069 3300048088 Bacteria 2009
494 Ga0495614_0011370 3300048089 Bacteria 3918
495 Ga0496101_0027213 3300048904 Bacteria 3981
496 Ga0496102_0000721 3300048905 Bacteria 32596
497 Ga0496102_0080777 3300048905 Bacteria 2996
498 Ga0496103_0018149 3300048906 Bacteria 4219
499 Ga0496103_0036334 3300048906 Bacteria 3017
500 Ga0496104_0029437 3300048907 Bacteria 5094
501 Ga0496104_0077284 3300048907 Bacteria 3172
502 Ga0496104_0177450 3300048907 Bacteria 2040
503 Ga0496105_0016141 3300048908 Bacteria 5956
504 Ga0496107_0077672 3300048910 Bacteria 2418
505 Ga0496108_0000041 3300048911 Bacteria 147365
506 Ga0496109_0103852 3300048912 Bacteria 2638
507 Ga0496110_0020301 3300048913 Bacteria 5609
508 Ga0496110_0031602 3300048913 Bacteria 4568
509 Ga0496110_0204486 3300048913 Bacteria 1794
510 Ga0496111_0003925 3300048914 Bacteria 9322
511 Ga0496112_0102848 3300048915 Bacteria 2826
512 Ga0496112_0174052 3300048915 Bacteria 2117
513 Ga0496114_0016245 3300048917 Bacteria 5995
514 Ga0496114_0041906 3300048917 Bacteria 3793
515 Ga0496114_0164934 3300048917 Bacteria 1928
516 Ga0496115_0044952 3300048918 Bacteria 3524
517 Ga0501031_0015215 3300049568 Bacteria 4996
518 Ga0501034_0205525 3300049571 Bacteria 1926
519 Ga0501036_0069665 3300049572 Bacteria 2975
520 Ga0501038_0000163 3300049574 Bacteria 56384
521 Ga0501047_0005021 3300049581 Bacteria 12423
522 Ga0501047_0255377 3300049581 Bacteria 1601
523 Ga0501048_0000286 3300049582 Bacteria 34220
524 Ga0501069_0116556 3300049585 Bacteria 1524
525 Ga0501070_0007934 3300049586 Bacteria 8993
526 Ga0501070_0035634 3300049586 Bacteria 4157
527 Ga0501070_0052385 3300049586 Bacteria 3387
528 Ga0501070_0104703 3300049586 Bacteria 2339
529 Ga0501073_0137479 3300049589 Bacteria 1693
530 Ga0501035_0010663 3300049822 Bacteria 8509
531 Ga0501035_0092318 3300049822 Bacteria 2664
532 Ga0501044_0037255 3300049823 Bacteria 5084
533 nmdc:mga03683_35533_c1 3300050489 Bacteria 2022
534 nmdc:mga03n38_12373_c1 3300050490 Bacteria 3209
535 nmdc:mga03n38_35483_c1 3300050490 Bacteria 2137
536 nmdc:mga00v17_125519_c1 3300050491 Bacteria 1637
537 nmdc:mga00v17_29992_c1 3300050491 Bacteria 3196
538 nmdc:mga00v17_6651_c1 3300050491 Bacteria 6141
539 nmdc:mga0yw44_1287_c1 3300050492 Bacteria 9899
540 nmdc:mga0yw44_196671_c1 3300050492 Bacteria 1331
541 nmdc:mga0yw44_30520_c1 3300050492 Bacteria 3125
542 nmdc:mga0yw44_54193_c1 3300050492 Bacteria 2437
543 nmdc:mga07m45_87509_c1 3300050496 Bacteria 1783
544 nmdc:mga05p37_191766_c1 3300050507 Bacteria 2481
545 nmdc:mga09592_21042_c1 3300050508 Bacteria 5372
546 nmdc:mga0qj67_227598_c1 3300050509 Bacteria 1513
547 nmdc:mga06r32_1287_c1 3300050510 Bacteria 10168
548 nmdc:mga0n895_39614_c1 3300050512 Bacteria 4573
549 Ga0495601_0021951 3300053077 Bacteria 3916
550 Ga0495612_0004755 3300053078 Bacteria 5619
551 Ga0495612_0021123 3300053078 Bacteria 2612
552 Ga0495612_0025030 3300053078 Bacteria 2396
553 Ga0495595_0005316 3300053084 Bacteria 5206
554 Ga0495595_0016070 3300053084 Bacteria 3196
555 Ga0495619_0019370 3300053085 Bacteria 4324
556 Ga0495619_0028982 3300053085 Bacteria 3574
557 Ga0495619_0134716 3300053085 Bacteria 1699
558 Ga0500644_0000067 3300053088 Bacteria 61703
559 Ga0500644_0011522 3300053088 Bacteria 2418
560 Ga0500644_0017444 3300053088 Bacteria 2085
561 Ga0500651_0130954 3300053093 Bacteria 1517
562 Ga0500641_0011715 3300053096 Bacteria 3189
563 Ga0500556_0001092 3300053104 Bacteria 13635
564 Ga0500569_012538 3300053109 Bacteria 2053
565 Ga0500593_004470 3300053117 Bacteria 5418
566 Ga0500652_009533 3300053131 Bacteria 3289
567 Ga0500573_0018194 3300053140 Bacteria 4005
568 Ga0500577_0007334 3300053142 Bacteria 3085
569 Ga0466962_0006925 3300061719 Bacteria 5435
570 Ga0466962_0011869 3300061719 Bacteria 4194
571 Ga0466962_0016610 3300061719 Bacteria 3550
572 Ga0466962_0029009 3300061719 Bacteria 2649
573 Ga0466962_0037381 3300061719 Bacteria 2324
574 Ga0466962_0059534 3300061719 Bacteria 1823
575 Ga0466962_0113879 3300061719 Bacteria 1303
576 Ga0530510_0144281 3300061734 Bacteria 1756
577 2515494413 2515154088 Bacteria 5526283
578 2515719685 2515154129 Bacteria 5584369
579 2515756642 2515154137 Bacteria 5711575
580 2516084996 2515154202 Bacteria 5471270
581 2516088973 2515154203 Bacteria 5458536
582 2558905615 2558860112 Bacteria 9931328
583 2643825950 2643221561 Bacteria 4984412
584 2643891704 2643221576 Bacteria 5214352
585 2643960752 2643221590 Bacteria 5214697
586 2644035731 2643221604 Bacteria 5014917
587 2644089260 2643221615 Bacteria 5487866
588 2644101554 2643221617 Bacteria 5139111
589 2644115617 2643221620 Bacteria 5134593
590 2644319105 2643221657 Bacteria 5490246
591 2644531941 2643221696 Bacteria 5431823
592 2645721717 2643221961 Bacteria 3919167
593 2645724329 2643221962 Bacteria 3874254
594 2738868169 2738541305 Bacteria 4910150
595 2753265780 2751185782 Bacteria 11227053
596 2791910520 2791354901 Bacteria 8322202
597 2809196283 2808606439 Bacteria 5952208
598 2812333098 2811994874 Bacteria 5367947
599 2855387019 2855386786 Bacteria 4752232
600 2866618470 2866612099 Bacteria 7543886
601 2870787845 2870782633 Bacteria 9624083
602 2891970839 2891968417 Bacteria 5821697
603 2899367065 2899359706 Bacteria 10940472
604 Ga0373934_0017470
605 JGI24737J22298_10017841
606 JGI25406J46586_10008352
607 Ga0070658_10064987
608 Ga0070683_100176084
609 Ga0070690_100122042
610 Ga0070666_10015790
611 Ga0070680_100088945
612 Ga0070682_100086912
613 Ga0068868_100042816
614 Ga0070660_100236496
615 Ga0070689_100061590
616 Ga0070668_100000642
617 Ga0070669_100083113
618 Ga0070671_100060336
619 Ga0070673_100047724
620 Ga0070659_100168610
621 Ga0070659_100222040
622 Ga0070709_10001154
623 Ga0070714_100000570
624 Ga0070714_100001784
625 Ga0070714_100011233
626 Ga0070714_100091015
627 Ga0070714_100159875
628 Ga0070714_100322714
629 Ga0070714_100330345
630 Ga0070713_100003560
631 Ga0070713_100023693
632 Ga0070713_100081372
633 Ga0070713_100119003
634 Ga0070710_10002653
635 Ga0070710_10029794
636 Ga0070710_10107581
637 Ga0070711_100004061
638 Ga0070711_100085178
639 Ga0070708_100091777
640 Ga0070708_100267544
641 Ga0070708_100421555
642 Ga0070663_100013123
643 Ga0070663_100033267
644 Ga0070681_10189177
645 Ga0070685_10048892
646 Ga0070706_100049901
647 Ga0070706_100062479
648 Ga0070707_100002696
649 Ga0070707_100013400
650 Ga0070707_100014613
651 Ga0070707_100059471
652 Ga0070707_100177974
653 Ga0070698_100001196
654 Ga0070698_100014548
655 Ga0070698_100050051
656 Ga0070698_100070860
657 Ga0070699_100000764
658 Ga0070684_100203360
659 Ga0070697_100138843
660 Ga0070697_100158023
661 Ga0068853_100061775
662 Ga0068853_100092674
663 Ga0070695_100063880
664 Ga0070696_100025465
665 Ga0068855_100175203
666 Ga0070664_100138393
667 Ga0068854_100203239
668 Ga0068856_100109735
669 Ga0068856_100234807
670 Ga0068852_100003383
671 Ga0068864_100149947
672 Ga0068866_10149124
673 Ga0068863_100166412
674 Ga0068863_100184281
675 Ga0068858_100053683
676 Ga0068860_100000410
677 Ga0068860_100013888
678 Ga0081455_10001381
679 Ga0081539_10000086
680 Ga0081539_10018371
681 Ga0070717_10024099
682 Ga0070717_10038636
683 Ga0070717_10048705
684 Ga0070717_10196424
685 Ga0070717_10201151
686 Ga0070717_10254280
687 Ga0070717_10263107
688 Ga0075365_10016005
689 Ga0075365_10194380
690 Ga0075368_10003683
691 Ga0075368_10033200
692 Ga0075363_100009178
693 Ga0075364_10005745
694 Ga0075364_10014973
695 Ga0075364_10077354
696 Ga0070715_10022144
697 Ga0070716_100011939
698 Ga0070712_100041918
699 Ga0070712_100100400
700 Ga0075362_10026730
701 Ga0075370_10044218
702 Ga0075370_10090641
703 Ga0075428_100026332
704 Ga0075431_100012552
705 Ga0075431_100099704
706 Ga0075431_100291137
707 Ga0075434_100007704
708 Ga0075429_100009538
709 Ga0075436_100099122
710 Ga0105245_10007729
711 Ga0105245_10018045
712 Ga0105245_10322970
713 Ga0105247_10031518
714 Ga0105247_10058228
715 Ga0114129_10022901
716 Ga0114129_10408249
717 Ga0105243_10133037
718 Ga0105241_10093182
719 Ga0105241_10162075
720 Ga0105242_10044041
721 Ga0105248_10055560
722 Ga0105248_10133139
723 Ga0105237_10082723
724 Ga0105249_10133712
725 Ga0105239_10187614
726 Ga0105246_10016655
727 Ga0157342_1001929
728 Ga0157371_10053759
729 Ga0157369_10017060
730 Ga0157378_10059272
731 Ga0157372_10527673
732 Ga0163163_10013062
733 Ga0163163_10056165
734 Ga0163163_10294737
735 Ga0157380_10062938
736 Ga0157377_10037385
737 Ga0157379_10011411
738 Ga0207653_10006897
739 Ga0207692_10001536
740 Ga0207692_10024372
741 Ga0207692_10040373
742 Ga0207692_10095617
743 Ga0207647_10008349
744 Ga0207685_10049234
745 Ga0207699_10020410
746 Ga0207699_10026142
747 Ga0207699_10147636
748 Ga0207699_10176909
749 Ga0207643_10011348
750 Ga0207684_10004936
751 Ga0207684_10040924
752 Ga0207684_10213836
753 Ga0207654_10115046
754 Ga0207695_10251872
755 Ga0207663_10011400
756 Ga0207663_10060103
757 Ga0207663_10120280
758 Ga0207662_10004985
759 Ga0207657_10008019
760 Ga0207657_10168323
761 Ga0207657_10224944
762 Ga0207646_10005717
763 Ga0207646_10007233
764 Ga0207646_10060115
765 Ga0207646_10210352
766 Ga0207694_10054589
767 Ga0207694_10263037
768 Ga0207687_10014576
769 Ga0207700_10015661
770 Ga0207700_10017204
771 Ga0207700_10017422
772 Ga0207700_10062695
773 Ga0207700_10247630
774 Ga0207664_10005175
775 Ga0207664_10013984
776 Ga0207664_10017910
777 Ga0207664_10030189
778 Ga0207664_10039524
779 Ga0207664_10049227
780 Ga0207664_10066374
781 Ga0207664_10077639
782 Ga0207664_10096905
783 Ga0207664_10107765
784 Ga0207664_10135138
785 Ga0207664_10317230
786 Ga0207690_10060432
787 Ga0207669_10106632
788 Ga0207665_10017264
789 Ga0207665_10042519
790 Ga0207665_10142294
791 Ga0207689_10003922
792 Ga0207661_10280698
793 Ga0207679_10010916
794 Ga0207667_10017308
795 Ga0207667_10289225
796 Ga0207668_10002146
797 Ga0207668_10011928
798 Ga0207658_10187630
799 Ga0207677_10043228
800 Ga0207677_10076265
801 Ga0207703_10061619
802 Ga0207639_10047386
803 Ga0207639_10132672
804 Ga0207678_10005834
805 Ga0207678_10027630
806 Ga0207708_10014233
807 Ga0207708_10152449
808 Ga0207702_10072371
809 Ga0207676_10072382
810 Ga0207675_100016824
811 Ga0207675_100263342
812 Ga0207683_10003942
813 Ga0207698_10102741
814 Ga0209813_10021816
815 Ga0268266_10274768
816 Ga0268264_10000155
817 Ga0268264_10078407
818 Ga0268264_10167726
819 Ga0268264_10318702
820 Ga0265337_1000562
821 Ga0265326_10003273
822 Ga0265319_1003722
823 Ga0265334_10001608
824 Ga0265323_10005530
825 Ga0265336_10002575
826 Ga0265336_10004427
827 Ga0307517_10061247
828 Ga0307515_10000192
829 Ga0307515_10006596
830 Ga0307515_10023361
831 Ga0307515_10023982
832 Ga0265338_10001286
833 Ga0265338_10012392
834 Ga0307511_10000710
835 Ga0307512_10011862
836 Ga0307512_10025132
837 Ga0265320_10010522
838 Ga0265339_10021613
839 Ga0265316_10004139
840 Ga0307513_10007180
841 Ga0307509_10010476
842 Ga0265313_10033810
843 Ga0307508_10005172
844 Ga0307508_10016687
845 Ga0307508_10065510
846 Ga0265314_10020889
847 Ga0265342_10002027
848 Ga0307516_10001960
849 Ga0307516_10018627
850 Ga0307516_10087317
851 Ga0307413_10089426
852 Ga0307413_10123552
853 Ga0307414_10170901
854 Ga0307415_100001831
855 Ga0307415_100020508
856 Ga0307507_10014654
857 Ga0316212_1002246
858 Ga0373948_0003054
859 Ga0373950_0012198
860 Ga0373926_0002418
861 Ga0373926_0012522
862 Ga0373926_0042178
863 Ga0373928_0006227
864 Ga0373940_0001991
865 Ga0373944_0007878
866 Ga0373949_0002005
867 Ga0373951_0006183
868 Ga0373952_0004632
869 Ga0373923_0019756
870 Ga0373932_0009608
871 Ga0373936_0001965
872 Ga0373936_0004348
873 Ga0373936_0033028
874 Ga0373941_0007715
875 Ga0373945_0000063
876 Ga0373945_0005414
877 Ga0373953_0012778
878 Ga0373954_0004140
879 Ga0373956_0008351
880 Ga0373956_0028041
881 Ga0373957_0001854
882 Ga0373957_0009269
883 Ga0373957_0022048
884 Ga0373943_0006467
885 Ga0373946_0002355
886 Ga0373955_0004276
887 Ga0373955_0006902
888 Ga0373955_0011472
889 Ga0373955_0035511
890 Ga0373942_0000165
891 Ga0373962_0021876
892 Ga0373924_0006572
893 Ga0373924_0014245
894 Ga0373931_0213426
895 Ga0373935_0006081
896 Ga0373935_0010347
897 Ga0373935_0027858
898 Ga0373927_0001934
899 Ga0373933_0003594
900 Ga0373933_0005089
901 Ga0373933_0037092
902 Ga0373933_0052521
903 Ga0373933_0062470
904 Ga0373933_0124188
905 Ga0373947_0000011
906 Ga0373947_0000952
907 Ga0373947_0001869
908 Ga0373947_0058970
909 Ga0373937_0041749
910 Ga0373937_0047667
911 Ga0373937_0056951
912 Ga0373937_0084328
913 Ga0373937_0123759
914 Ga0372808_000114
915 Ga0372808_004314
916 Ga0373925_0000072
917 Ga0373925_0002590
918 Ga0373925_0007631
919 Ga0373925_0099768
920 Ga0395900_0023945
921 Ga0395900_0114385
922 Ga0395898_0096601
923 Ga0436364_0690278
924 Ga0436364_1422257
925 Ga0395901_0172038
926 Ga0395901_0338593
927 Ga0451793_0535357
928 Ga0451833_0215925
929 Ga0451843_1022262
930 Ga0451853_0390109
931 Ga0439431_0017807
932 Ga0439452_027813
933 Ga0466969_0010807
934 Ga0466972_0014962
935 Ga0466965_0017059
936 Ga0466965_0019370
937 Ga0466965_0035271
938 Ga0466965_0045200
939 Ga0466966_0001650
940 Ga0466966_0012869
941 Ga0466966_0021303
942 Ga0466966_0033145
943 Ga0466966_0040362
944 Ga0466966_0083926
945 Ga0466961_0004276
946 Ga0466961_0016413
947 Ga0466961_0021602
948 Ga0466961_0022184
949 Ga0466961_0039976
950 Ga0466961_0085174
951 Ga0466961_0105489
952 Ga0466963_0059827
953 Ga0466963_0074315
954 Ga0466963_0086500
955 Ga0466970_0023693
956 Ga0466970_0032971
957 Ga0466970_0055576
958 Ga0466970_0084852
959 Ga0466957_0090615
960 Ga0466960_0004437
961 Ga0466960_0006092
962 Ga0466959_0011146
963 Ga0466959_0011833
964 Ga0466958_0001690
965 Ga0466958_0008621
966 Ga0466958_0079511
967 Ga0466958_0111356
968 Ga0466958_0169354
969 Ga0466967_0002377
970 Ga0466967_0004350
971 Ga0466967_0010208
972 Ga0466967_0022161
973 Ga0466967_0054752
974 Ga0466967_0062607
975 Ga0466967_0157090
976 Ga0466967_0251545
977 Ga0495592_0000831
978 Ga0495592_0012576
979 Ga0495592_0036341
980 Ga0495592_0058949
981 Ga0495592_0066105
982 Ga0495603_0026491
983 Ga0495603_0075296
984 Ga0495603_0087384
985 Ga0495629_0011493
986 Ga0495629_0014137
987 Ga0495629_0111035
988 Ga0495641_0011080
989 Ga0495641_0013867
990 Ga0495651_0022366
991 Ga0495651_0025204
992 Ga0495651_0035323
993 Ga0495653_0007038
994 Ga0495653_0092287
995 Ga0495653_0110620
996 Ga0495580_0012950
997 Ga0495580_0028064
998 Ga0495582_0030572
999 Ga0495639_0029292
1000 Ga0495662_0023447
1001 Ga0495664_0000220
1002 Ga0495664_0017525
1003 Ga0495664_0035491
1004 Ga0495664_0045305
1005 Ga0495594_0087990
1006 Ga0495594_0095368
1007 Ga0495608_0006046
1008 Ga0495608_0009916
1009 Ga0495608_0022625
1010 Ga0495608_0118775
1011 Ga0495628_0035616
1012 Ga0495628_0070078
1013 Ga0495628_0079477
1014 Ga0495628_0105280
1015 Ga0495628_0172550
1016 Ga0495630_0007758
1017 Ga0495630_0012136
1018 Ga0495630_0054191
1019 Ga0495666_0005324
1020 Ga0495666_0036890
1021 Ga0495652_0017216
1022 Ga0495652_0033278
1023 Ga0495652_0138475
1024 Ga0495665_0007638
1025 Ga0495665_0017714
1026 Ga0495640_0017105
1027 Ga0495640_0033600
1028 Ga0495640_0045983
1029 Ga0495587_0010978
1030 Ga0495587_0012217
1031 Ga0495587_0024741
1032 Ga0495667_0006400
1033 Ga0495667_0007944
1034 Ga0495667_0008522
1035 Ga0495667_0040864
1036 Ga0495667_0043456
1037 Ga0495634_0026821
1038 Ga0495634_0049158
1039 Ga0495634_0067641
1040 Ga0495634_0080422
1041 Ga0495635_0002796
1042 Ga0495635_0006437
1043 Ga0495635_0027417
1044 Ga0495635_0056149
1045 Ga0495635_0069286
1046 Ga0495635_0080743
1047 Ga0495588_0050901
1048 Ga0495657_0007413
1049 Ga0495657_0020546
1050 Ga0495599_0015523
1051 Ga0495599_0033814
1052 Ga0495599_0034543
1053 Ga0495599_0103092
1054 Ga0495623_0022658
1055 Ga0495623_0045035
1056 Ga0495646_0021320
1057 Ga0495646_0080341
1058 Ga0495658_0050333
1059 Ga0495658_0051301
1060 Ga0495669_0045736
1061 Ga0495613_0018025
1062 Ga0495613_0043773
1063 Ga0495613_0140259
1064 Ga0495600_0003949
1065 Ga0495600_0023362
1066 Ga0495600_0036524
1067 Ga0495600_0044802
1068 Ga0495600_0124411
1069 Ga0495581_0017623
1070 Ga0495581_0019788
1071 Ga0495581_0068202
1072 Ga0495604_0021065
1073 Ga0495604_0021793
1074 Ga0495604_0025955
1075 Ga0495604_0027873
1076 Ga0495674_0003143
1077 Ga0495674_0030062
1078 Ga0495676_0017043
1079 Ga0495676_0158643
1080 Ga0495680_0004344
1081 Ga0495680_0007513
1082 Ga0495680_0016778
1083 Ga0495680_0044307
1084 Ga0495680_0050841
1085 Ga0495680_0154019
1086 Ga0495675_0001647
1087 Ga0495675_0020600
1088 Ga0495675_0034359
1089 Ga0495684_0010271
1090 Ga0495684_0016550
1091 Ga0495684_0031130
1092 Ga0495684_0076200
1093 Ga0495593_0012025
1094 Ga0495593_0037528
1095 Ga0495602_0007219
1096 Ga0495602_0130069
1097 Ga0495614_0011370
1098 Ga0496101_0027213
1099 Ga0496102_0000721
1100 Ga0496102_0080777
1101 Ga0496103_0018149
1102 Ga0496103_0036334
1103 Ga0496104_0029437
1104 Ga0496104_0077284
1105 Ga0496104_0177450
1106 Ga0496105_0016141
1107 Ga0496107_0077672
1108 Ga0496108_0000041
1109 Ga0496109_0103852
1110 Ga0496110_0020301
1111 Ga0496110_0031602
1112 Ga0496110_0204486
1113 Ga0496111_0003925
1114 Ga0496112_0102848
1115 Ga0496112_0174052
1116 Ga0496114_0016245
1117 Ga0496114_0041906
1118 Ga0496114_0164934
1119 Ga0496115_0044952
1120 Ga0501031_0015215
1121 Ga0501034_0205525
1122 Ga0501036_0069665
1123 Ga0501038_0000163
1124 Ga0501047_0005021
1125 Ga0501047_0255377
1126 Ga0501048_0000286
1127 Ga0501069_0116556
1128 Ga0501070_0007934
1129 Ga0501070_0035634
1130 Ga0501070_0052385
1131 Ga0501070_0104703
1132 Ga0501073_0137479
1133 Ga0501035_0010663
1134 Ga0501035_0092318
1135 Ga0501044_0037255
1136 nmdc:mga03683_35533_c1
1137 nmdc:mga03n38_12373_c1
1138 nmdc:mga03n38_35483_c1
1139 nmdc:mga00v17_125519_c1
1140 nmdc:mga00v17_29992_c1
1141 nmdc:mga00v17_6651_c1
1142 nmdc:mga0yw44_1287_c1
1143 nmdc:mga0yw44_196671_c1
1144 nmdc:mga0yw44_30520_c1
1145 nmdc:mga0yw44_54193_c1
1146 nmdc:mga07m45_87509_c1
1147 nmdc:mga05p37_191766_c1
1148 nmdc:mga09592_21042_c1
1149 nmdc:mga0qj67_227598_c1
1150 nmdc:mga06r32_1287_c1
1151 nmdc:mga0n895_39614_c1
1152 Ga0495601_0021951
1153 Ga0495612_0004755
1154 Ga0495612_0021123
1155 Ga0495612_0025030
1156 Ga0495595_0005316
1157 Ga0495595_0016070
1158 Ga0495619_0019370
1159 Ga0495619_0028982
1160 Ga0495619_0134716
1161 Ga0500644_0000067
1162 Ga0500644_0011522
1163 Ga0500644_0017444
1164 Ga0500651_0130954
1165 Ga0500641_0011715
1166 Ga0500556_0001092
1167 Ga0500569_012538
1168 Ga0500593_004470
1169 Ga0500652_009533
1170 Ga0500573_0018194
1171 Ga0500577_0007334
1172 Ga0466962_0006925
1173 Ga0466962_0011869
1174 Ga0466962_0016610
1175 Ga0466962_0029009
1176 Ga0466962_0037381
1177 Ga0466962_0059534
1178 Ga0466962_0113879
1179 Ga0530510_0144281
1180 2515494413
1181 2515719685
1182 2515756642
1183 2516084996
1184 2516088973
1185 2558905615
1186 2643825950
1187 2643891704
1188 2643960752
1189 2644035731
1190 2644089260
1191 2644101554
1192 2644115617
1193 2644319105
1194 2644531941
1195 2645721717
1196 2645724329
1197 2738868169
1198 2753265780
1199 2791910520
1200 2809196283
1201 2812333098
1202 2855387019
1203 2866618470
1204 2870787845
1205 2891970839
1206 2899367065

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

258

392

0.97

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

18

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfq-assembly1.cif.gz_C crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 0.9841 9 392
2rfq-assembly1.cif.gz_D crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 0.983 9 392
3afe-assembly1.cif.gz_C crystal structure of the hsaa monooxygenase from m.tuberculosis 0.9772 6 392
3afe-assembly1.cif.gz_B crystal structure of the hsaa monooxygenase from m.tuberculosis 0.977 6 392
2rfq-assembly1.cif.gz_B crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 0.9762 9 392
ID Description Score Start End Superfamily
3afeA01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 1 6 112 1.10.540.10
2rfqB01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9962 11 112 1.10.540.10
3afeA01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9817 6 112 1.10.540.10
3afeD02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9643 114 208 2.40.110.10
af_O05773_204_374_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9476 226 389 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A5D0PPE9-F1-model_v4 deleted 0.987 9 392
AF-A0A6L3VWV4-F1-model_v4 Flavin-dependent monooxygenase 0.9859 6 392 GO:0003995
GO:0005737
GO:0016712
GO:0033539
GO:0050660
AF-A0A6L3VWV4-F1-model_v4 Flavin-dependent monooxygenase 0.9809 6 392 GO:0003995
GO:0005737
GO:0016712
GO:0033539
GO:0050660
AF-A0A351A552-F1-model_v4 Flavin-dependent monooxygenase 0.9788 7 148 GO:0004497
GO:0016627
GO:0050660
AF-A0A537TNY1-F1-model_v4 Flavin-dependent monooxygenase 0.9737 21 392 GO:0003995
GO:0005737
GO:0016712
GO:0033539
GO:0050660

Map