F468297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 603 | 319 | 1206 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0017470|Ga0373934_0017470_392_1636 |
| Length | 414 |
| Sequence | MAASDQAGPGHQASRAQPSERAVIAGVTELLPTLRQRAQETEDARVVPAESVKSLEETGFFRLLQPRSAGGLEADPVTFFTAVRLIASACGSTGWVASVIGVHPWQLALFPQQAQDDVWGADPATRMSSSYAPTGKAKLVKGDGEVGGGGYTLNGRWSFSSGCDHASWVLLGGIVTDDEGKPVDFCTFLLPASDYTIDDVWDTVGLRGTGSNDIVVNNAFVPGHRALSFTGVTKIACPGHQVNTGALYRIPFGSIFSYAITTPIIGMATGAYAAHIDYQRQRVRASYVGQRSAEDPFAQVRIAEAAGLIDAAWLALERDMTELMDHARNDRKIPLPLRLRTRRDQVTGTGQAIRAVDLLFENSGGRALKLGTPIQRFWRDAHAGRVHAINDPERALSMFGRGEFGHDVPPDAMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 147 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 148 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 151 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 186 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 189 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 285 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 287 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 288 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 289 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 290 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 291 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 293 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 294 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 295 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 296 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 297 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 298 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 299 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 300 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 301 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 302 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 303 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 304 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 305 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 306 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 307 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 308 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 309 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 310 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 311 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 312 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 313 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 314 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 315 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 316 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 317 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 318 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 319 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.19 |
| Metatranscriptomes | 0.33 |
| Isolates | 4.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.64 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 83.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373934_0017470 | 3300035086 | Bacteria | 2738 |
| 2 | JGI24737J22298_10017841 | 3300001990 | Bacteria | 2283 |
| 3 | JGI25406J46586_10008352 | 3300003203 | Bacteria | 4693 |
| 4 | Ga0070658_10064987 | 3300005327 | Bacteria | 2977 |
| 5 | Ga0070683_100176084 | 3300005329 | Bacteria | 2030 |
| 6 | Ga0070690_100122042 | 3300005330 | Bacteria | 1750 |
| 7 | Ga0070666_10015790 | 3300005335 | Bacteria | 4822 |
| 8 | Ga0070680_100088945 | 3300005336 | Bacteria | 2555 |
| 9 | Ga0070682_100086912 | 3300005337 | Bacteria | 2037 |
| 10 | Ga0068868_100042816 | 3300005338 | Bacteria | 3536 |
| 11 | Ga0070660_100236496 | 3300005339 | Bacteria | 1487 |
| 12 | Ga0070689_100061590 | 3300005340 | Bacteria | 2919 |
| 13 | Ga0070668_100000642 | 3300005347 | Bacteria | 23581 |
| 14 | Ga0070669_100083113 | 3300005353 | Bacteria | 2388 |
| 15 | Ga0070671_100060336 | 3300005355 | Bacteria | 3158 |
| 16 | Ga0070673_100047724 | 3300005364 | Bacteria | 3334 |
| 17 | Ga0070659_100168610 | 3300005366 | Bacteria | 1792 |
| 18 | Ga0070659_100222040 | 3300005366 | Bacteria | 1560 |
| 19 | Ga0070709_10001154 | 3300005434 | Bacteria | 14514 |
| 20 | Ga0070714_100000570 | 3300005435 | Bacteria | 26508 |
| 21 | Ga0070714_100001784 | 3300005435 | Bacteria | 15666 |
| 22 | Ga0070714_100011233 | 3300005435 | Bacteria | 7100 |
| 23 | Ga0070714_100091015 | 3300005435 | Bacteria | 2672 |
| 24 | Ga0070714_100159875 | 3300005435 | Bacteria | 2037 |
| 25 | Ga0070714_100322714 | 3300005435 | Bacteria | 1444 |
| 26 | Ga0070714_100330345 | 3300005435 | Bacteria | 1428 |
| 27 | Ga0070713_100003560 | 3300005436 | Bacteria | 10287 |
| 28 | Ga0070713_100023693 | 3300005436 | Bacteria | 4769 |
| 29 | Ga0070713_100081372 | 3300005436 | Bacteria | 2763 |
| 30 | Ga0070713_100119003 | 3300005436 | Bacteria | 2313 |
| 31 | Ga0070710_10002653 | 3300005437 | Bacteria | 8498 |
| 32 | Ga0070710_10029794 | 3300005437 | Bacteria | 2931 |
| 33 | Ga0070710_10107581 | 3300005437 | Bacteria | 1670 |
| 34 | Ga0070711_100004061 | 3300005439 | Bacteria | 8602 |
| 35 | Ga0070711_100085178 | 3300005439 | Bacteria | 2263 |
| 36 | Ga0070708_100091777 | 3300005445 | Bacteria | 2766 |
| 37 | Ga0070708_100267544 | 3300005445 | Bacteria | 1607 |
| 38 | Ga0070708_100421555 | 3300005445 | Bacteria | 1259 |
| 39 | Ga0070663_100013123 | 3300005455 | Bacteria | 5267 |
| 40 | Ga0070663_100033267 | 3300005455 | Bacteria | 3560 |
| 41 | Ga0070681_10189177 | 3300005458 | Bacteria | 1978 |
| 42 | Ga0070685_10048892 | 3300005466 | Bacteria | 2438 |
| 43 | Ga0070706_100049901 | 3300005467 | Bacteria | 3861 |
| 44 | Ga0070706_100062479 | 3300005467 | Bacteria | 3441 |
| 45 | Ga0070707_100002696 | 3300005468 | Bacteria | 16886 |
| 46 | Ga0070707_100013400 | 3300005468 | Bacteria | 7668 |
| 47 | Ga0070707_100014613 | 3300005468 | Bacteria | 7361 |
| 48 | Ga0070707_100059471 | 3300005468 | Bacteria | 3666 |
| 49 | Ga0070707_100177974 | 3300005468 | Bacteria | 2073 |
| 50 | Ga0070698_100001196 | 3300005471 | Bacteria | 28804 |
| 51 | Ga0070698_100014548 | 3300005471 | Bacteria | 8307 |
| 52 | Ga0070698_100050051 | 3300005471 | Bacteria | 4262 |
| 53 | Ga0070698_100070860 | 3300005471 | Bacteria | 3497 |
| 54 | Ga0070699_100000764 | 3300005518 | Bacteria | 29736 |
| 55 | Ga0070684_100203360 | 3300005535 | Bacteria | 1804 |
| 56 | Ga0070697_100138843 | 3300005536 | Bacteria | 2043 |
| 57 | Ga0070697_100158023 | 3300005536 | Bacteria | 1914 |
| 58 | Ga0068853_100061775 | 3300005539 | Bacteria | 3241 |
| 59 | Ga0068853_100092674 | 3300005539 | Bacteria | 2658 |
| 60 | Ga0070695_100063880 | 3300005545 | Bacteria | 2394 |
| 61 | Ga0070696_100025465 | 3300005546 | Bacteria | 4023 |
| 62 | Ga0068855_100175203 | 3300005563 | Bacteria | 2427 |
| 63 | Ga0070664_100138393 | 3300005564 | Bacteria | 2142 |
| 64 | Ga0068854_100203239 | 3300005578 | Bacteria | 1558 |
| 65 | Ga0068856_100109735 | 3300005614 | Bacteria | 2756 |
| 66 | Ga0068856_100234807 | 3300005614 | Bacteria | 1849 |
| 67 | Ga0068852_100003383 | 3300005616 | Bacteria | 11137 |
| 68 | Ga0068864_100149947 | 3300005618 | Bacteria | 2111 |
| 69 | Ga0068866_10149124 | 3300005718 | Bacteria | 1352 |
| 70 | Ga0068863_100166412 | 3300005841 | Bacteria | 2114 |
| 71 | Ga0068863_100184281 | 3300005841 | Bacteria | 2004 |
| 72 | Ga0068858_100053683 | 3300005842 | Bacteria | 3728 |
| 73 | Ga0068860_100000410 | 3300005843 | Bacteria | 55852 |
| 74 | Ga0068860_100013888 | 3300005843 | Bacteria | 7896 |
| 75 | Ga0081455_10001381 | 3300005937 | Bacteria | 30015 |
| 76 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 77 | Ga0081539_10018371 | 3300005985 | Bacteria | 4856 |
| 78 | Ga0070717_10024099 | 3300006028 | Bacteria | 4829 |
| 79 | Ga0070717_10038636 | 3300006028 | Bacteria | 3880 |
| 80 | Ga0070717_10048705 | 3300006028 | Bacteria | 3477 |
| 81 | Ga0070717_10196424 | 3300006028 | Bacteria | 1765 |
| 82 | Ga0070717_10201151 | 3300006028 | Bacteria | 1745 |
| 83 | Ga0070717_10254280 | 3300006028 | Bacteria | 1553 |
| 84 | Ga0070717_10263107 | 3300006028 | Bacteria | 1526 |
| 85 | Ga0075365_10016005 | 3300006038 | Bacteria | 4549 |
| 86 | Ga0075365_10194380 | 3300006038 | Bacteria | 1420 |
| 87 | Ga0075368_10003683 | 3300006042 | Bacteria | 5145 |
| 88 | Ga0075368_10033200 | 3300006042 | Bacteria | 2007 |
| 89 | Ga0075363_100009178 | 3300006048 | Bacteria | 4644 |
| 90 | Ga0075364_10005745 | 3300006051 | Bacteria | 7234 |
| 91 | Ga0075364_10014973 | 3300006051 | Bacteria | 4801 |
| 92 | Ga0075364_10077354 | 3300006051 | Bacteria | 2196 |
| 93 | Ga0070715_10022144 | 3300006163 | Bacteria | 2474 |
| 94 | Ga0070716_100011939 | 3300006173 | Bacteria | 4388 |
| 95 | Ga0070712_100041918 | 3300006175 | Bacteria | 3145 |
| 96 | Ga0070712_100100400 | 3300006175 | Bacteria | 2138 |
| 97 | Ga0075362_10026730 | 3300006177 | Bacteria | 2467 |
| 98 | Ga0075370_10044218 | 3300006353 | Bacteria | 2518 |
| 99 | Ga0075370_10090641 | 3300006353 | Bacteria | 1763 |
| 100 | Ga0075428_100026332 | 3300006844 | Bacteria | 6438 |
| 101 | Ga0075431_100012552 | 3300006847 | Bacteria | 8551 |
| 102 | Ga0075431_100099704 | 3300006847 | Bacteria | 2997 |
| 103 | Ga0075431_100291137 | 3300006847 | Bacteria | 1652 |
| 104 | Ga0075434_100007704 | 3300006871 | Bacteria | 9967 |
| 105 | Ga0075429_100009538 | 3300006880 | Bacteria | 8419 |
| 106 | Ga0075436_100099122 | 3300006914 | Bacteria | 2028 |
| 107 | Ga0105245_10007729 | 3300009098 | Bacteria | 9417 |
| 108 | Ga0105245_10018045 | 3300009098 | Bacteria | 6165 |
| 109 | Ga0105245_10322970 | 3300009098 | Bacteria | 1521 |
| 110 | Ga0105247_10031518 | 3300009101 | Bacteria | 3218 |
| 111 | Ga0105247_10058228 | 3300009101 | Bacteria | 2390 |
| 112 | Ga0114129_10022901 | 3300009147 | Bacteria | 8860 |
| 113 | Ga0114129_10408249 | 3300009147 | Bacteria | 1789 |
| 114 | Ga0105243_10133037 | 3300009148 | Bacteria | 2113 |
| 115 | Ga0105241_10093182 | 3300009174 | Bacteria | 2380 |
| 116 | Ga0105241_10162075 | 3300009174 | Bacteria | 1839 |
| 117 | Ga0105242_10044041 | 3300009176 | Bacteria | 3612 |
| 118 | Ga0105248_10055560 | 3300009177 | Bacteria | 4441 |
| 119 | Ga0105248_10133139 | 3300009177 | Bacteria | 2805 |
| 120 | Ga0105237_10082723 | 3300009545 | Bacteria | 3201 |
| 121 | Ga0105249_10133712 | 3300009553 | Bacteria | 2371 |
| 122 | Ga0105239_10187614 | 3300010375 | Bacteria | 2314 |
| 123 | Ga0105246_10016655 | 3300011119 | Bacteria | 4657 |
| 124 | Ga0157342_1001929 | 3300012507 | Bacteria | 1616 |
| 125 | Ga0157371_10053759 | 3300013102 | Bacteria | 2860 |
| 126 | Ga0157369_10017060 | 3300013105 | Bacteria | 8158 |
| 127 | Ga0157378_10059272 | 3300013297 | Bacteria | 3415 |
| 128 | Ga0157372_10527673 | 3300013307 | Bacteria | 1376 |
| 129 | Ga0163163_10013062 | 3300014325 | Bacteria | 7585 |
| 130 | Ga0163163_10056165 | 3300014325 | Bacteria | 3891 |
| 131 | Ga0163163_10294737 | 3300014325 | Bacteria | 1674 |
| 132 | Ga0157380_10062938 | 3300014326 | Bacteria | 2974 |
| 133 | Ga0157377_10037385 | 3300014745 | Bacteria | 2674 |
| 134 | Ga0157379_10011411 | 3300014968 | Bacteria | 7754 |
| 135 | Ga0207653_10006897 | 3300025885 | Bacteria | 3543 |
| 136 | Ga0207692_10001536 | 3300025898 | Bacteria | 8669 |
| 137 | Ga0207692_10024372 | 3300025898 | Bacteria | 2812 |
| 138 | Ga0207692_10040373 | 3300025898 | Bacteria | 2302 |
| 139 | Ga0207692_10095617 | 3300025898 | Bacteria | 1620 |
| 140 | Ga0207647_10008349 | 3300025904 | Bacteria | 7428 |
| 141 | Ga0207685_10049234 | 3300025905 | Bacteria | 1618 |
| 142 | Ga0207699_10020410 | 3300025906 | Bacteria | 3551 |
| 143 | Ga0207699_10026142 | 3300025906 | Bacteria | 3213 |
| 144 | Ga0207699_10147636 | 3300025906 | Bacteria | 1552 |
| 145 | Ga0207699_10176909 | 3300025906 | Bacteria | 1432 |
| 146 | Ga0207643_10011348 | 3300025908 | Bacteria | 4811 |
| 147 | Ga0207684_10004936 | 3300025910 | Bacteria | 12444 |
| 148 | Ga0207684_10040924 | 3300025910 | Bacteria | 3929 |
| 149 | Ga0207684_10213836 | 3300025910 | Bacteria | 1663 |
| 150 | Ga0207654_10115046 | 3300025911 | Bacteria | 1680 |
| 151 | Ga0207695_10251872 | 3300025913 | Bacteria | 1665 |
| 152 | Ga0207663_10011400 | 3300025916 | Bacteria | 4773 |
| 153 | Ga0207663_10060103 | 3300025916 | Bacteria | 2407 |
| 154 | Ga0207663_10120280 | 3300025916 | Bacteria | 1797 |
| 155 | Ga0207662_10004985 | 3300025918 | Bacteria | 7026 |
| 156 | Ga0207657_10008019 | 3300025919 | Bacteria | 10769 |
| 157 | Ga0207657_10168323 | 3300025919 | Bacteria | 1777 |
| 158 | Ga0207657_10224944 | 3300025919 | Bacteria | 1502 |
| 159 | Ga0207646_10005717 | 3300025922 | Bacteria | 13042 |
| 160 | Ga0207646_10007233 | 3300025922 | Bacteria | 11321 |
| 161 | Ga0207646_10060115 | 3300025922 | Bacteria | 3394 |
| 162 | Ga0207646_10210352 | 3300025922 | Bacteria | 1757 |
| 163 | Ga0207694_10054589 | 3300025924 | Bacteria | 3100 |
| 164 | Ga0207694_10263037 | 3300025924 | Bacteria | 1413 |
| 165 | Ga0207687_10014576 | 3300025927 | Bacteria | 5145 |
| 166 | Ga0207700_10015661 | 3300025928 | Bacteria | 5011 |
| 167 | Ga0207700_10017204 | 3300025928 | Bacteria | 4824 |
| 168 | Ga0207700_10017422 | 3300025928 | Bacteria | 4798 |
| 169 | Ga0207700_10062695 | 3300025928 | Bacteria | 2824 |
| 170 | Ga0207700_10247630 | 3300025928 | Bacteria | 1521 |
| 171 | Ga0207664_10005175 | 3300025929 | Bacteria | 8889 |
| 172 | Ga0207664_10013984 | 3300025929 | Bacteria | 5785 |
| 173 | Ga0207664_10017910 | 3300025929 | Bacteria | 5204 |
| 174 | Ga0207664_10030189 | 3300025929 | Bacteria | 4138 |
| 175 | Ga0207664_10039524 | 3300025929 | Bacteria | 3663 |
| 176 | Ga0207664_10049227 | 3300025929 | Bacteria | 3317 |
| 177 | Ga0207664_10066374 | 3300025929 | Bacteria | 2892 |
| 178 | Ga0207664_10077639 | 3300025929 | Bacteria | 2691 |
| 179 | Ga0207664_10096905 | 3300025929 | Bacteria | 2429 |
| 180 | Ga0207664_10107765 | 3300025929 | Bacteria | 2312 |
| 181 | Ga0207664_10135138 | 3300025929 | Bacteria | 2080 |
| 182 | Ga0207664_10317230 | 3300025929 | Bacteria | 1375 |
| 183 | Ga0207690_10060432 | 3300025932 | Bacteria | 2572 |
| 184 | Ga0207669_10106632 | 3300025937 | Bacteria | 1867 |
| 185 | Ga0207665_10017264 | 3300025939 | Bacteria | 4742 |
| 186 | Ga0207665_10042519 | 3300025939 | Bacteria | 3037 |
| 187 | Ga0207665_10142294 | 3300025939 | Bacteria | 1712 |
| 188 | Ga0207689_10003922 | 3300025942 | Bacteria | 13542 |
| 189 | Ga0207661_10280698 | 3300025944 | Bacteria | 1489 |
| 190 | Ga0207679_10010916 | 3300025945 | Bacteria | 5859 |
| 191 | Ga0207667_10017308 | 3300025949 | Bacteria | 8117 |
| 192 | Ga0207667_10289225 | 3300025949 | Bacteria | 1674 |
| 193 | Ga0207668_10002146 | 3300025972 | Bacteria | 11505 |
| 194 | Ga0207668_10011928 | 3300025972 | Bacteria | 5302 |
| 195 | Ga0207658_10187630 | 3300025986 | Bacteria | 1716 |
| 196 | Ga0207677_10043228 | 3300026023 | Bacteria | 2994 |
| 197 | Ga0207677_10076265 | 3300026023 | Bacteria | 2386 |
| 198 | Ga0207703_10061619 | 3300026035 | Bacteria | 3071 |
| 199 | Ga0207639_10047386 | 3300026041 | Bacteria | 3248 |
| 200 | Ga0207639_10132672 | 3300026041 | Bacteria | 2064 |
| 201 | Ga0207678_10005834 | 3300026067 | Bacteria | 10977 |
| 202 | Ga0207678_10027630 | 3300026067 | Bacteria | 4952 |
| 203 | Ga0207708_10014233 | 3300026075 | Bacteria | 5950 |
| 204 | Ga0207708_10152449 | 3300026075 | Bacteria | 1820 |
| 205 | Ga0207702_10072371 | 3300026078 | Bacteria | 2971 |
| 206 | Ga0207676_10072382 | 3300026095 | Bacteria | 2771 |
| 207 | Ga0207675_100016824 | 3300026118 | Bacteria | 6832 |
| 208 | Ga0207675_100263342 | 3300026118 | Bacteria | 1671 |
| 209 | Ga0207683_10003942 | 3300026121 | Bacteria | 12878 |
| 210 | Ga0207698_10102741 | 3300026142 | Bacteria | 2373 |
| 211 | Ga0209813_10021816 | 3300027866 | Bacteria | 1804 |
| 212 | Ga0268266_10274768 | 3300028379 | Bacteria | 1565 |
| 213 | Ga0268264_10000155 | 3300028381 | Bacteria | 156029 |
| 214 | Ga0268264_10078407 | 3300028381 | Bacteria | 2817 |
| 215 | Ga0268264_10167726 | 3300028381 | Bacteria | 1983 |
| 216 | Ga0268264_10318702 | 3300028381 | Bacteria | 1469 |
| 217 | Ga0265337_1000562 | 3300028556 | Bacteria | 19510 |
| 218 | Ga0265326_10003273 | 3300028558 | Bacteria | 5338 |
| 219 | Ga0265319_1003722 | 3300028563 | Bacteria | 7836 |
| 220 | Ga0265334_10001608 | 3300028573 | Bacteria | 10847 |
| 221 | Ga0265323_10005530 | 3300028653 | Bacteria | 5366 |
| 222 | Ga0265336_10002575 | 3300028666 | Bacteria | 7412 |
| 223 | Ga0265336_10004427 | 3300028666 | Bacteria | 5315 |
| 224 | Ga0307517_10061247 | 3300028786 | Bacteria | 3565 |
| 225 | Ga0307515_10000192 | 3300028794 | Bacteria | 149030 |
| 226 | Ga0307515_10006596 | 3300028794 | Bacteria | 23161 |
| 227 | Ga0307515_10023361 | 3300028794 | Bacteria | 10839 |
| 228 | Ga0307515_10023982 | 3300028794 | Bacteria | 10656 |
| 229 | Ga0265338_10001286 | 3300028800 | Bacteria | 41166 |
| 230 | Ga0265338_10012392 | 3300028800 | Bacteria | 9721 |
| 231 | Ga0307511_10000710 | 3300030521 | Bacteria | 35487 |
| 232 | Ga0307512_10011862 | 3300030522 | Bacteria | 8235 |
| 233 | Ga0307512_10025132 | 3300030522 | Bacteria | 5284 |
| 234 | Ga0265320_10010522 | 3300031240 | Bacteria | 5505 |
| 235 | Ga0265339_10021613 | 3300031249 | Bacteria | 3739 |
| 236 | Ga0265316_10004139 | 3300031344 | Bacteria | 14517 |
| 237 | Ga0307513_10007180 | 3300031456 | Bacteria | 14468 |
| 238 | Ga0307509_10010476 | 3300031507 | Bacteria | 11349 |
| 239 | Ga0265313_10033810 | 3300031595 | Bacteria | 2594 |
| 240 | Ga0307508_10005172 | 3300031616 | Bacteria | 12489 |
| 241 | Ga0307508_10016687 | 3300031616 | Bacteria | 6682 |
| 242 | Ga0307508_10065510 | 3300031616 | Bacteria | 3201 |
| 243 | Ga0265314_10020889 | 3300031711 | Bacteria | 5047 |
| 244 | Ga0265342_10002027 | 3300031712 | Bacteria | 18022 |
| 245 | Ga0307516_10001960 | 3300031730 | Bacteria | 28187 |
| 246 | Ga0307516_10018627 | 3300031730 | Bacteria | 7210 |
| 247 | Ga0307516_10087317 | 3300031730 | Bacteria | 2953 |
| 248 | Ga0307413_10089426 | 3300031824 | Bacteria | 2001 |
| 249 | Ga0307413_10123552 | 3300031824 | Bacteria | 1758 |
| 250 | Ga0307414_10170901 | 3300032004 | Bacteria | 1738 |
| 251 | Ga0307415_100001831 | 3300032126 | Bacteria | 10426 |
| 252 | Ga0307415_100020508 | 3300032126 | Bacteria | 4038 |
| 253 | Ga0307507_10014654 | 3300033179 | Bacteria | 9324 |
| 254 | Ga0316212_1002246 | 3300033547 | Bacteria | 2743 |
| 255 | Ga0373948_0003054 | 3300034817 | Bacteria | 2537 |
| 256 | Ga0373950_0012198 | 3300034818 | Bacteria | 1416 |
| 257 | Ga0373926_0002418 | 3300035083 | Bacteria | 5916 |
| 258 | Ga0373926_0012522 | 3300035083 | Bacteria | 2868 |
| 259 | Ga0373926_0042178 | 3300035083 | Bacteria | 1631 |
| 260 | Ga0373928_0006227 | 3300035084 | Bacteria | 2292 |
| 261 | Ga0373940_0001991 | 3300035088 | Bacteria | 3865 |
| 262 | Ga0373944_0007878 | 3300035089 | Bacteria | 2867 |
| 263 | Ga0373949_0002005 | 3300035090 | Bacteria | 5435 |
| 264 | Ga0373951_0006183 | 3300035091 | Bacteria | 2747 |
| 265 | Ga0373952_0004632 | 3300035092 | Bacteria | 2498 |
| 266 | Ga0373923_0019756 | 3300035111 | Bacteria | 2611 |
| 267 | Ga0373932_0009608 | 3300035112 | Bacteria | 2327 |
| 268 | Ga0373936_0001965 | 3300035113 | Bacteria | 7603 |
| 269 | Ga0373936_0004348 | 3300035113 | Bacteria | 5356 |
| 270 | Ga0373936_0033028 | 3300035113 | Bacteria | 2049 |
| 271 | Ga0373941_0007715 | 3300035115 | Bacteria | 2644 |
| 272 | Ga0373945_0000063 | 3300035116 | Bacteria | 23921 |
| 273 | Ga0373945_0005414 | 3300035116 | Bacteria | 4084 |
| 274 | Ga0373953_0012778 | 3300035117 | Bacteria | 2981 |
| 275 | Ga0373954_0004140 | 3300035118 | Bacteria | 6212 |
| 276 | Ga0373956_0008351 | 3300035119 | Bacteria | 4189 |
| 277 | Ga0373956_0028041 | 3300035119 | Bacteria | 2448 |
| 278 | Ga0373957_0001854 | 3300035120 | Bacteria | 5858 |
| 279 | Ga0373957_0009269 | 3300035120 | Bacteria | 3216 |
| 280 | Ga0373957_0022048 | 3300035120 | Bacteria | 2266 |
| 281 | Ga0373943_0006467 | 3300035170 | Bacteria | 5262 |
| 282 | Ga0373946_0002355 | 3300035171 | Bacteria | 6680 |
| 283 | Ga0373955_0004276 | 3300035172 | Bacteria | 6310 |
| 284 | Ga0373955_0006902 | 3300035172 | Bacteria | 5191 |
| 285 | Ga0373955_0011472 | 3300035172 | Bacteria | 4225 |
| 286 | Ga0373955_0035511 | 3300035172 | Bacteria | 2640 |
| 287 | Ga0373942_0000165 | 3300035207 | Bacteria | 16207 |
| 288 | Ga0373962_0021876 | 3300035242 | Bacteria | 1691 |
| 289 | Ga0373924_0006572 | 3300035410 | Bacteria | 4168 |
| 290 | Ga0373924_0014245 | 3300035410 | Bacteria | 3002 |
| 291 | Ga0373931_0213426 | 3300035691 | Bacteria | 1159 |
| 292 | Ga0373935_0006081 | 3300035692 | Bacteria | 7177 |
| 293 | Ga0373935_0010347 | 3300035692 | Bacteria | 5595 |
| 294 | Ga0373935_0027858 | 3300035692 | Bacteria | 3491 |
| 295 | Ga0373927_0001934 | 3300035695 | Bacteria | 15296 |
| 296 | Ga0373933_0003594 | 3300035724 | Bacteria | 8612 |
| 297 | Ga0373933_0005089 | 3300035724 | Bacteria | 7169 |
| 298 | Ga0373933_0037092 | 3300035724 | Bacteria | 2858 |
| 299 | Ga0373933_0052521 | 3300035724 | Bacteria | 2439 |
| 300 | Ga0373933_0062470 | 3300035724 | Bacteria | 2249 |
| 301 | Ga0373933_0124188 | 3300035724 | Bacteria | 1618 |
| 302 | Ga0373947_0000011 | 3300035725 | Bacteria | 160778 |
| 303 | Ga0373947_0000952 | 3300035725 | Bacteria | 17638 |
| 304 | Ga0373947_0001869 | 3300035725 | Bacteria | 12839 |
| 305 | Ga0373947_0058970 | 3300035725 | Bacteria | 2326 |
| 306 | Ga0373937_0041749 | 3300036401 | Bacteria | 4184 |
| 307 | Ga0373937_0047667 | 3300036401 | Bacteria | 3922 |
| 308 | Ga0373937_0056951 | 3300036401 | Bacteria | 3589 |
| 309 | Ga0373937_0084328 | 3300036401 | Bacteria | 2939 |
| 310 | Ga0373937_0123759 | 3300036401 | Bacteria | 2411 |
| 311 | Ga0372808_000114 | 3300036459 | Bacteria | 4202 |
| 312 | Ga0372808_004314 | 3300036459 | Bacteria | 1807 |
| 313 | Ga0373925_0000072 | 3300037068 | Bacteria | 106707 |
| 314 | Ga0373925_0002590 | 3300037068 | Bacteria | 14378 |
| 315 | Ga0373925_0007631 | 3300037068 | Bacteria | 7878 |
| 316 | Ga0373925_0099768 | 3300037068 | Bacteria | 2230 |
| 317 | Ga0395900_0023945 | 3300037418 | Bacteria | 6247 |
| 318 | Ga0395900_0114385 | 3300037418 | Bacteria | 2769 |
| 319 | Ga0395898_0096601 | 3300037466 | Bacteria | 2838 |
| 320 | Ga0436364_0690278 | 3300037853 | Bacteria | 5198 |
| 321 | Ga0436364_1422257 | 3300037853 | Bacteria | 1361 |
| 322 | Ga0395901_0172038 | 3300038443 | Bacteria | 2272 |
| 323 | Ga0395901_0338593 | 3300038443 | Bacteria | 1554 |
| 324 | Ga0451793_0535357 | 3300041452 | Bacteria | 7523 |
| 325 | Ga0451833_0215925 | 3300041491 | Bacteria | 6583 |
| 326 | Ga0451843_1022262 | 3300041509 | Bacteria | 2393 |
| 327 | Ga0451853_0390109 | 3300041512 | Bacteria | 9634 |
| 328 | Ga0439431_0017807 | 3300041997 | Bacteria | 1674 |
| 329 | Ga0439452_027813 | 3300042010 | Bacteria | 1417 |
| 330 | Ga0466969_0010807 | 3300044656 | Bacteria | 4836 |
| 331 | Ga0466972_0014962 | 3300044658 | Bacteria | 3881 |
| 332 | Ga0466965_0017059 | 3300044683 | Bacteria | 3466 |
| 333 | Ga0466965_0019370 | 3300044683 | Bacteria | 3267 |
| 334 | Ga0466965_0035271 | 3300044683 | Bacteria | 2450 |
| 335 | Ga0466965_0045200 | 3300044683 | Bacteria | 2177 |
| 336 | Ga0466966_0001650 | 3300044684 | Bacteria | 14382 |
| 337 | Ga0466966_0012869 | 3300044684 | Bacteria | 5541 |
| 338 | Ga0466966_0021303 | 3300044684 | Bacteria | 4257 |
| 339 | Ga0466966_0033145 | 3300044684 | Bacteria | 3345 |
| 340 | Ga0466966_0040362 | 3300044684 | Bacteria | 3004 |
| 341 | Ga0466966_0083926 | 3300044684 | Bacteria | 1982 |
| 342 | Ga0466961_0004276 | 3300044693 | Bacteria | 8940 |
| 343 | Ga0466961_0016413 | 3300044693 | Bacteria | 4758 |
| 344 | Ga0466961_0021602 | 3300044693 | Bacteria | 4141 |
| 345 | Ga0466961_0022184 | 3300044693 | Bacteria | 4084 |
| 346 | Ga0466961_0039976 | 3300044693 | Bacteria | 3006 |
| 347 | Ga0466961_0085174 | 3300044693 | Bacteria | 1999 |
| 348 | Ga0466961_0105489 | 3300044693 | Bacteria | 1774 |
| 349 | Ga0466963_0059827 | 3300044694 | Bacteria | 2543 |
| 350 | Ga0466963_0074315 | 3300044694 | Bacteria | 2292 |
| 351 | Ga0466963_0086500 | 3300044694 | Bacteria | 2130 |
| 352 | Ga0466970_0023693 | 3300044765 | Bacteria | 3208 |
| 353 | Ga0466970_0032971 | 3300044765 | Bacteria | 2737 |
| 354 | Ga0466970_0055576 | 3300044765 | Bacteria | 2114 |
| 355 | Ga0466970_0084852 | 3300044765 | Bacteria | 1715 |
| 356 | Ga0466957_0090615 | 3300044842 | Bacteria | 1915 |
| 357 | Ga0466960_0004437 | 3300044901 | Bacteria | 5484 |
| 358 | Ga0466960_0006092 | 3300044901 | Bacteria | 4822 |
| 359 | Ga0466959_0011146 | 3300045049 | Bacteria | 6452 |
| 360 | Ga0466959_0011833 | 3300045049 | Bacteria | 6282 |
| 361 | Ga0466958_0001690 | 3300045836 | Bacteria | 10637 |
| 362 | Ga0466958_0008621 | 3300045836 | Bacteria | 5659 |
| 363 | Ga0466958_0079511 | 3300045836 | Bacteria | 2016 |
| 364 | Ga0466958_0111356 | 3300045836 | Bacteria | 1709 |
| 365 | Ga0466958_0169354 | 3300045836 | Bacteria | 1383 |
| 366 | Ga0466967_0002377 | 3300045976 | Bacteria | 11654 |
| 367 | Ga0466967_0004350 | 3300045976 | Bacteria | 9535 |
| 368 | Ga0466967_0010208 | 3300045976 | Bacteria | 7027 |
| 369 | Ga0466967_0022161 | 3300045976 | Bacteria | 5176 |
| 370 | Ga0466967_0054752 | 3300045976 | Bacteria | 3513 |
| 371 | Ga0466967_0062607 | 3300045976 | Bacteria | 3303 |
| 372 | Ga0466967_0157090 | 3300045976 | Bacteria | 2131 |
| 373 | Ga0466967_0251545 | 3300045976 | Bacteria | 1688 |
| 374 | Ga0495592_0000831 | 3300046454 | Bacteria | 21457 |
| 375 | Ga0495592_0012576 | 3300046454 | Bacteria | 6433 |
| 376 | Ga0495592_0036341 | 3300046454 | Bacteria | 3710 |
| 377 | Ga0495592_0058949 | 3300046454 | Bacteria | 2829 |
| 378 | Ga0495592_0066105 | 3300046454 | Bacteria | 2646 |
| 379 | Ga0495603_0026491 | 3300046455 | Bacteria | 3502 |
| 380 | Ga0495603_0075296 | 3300046455 | Bacteria | 1981 |
| 381 | Ga0495603_0087384 | 3300046455 | Bacteria | 1824 |
| 382 | Ga0495629_0011493 | 3300046459 | Bacteria | 6431 |
| 383 | Ga0495629_0014137 | 3300046459 | Bacteria | 5750 |
| 384 | Ga0495629_0111035 | 3300046459 | Bacteria | 1911 |
| 385 | Ga0495641_0011080 | 3300046461 | Bacteria | 5163 |
| 386 | Ga0495641_0013867 | 3300046461 | Bacteria | 4393 |
| 387 | Ga0495651_0022366 | 3300046462 | Bacteria | 4914 |
| 388 | Ga0495651_0025204 | 3300046462 | Bacteria | 4628 |
| 389 | Ga0495651_0035323 | 3300046462 | Bacteria | 3892 |
| 390 | Ga0495653_0007038 | 3300046463 | Bacteria | 9230 |
| 391 | Ga0495653_0092287 | 3300046463 | Bacteria | 2211 |
| 392 | Ga0495653_0110620 | 3300046463 | Bacteria | 1974 |
| 393 | Ga0495580_0012950 | 3300046472 | Bacteria | 6385 |
| 394 | Ga0495580_0028064 | 3300046472 | Bacteria | 4093 |
| 395 | Ga0495582_0030572 | 3300046473 | Bacteria | 2956 |
| 396 | Ga0495639_0029292 | 3300046475 | Bacteria | 2443 |
| 397 | Ga0495662_0023447 | 3300046476 | Bacteria | 2980 |
| 398 | Ga0495664_0000220 | 3300046477 | Bacteria | 27274 |
| 399 | Ga0495664_0017525 | 3300046477 | Bacteria | 4095 |
| 400 | Ga0495664_0035491 | 3300046477 | Bacteria | 2936 |
| 401 | Ga0495664_0045305 | 3300046477 | Bacteria | 2608 |
| 402 | Ga0495594_0087990 | 3300046499 | Bacteria | 1739 |
| 403 | Ga0495594_0095368 | 3300046499 | Bacteria | 1670 |
| 404 | Ga0495608_0006046 | 3300046511 | Bacteria | 8603 |
| 405 | Ga0495608_0009916 | 3300046511 | Bacteria | 6650 |
| 406 | Ga0495608_0022625 | 3300046511 | Bacteria | 4310 |
| 407 | Ga0495608_0118775 | 3300046511 | Bacteria | 1696 |
| 408 | Ga0495628_0035616 | 3300046516 | Bacteria | 3998 |
| 409 | Ga0495628_0070078 | 3300046516 | Bacteria | 2734 |
| 410 | Ga0495628_0079477 | 3300046516 | Bacteria | 2550 |
| 411 | Ga0495628_0105280 | 3300046516 | Bacteria | 2173 |
| 412 | Ga0495628_0172550 | 3300046516 | Bacteria | 1639 |
| 413 | Ga0495630_0007758 | 3300046517 | Bacteria | 7683 |
| 414 | Ga0495630_0012136 | 3300046517 | Bacteria | 6247 |
| 415 | Ga0495630_0054191 | 3300046517 | Bacteria | 3004 |
| 416 | Ga0495666_0005324 | 3300046526 | Bacteria | 6488 |
| 417 | Ga0495666_0036890 | 3300046526 | Bacteria | 2379 |
| 418 | Ga0495652_0017216 | 3300046529 | Bacteria | 6453 |
| 419 | Ga0495652_0033278 | 3300046529 | Bacteria | 4501 |
| 420 | Ga0495652_0138475 | 3300046529 | Bacteria | 1917 |
| 421 | Ga0495665_0007638 | 3300046531 | Bacteria | 5854 |
| 422 | Ga0495665_0017714 | 3300046531 | Bacteria | 3830 |
| 423 | Ga0495640_0017105 | 3300046533 | Bacteria | 5410 |
| 424 | Ga0495640_0033600 | 3300046533 | Bacteria | 3642 |
| 425 | Ga0495640_0045983 | 3300046533 | Bacteria | 3027 |
| 426 | Ga0495587_0010978 | 3300046536 | Bacteria | 5745 |
| 427 | Ga0495587_0012217 | 3300046536 | Bacteria | 5421 |
| 428 | Ga0495587_0024741 | 3300046536 | Bacteria | 3676 |
| 429 | Ga0495667_0006400 | 3300046559 | Bacteria | 7985 |
| 430 | Ga0495667_0007944 | 3300046559 | Bacteria | 7193 |
| 431 | Ga0495667_0008522 | 3300046559 | Bacteria | 6959 |
| 432 | Ga0495667_0040864 | 3300046559 | Bacteria | 3077 |
| 433 | Ga0495667_0043456 | 3300046559 | Bacteria | 2977 |
| 434 | Ga0495634_0026821 | 3300046642 | Bacteria | 4016 |
| 435 | Ga0495634_0049158 | 3300046642 | Bacteria | 2837 |
| 436 | Ga0495634_0067641 | 3300046642 | Bacteria | 2362 |
| 437 | Ga0495634_0080422 | 3300046642 | Bacteria | 2132 |
| 438 | Ga0495635_0002796 | 3300046663 | Bacteria | 11958 |
| 439 | Ga0495635_0006437 | 3300046663 | Bacteria | 8188 |
| 440 | Ga0495635_0027417 | 3300046663 | Bacteria | 3962 |
| 441 | Ga0495635_0056149 | 3300046663 | Bacteria | 2711 |
| 442 | Ga0495635_0069286 | 3300046663 | Bacteria | 2418 |
| 443 | Ga0495635_0080743 | 3300046663 | Bacteria | 2225 |
| 444 | Ga0495588_0050901 | 3300046674 | Bacteria | 2132 |
| 445 | Ga0495657_0007413 | 3300046675 | Bacteria | 8477 |
| 446 | Ga0495657_0020546 | 3300046675 | Bacteria | 4745 |
| 447 | Ga0495599_0015523 | 3300046678 | Bacteria | 4728 |
| 448 | Ga0495599_0033814 | 3300046678 | Bacteria | 3213 |
| 449 | Ga0495599_0034543 | 3300046678 | Bacteria | 3176 |
| 450 | Ga0495599_0103092 | 3300046678 | Bacteria | 1778 |
| 451 | Ga0495623_0022658 | 3300046679 | Bacteria | 4054 |
| 452 | Ga0495623_0045035 | 3300046679 | Bacteria | 2803 |
| 453 | Ga0495646_0021320 | 3300046680 | Bacteria | 4095 |
| 454 | Ga0495646_0080341 | 3300046680 | Bacteria | 1902 |
| 455 | Ga0495658_0050333 | 3300046683 | Bacteria | 2356 |
| 456 | Ga0495658_0051301 | 3300046683 | Bacteria | 2337 |
| 457 | Ga0495669_0045736 | 3300046684 | Bacteria | 1952 |
| 458 | Ga0495613_0018025 | 3300046689 | Bacteria | 5262 |
| 459 | Ga0495613_0043773 | 3300046689 | Bacteria | 3312 |
| 460 | Ga0495613_0140259 | 3300046689 | Bacteria | 1727 |
| 461 | Ga0495600_0003949 | 3300046809 | Bacteria | 8809 |
| 462 | Ga0495600_0023362 | 3300046809 | Bacteria | 3977 |
| 463 | Ga0495600_0036524 | 3300046809 | Bacteria | 3193 |
| 464 | Ga0495600_0044802 | 3300046809 | Bacteria | 2885 |
| 465 | Ga0495600_0124411 | 3300046809 | Bacteria | 1677 |
| 466 | Ga0495581_0017623 | 3300047315 | Bacteria | 4148 |
| 467 | Ga0495581_0019788 | 3300047315 | Bacteria | 3909 |
| 468 | Ga0495581_0068202 | 3300047315 | Bacteria | 2056 |
| 469 | Ga0495604_0021065 | 3300047317 | Bacteria | 5201 |
| 470 | Ga0495604_0021793 | 3300047317 | Bacteria | 5114 |
| 471 | Ga0495604_0025955 | 3300047317 | Bacteria | 4666 |
| 472 | Ga0495604_0027873 | 3300047317 | Bacteria | 4492 |
| 473 | Ga0495674_0003143 | 3300047319 | Bacteria | 16039 |
| 474 | Ga0495674_0030062 | 3300047319 | Bacteria | 4942 |
| 475 | Ga0495676_0017043 | 3300047321 | Bacteria | 6428 |
| 476 | Ga0495676_0158643 | 3300047321 | Bacteria | 1602 |
| 477 | Ga0495680_0004344 | 3300047322 | Bacteria | 13578 |
| 478 | Ga0495680_0007513 | 3300047322 | Bacteria | 9981 |
| 479 | Ga0495680_0016778 | 3300047322 | Bacteria | 6278 |
| 480 | Ga0495680_0044307 | 3300047322 | Bacteria | 3518 |
| 481 | Ga0495680_0050841 | 3300047322 | Bacteria | 3239 |
| 482 | Ga0495680_0154019 | 3300047322 | Bacteria | 1673 |
| 483 | Ga0495675_0001647 | 3300047444 | Bacteria | 13373 |
| 484 | Ga0495675_0020600 | 3300047444 | Bacteria | 4197 |
| 485 | Ga0495675_0034359 | 3300047444 | Bacteria | 3237 |
| 486 | Ga0495684_0010271 | 3300047471 | Bacteria | 7238 |
| 487 | Ga0495684_0016550 | 3300047471 | Bacteria | 5680 |
| 488 | Ga0495684_0031130 | 3300047471 | Bacteria | 4095 |
| 489 | Ga0495684_0076200 | 3300047471 | Bacteria | 2547 |
| 490 | Ga0495593_0012025 | 3300047673 | Bacteria | 4961 |
| 491 | Ga0495593_0037528 | 3300047673 | Bacteria | 2620 |
| 492 | Ga0495602_0007219 | 3300048088 | Bacteria | 11640 |
| 493 | Ga0495602_0130069 | 3300048088 | Bacteria | 2009 |
| 494 | Ga0495614_0011370 | 3300048089 | Bacteria | 3918 |
| 495 | Ga0496101_0027213 | 3300048904 | Bacteria | 3981 |
| 496 | Ga0496102_0000721 | 3300048905 | Bacteria | 32596 |
| 497 | Ga0496102_0080777 | 3300048905 | Bacteria | 2996 |
| 498 | Ga0496103_0018149 | 3300048906 | Bacteria | 4219 |
| 499 | Ga0496103_0036334 | 3300048906 | Bacteria | 3017 |
| 500 | Ga0496104_0029437 | 3300048907 | Bacteria | 5094 |
| 501 | Ga0496104_0077284 | 3300048907 | Bacteria | 3172 |
| 502 | Ga0496104_0177450 | 3300048907 | Bacteria | 2040 |
| 503 | Ga0496105_0016141 | 3300048908 | Bacteria | 5956 |
| 504 | Ga0496107_0077672 | 3300048910 | Bacteria | 2418 |
| 505 | Ga0496108_0000041 | 3300048911 | Bacteria | 147365 |
| 506 | Ga0496109_0103852 | 3300048912 | Bacteria | 2638 |
| 507 | Ga0496110_0020301 | 3300048913 | Bacteria | 5609 |
| 508 | Ga0496110_0031602 | 3300048913 | Bacteria | 4568 |
| 509 | Ga0496110_0204486 | 3300048913 | Bacteria | 1794 |
| 510 | Ga0496111_0003925 | 3300048914 | Bacteria | 9322 |
| 511 | Ga0496112_0102848 | 3300048915 | Bacteria | 2826 |
| 512 | Ga0496112_0174052 | 3300048915 | Bacteria | 2117 |
| 513 | Ga0496114_0016245 | 3300048917 | Bacteria | 5995 |
| 514 | Ga0496114_0041906 | 3300048917 | Bacteria | 3793 |
| 515 | Ga0496114_0164934 | 3300048917 | Bacteria | 1928 |
| 516 | Ga0496115_0044952 | 3300048918 | Bacteria | 3524 |
| 517 | Ga0501031_0015215 | 3300049568 | Bacteria | 4996 |
| 518 | Ga0501034_0205525 | 3300049571 | Bacteria | 1926 |
| 519 | Ga0501036_0069665 | 3300049572 | Bacteria | 2975 |
| 520 | Ga0501038_0000163 | 3300049574 | Bacteria | 56384 |
| 521 | Ga0501047_0005021 | 3300049581 | Bacteria | 12423 |
| 522 | Ga0501047_0255377 | 3300049581 | Bacteria | 1601 |
| 523 | Ga0501048_0000286 | 3300049582 | Bacteria | 34220 |
| 524 | Ga0501069_0116556 | 3300049585 | Bacteria | 1524 |
| 525 | Ga0501070_0007934 | 3300049586 | Bacteria | 8993 |
| 526 | Ga0501070_0035634 | 3300049586 | Bacteria | 4157 |
| 527 | Ga0501070_0052385 | 3300049586 | Bacteria | 3387 |
| 528 | Ga0501070_0104703 | 3300049586 | Bacteria | 2339 |
| 529 | Ga0501073_0137479 | 3300049589 | Bacteria | 1693 |
| 530 | Ga0501035_0010663 | 3300049822 | Bacteria | 8509 |
| 531 | Ga0501035_0092318 | 3300049822 | Bacteria | 2664 |
| 532 | Ga0501044_0037255 | 3300049823 | Bacteria | 5084 |
| 533 | nmdc:mga03683_35533_c1 | 3300050489 | Bacteria | 2022 |
| 534 | nmdc:mga03n38_12373_c1 | 3300050490 | Bacteria | 3209 |
| 535 | nmdc:mga03n38_35483_c1 | 3300050490 | Bacteria | 2137 |
| 536 | nmdc:mga00v17_125519_c1 | 3300050491 | Bacteria | 1637 |
| 537 | nmdc:mga00v17_29992_c1 | 3300050491 | Bacteria | 3196 |
| 538 | nmdc:mga00v17_6651_c1 | 3300050491 | Bacteria | 6141 |
| 539 | nmdc:mga0yw44_1287_c1 | 3300050492 | Bacteria | 9899 |
| 540 | nmdc:mga0yw44_196671_c1 | 3300050492 | Bacteria | 1331 |
| 541 | nmdc:mga0yw44_30520_c1 | 3300050492 | Bacteria | 3125 |
| 542 | nmdc:mga0yw44_54193_c1 | 3300050492 | Bacteria | 2437 |
| 543 | nmdc:mga07m45_87509_c1 | 3300050496 | Bacteria | 1783 |
| 544 | nmdc:mga05p37_191766_c1 | 3300050507 | Bacteria | 2481 |
| 545 | nmdc:mga09592_21042_c1 | 3300050508 | Bacteria | 5372 |
| 546 | nmdc:mga0qj67_227598_c1 | 3300050509 | Bacteria | 1513 |
| 547 | nmdc:mga06r32_1287_c1 | 3300050510 | Bacteria | 10168 |
| 548 | nmdc:mga0n895_39614_c1 | 3300050512 | Bacteria | 4573 |
| 549 | Ga0495601_0021951 | 3300053077 | Bacteria | 3916 |
| 550 | Ga0495612_0004755 | 3300053078 | Bacteria | 5619 |
| 551 | Ga0495612_0021123 | 3300053078 | Bacteria | 2612 |
| 552 | Ga0495612_0025030 | 3300053078 | Bacteria | 2396 |
| 553 | Ga0495595_0005316 | 3300053084 | Bacteria | 5206 |
| 554 | Ga0495595_0016070 | 3300053084 | Bacteria | 3196 |
| 555 | Ga0495619_0019370 | 3300053085 | Bacteria | 4324 |
| 556 | Ga0495619_0028982 | 3300053085 | Bacteria | 3574 |
| 557 | Ga0495619_0134716 | 3300053085 | Bacteria | 1699 |
| 558 | Ga0500644_0000067 | 3300053088 | Bacteria | 61703 |
| 559 | Ga0500644_0011522 | 3300053088 | Bacteria | 2418 |
| 560 | Ga0500644_0017444 | 3300053088 | Bacteria | 2085 |
| 561 | Ga0500651_0130954 | 3300053093 | Bacteria | 1517 |
| 562 | Ga0500641_0011715 | 3300053096 | Bacteria | 3189 |
| 563 | Ga0500556_0001092 | 3300053104 | Bacteria | 13635 |
| 564 | Ga0500569_012538 | 3300053109 | Bacteria | 2053 |
| 565 | Ga0500593_004470 | 3300053117 | Bacteria | 5418 |
| 566 | Ga0500652_009533 | 3300053131 | Bacteria | 3289 |
| 567 | Ga0500573_0018194 | 3300053140 | Bacteria | 4005 |
| 568 | Ga0500577_0007334 | 3300053142 | Bacteria | 3085 |
| 569 | Ga0466962_0006925 | 3300061719 | Bacteria | 5435 |
| 570 | Ga0466962_0011869 | 3300061719 | Bacteria | 4194 |
| 571 | Ga0466962_0016610 | 3300061719 | Bacteria | 3550 |
| 572 | Ga0466962_0029009 | 3300061719 | Bacteria | 2649 |
| 573 | Ga0466962_0037381 | 3300061719 | Bacteria | 2324 |
| 574 | Ga0466962_0059534 | 3300061719 | Bacteria | 1823 |
| 575 | Ga0466962_0113879 | 3300061719 | Bacteria | 1303 |
| 576 | Ga0530510_0144281 | 3300061734 | Bacteria | 1756 |
| 577 | 2515494413 | 2515154088 | Bacteria | 5526283 |
| 578 | 2515719685 | 2515154129 | Bacteria | 5584369 |
| 579 | 2515756642 | 2515154137 | Bacteria | 5711575 |
| 580 | 2516084996 | 2515154202 | Bacteria | 5471270 |
| 581 | 2516088973 | 2515154203 | Bacteria | 5458536 |
| 582 | 2558905615 | 2558860112 | Bacteria | 9931328 |
| 583 | 2643825950 | 2643221561 | Bacteria | 4984412 |
| 584 | 2643891704 | 2643221576 | Bacteria | 5214352 |
| 585 | 2643960752 | 2643221590 | Bacteria | 5214697 |
| 586 | 2644035731 | 2643221604 | Bacteria | 5014917 |
| 587 | 2644089260 | 2643221615 | Bacteria | 5487866 |
| 588 | 2644101554 | 2643221617 | Bacteria | 5139111 |
| 589 | 2644115617 | 2643221620 | Bacteria | 5134593 |
| 590 | 2644319105 | 2643221657 | Bacteria | 5490246 |
| 591 | 2644531941 | 2643221696 | Bacteria | 5431823 |
| 592 | 2645721717 | 2643221961 | Bacteria | 3919167 |
| 593 | 2645724329 | 2643221962 | Bacteria | 3874254 |
| 594 | 2738868169 | 2738541305 | Bacteria | 4910150 |
| 595 | 2753265780 | 2751185782 | Bacteria | 11227053 |
| 596 | 2791910520 | 2791354901 | Bacteria | 8322202 |
| 597 | 2809196283 | 2808606439 | Bacteria | 5952208 |
| 598 | 2812333098 | 2811994874 | Bacteria | 5367947 |
| 599 | 2855387019 | 2855386786 | Bacteria | 4752232 |
| 600 | 2866618470 | 2866612099 | Bacteria | 7543886 |
| 601 | 2870787845 | 2870782633 | Bacteria | 9624083 |
| 602 | 2891970839 | 2891968417 | Bacteria | 5821697 |
| 603 | 2899367065 | 2899359706 | Bacteria | 10940472 |
| 604 | Ga0373934_0017470 | |||
| 605 | JGI24737J22298_10017841 | |||
| 606 | JGI25406J46586_10008352 | |||
| 607 | Ga0070658_10064987 | |||
| 608 | Ga0070683_100176084 | |||
| 609 | Ga0070690_100122042 | |||
| 610 | Ga0070666_10015790 | |||
| 611 | Ga0070680_100088945 | |||
| 612 | Ga0070682_100086912 | |||
| 613 | Ga0068868_100042816 | |||
| 614 | Ga0070660_100236496 | |||
| 615 | Ga0070689_100061590 | |||
| 616 | Ga0070668_100000642 | |||
| 617 | Ga0070669_100083113 | |||
| 618 | Ga0070671_100060336 | |||
| 619 | Ga0070673_100047724 | |||
| 620 | Ga0070659_100168610 | |||
| 621 | Ga0070659_100222040 | |||
| 622 | Ga0070709_10001154 | |||
| 623 | Ga0070714_100000570 | |||
| 624 | Ga0070714_100001784 | |||
| 625 | Ga0070714_100011233 | |||
| 626 | Ga0070714_100091015 | |||
| 627 | Ga0070714_100159875 | |||
| 628 | Ga0070714_100322714 | |||
| 629 | Ga0070714_100330345 | |||
| 630 | Ga0070713_100003560 | |||
| 631 | Ga0070713_100023693 | |||
| 632 | Ga0070713_100081372 | |||
| 633 | Ga0070713_100119003 | |||
| 634 | Ga0070710_10002653 | |||
| 635 | Ga0070710_10029794 | |||
| 636 | Ga0070710_10107581 | |||
| 637 | Ga0070711_100004061 | |||
| 638 | Ga0070711_100085178 | |||
| 639 | Ga0070708_100091777 | |||
| 640 | Ga0070708_100267544 | |||
| 641 | Ga0070708_100421555 | |||
| 642 | Ga0070663_100013123 | |||
| 643 | Ga0070663_100033267 | |||
| 644 | Ga0070681_10189177 | |||
| 645 | Ga0070685_10048892 | |||
| 646 | Ga0070706_100049901 | |||
| 647 | Ga0070706_100062479 | |||
| 648 | Ga0070707_100002696 | |||
| 649 | Ga0070707_100013400 | |||
| 650 | Ga0070707_100014613 | |||
| 651 | Ga0070707_100059471 | |||
| 652 | Ga0070707_100177974 | |||
| 653 | Ga0070698_100001196 | |||
| 654 | Ga0070698_100014548 | |||
| 655 | Ga0070698_100050051 | |||
| 656 | Ga0070698_100070860 | |||
| 657 | Ga0070699_100000764 | |||
| 658 | Ga0070684_100203360 | |||
| 659 | Ga0070697_100138843 | |||
| 660 | Ga0070697_100158023 | |||
| 661 | Ga0068853_100061775 | |||
| 662 | Ga0068853_100092674 | |||
| 663 | Ga0070695_100063880 | |||
| 664 | Ga0070696_100025465 | |||
| 665 | Ga0068855_100175203 | |||
| 666 | Ga0070664_100138393 | |||
| 667 | Ga0068854_100203239 | |||
| 668 | Ga0068856_100109735 | |||
| 669 | Ga0068856_100234807 | |||
| 670 | Ga0068852_100003383 | |||
| 671 | Ga0068864_100149947 | |||
| 672 | Ga0068866_10149124 | |||
| 673 | Ga0068863_100166412 | |||
| 674 | Ga0068863_100184281 | |||
| 675 | Ga0068858_100053683 | |||
| 676 | Ga0068860_100000410 | |||
| 677 | Ga0068860_100013888 | |||
| 678 | Ga0081455_10001381 | |||
| 679 | Ga0081539_10000086 | |||
| 680 | Ga0081539_10018371 | |||
| 681 | Ga0070717_10024099 | |||
| 682 | Ga0070717_10038636 | |||
| 683 | Ga0070717_10048705 | |||
| 684 | Ga0070717_10196424 | |||
| 685 | Ga0070717_10201151 | |||
| 686 | Ga0070717_10254280 | |||
| 687 | Ga0070717_10263107 | |||
| 688 | Ga0075365_10016005 | |||
| 689 | Ga0075365_10194380 | |||
| 690 | Ga0075368_10003683 | |||
| 691 | Ga0075368_10033200 | |||
| 692 | Ga0075363_100009178 | |||
| 693 | Ga0075364_10005745 | |||
| 694 | Ga0075364_10014973 | |||
| 695 | Ga0075364_10077354 | |||
| 696 | Ga0070715_10022144 | |||
| 697 | Ga0070716_100011939 | |||
| 698 | Ga0070712_100041918 | |||
| 699 | Ga0070712_100100400 | |||
| 700 | Ga0075362_10026730 | |||
| 701 | Ga0075370_10044218 | |||
| 702 | Ga0075370_10090641 | |||
| 703 | Ga0075428_100026332 | |||
| 704 | Ga0075431_100012552 | |||
| 705 | Ga0075431_100099704 | |||
| 706 | Ga0075431_100291137 | |||
| 707 | Ga0075434_100007704 | |||
| 708 | Ga0075429_100009538 | |||
| 709 | Ga0075436_100099122 | |||
| 710 | Ga0105245_10007729 | |||
| 711 | Ga0105245_10018045 | |||
| 712 | Ga0105245_10322970 | |||
| 713 | Ga0105247_10031518 | |||
| 714 | Ga0105247_10058228 | |||
| 715 | Ga0114129_10022901 | |||
| 716 | Ga0114129_10408249 | |||
| 717 | Ga0105243_10133037 | |||
| 718 | Ga0105241_10093182 | |||
| 719 | Ga0105241_10162075 | |||
| 720 | Ga0105242_10044041 | |||
| 721 | Ga0105248_10055560 | |||
| 722 | Ga0105248_10133139 | |||
| 723 | Ga0105237_10082723 | |||
| 724 | Ga0105249_10133712 | |||
| 725 | Ga0105239_10187614 | |||
| 726 | Ga0105246_10016655 | |||
| 727 | Ga0157342_1001929 | |||
| 728 | Ga0157371_10053759 | |||
| 729 | Ga0157369_10017060 | |||
| 730 | Ga0157378_10059272 | |||
| 731 | Ga0157372_10527673 | |||
| 732 | Ga0163163_10013062 | |||
| 733 | Ga0163163_10056165 | |||
| 734 | Ga0163163_10294737 | |||
| 735 | Ga0157380_10062938 | |||
| 736 | Ga0157377_10037385 | |||
| 737 | Ga0157379_10011411 | |||
| 738 | Ga0207653_10006897 | |||
| 739 | Ga0207692_10001536 | |||
| 740 | Ga0207692_10024372 | |||
| 741 | Ga0207692_10040373 | |||
| 742 | Ga0207692_10095617 | |||
| 743 | Ga0207647_10008349 | |||
| 744 | Ga0207685_10049234 | |||
| 745 | Ga0207699_10020410 | |||
| 746 | Ga0207699_10026142 | |||
| 747 | Ga0207699_10147636 | |||
| 748 | Ga0207699_10176909 | |||
| 749 | Ga0207643_10011348 | |||
| 750 | Ga0207684_10004936 | |||
| 751 | Ga0207684_10040924 | |||
| 752 | Ga0207684_10213836 | |||
| 753 | Ga0207654_10115046 | |||
| 754 | Ga0207695_10251872 | |||
| 755 | Ga0207663_10011400 | |||
| 756 | Ga0207663_10060103 | |||
| 757 | Ga0207663_10120280 | |||
| 758 | Ga0207662_10004985 | |||
| 759 | Ga0207657_10008019 | |||
| 760 | Ga0207657_10168323 | |||
| 761 | Ga0207657_10224944 | |||
| 762 | Ga0207646_10005717 | |||
| 763 | Ga0207646_10007233 | |||
| 764 | Ga0207646_10060115 | |||
| 765 | Ga0207646_10210352 | |||
| 766 | Ga0207694_10054589 | |||
| 767 | Ga0207694_10263037 | |||
| 768 | Ga0207687_10014576 | |||
| 769 | Ga0207700_10015661 | |||
| 770 | Ga0207700_10017204 | |||
| 771 | Ga0207700_10017422 | |||
| 772 | Ga0207700_10062695 | |||
| 773 | Ga0207700_10247630 | |||
| 774 | Ga0207664_10005175 | |||
| 775 | Ga0207664_10013984 | |||
| 776 | Ga0207664_10017910 | |||
| 777 | Ga0207664_10030189 | |||
| 778 | Ga0207664_10039524 | |||
| 779 | Ga0207664_10049227 | |||
| 780 | Ga0207664_10066374 | |||
| 781 | Ga0207664_10077639 | |||
| 782 | Ga0207664_10096905 | |||
| 783 | Ga0207664_10107765 | |||
| 784 | Ga0207664_10135138 | |||
| 785 | Ga0207664_10317230 | |||
| 786 | Ga0207690_10060432 | |||
| 787 | Ga0207669_10106632 | |||
| 788 | Ga0207665_10017264 | |||
| 789 | Ga0207665_10042519 | |||
| 790 | Ga0207665_10142294 | |||
| 791 | Ga0207689_10003922 | |||
| 792 | Ga0207661_10280698 | |||
| 793 | Ga0207679_10010916 | |||
| 794 | Ga0207667_10017308 | |||
| 795 | Ga0207667_10289225 | |||
| 796 | Ga0207668_10002146 | |||
| 797 | Ga0207668_10011928 | |||
| 798 | Ga0207658_10187630 | |||
| 799 | Ga0207677_10043228 | |||
| 800 | Ga0207677_10076265 | |||
| 801 | Ga0207703_10061619 | |||
| 802 | Ga0207639_10047386 | |||
| 803 | Ga0207639_10132672 | |||
| 804 | Ga0207678_10005834 | |||
| 805 | Ga0207678_10027630 | |||
| 806 | Ga0207708_10014233 | |||
| 807 | Ga0207708_10152449 | |||
| 808 | Ga0207702_10072371 | |||
| 809 | Ga0207676_10072382 | |||
| 810 | Ga0207675_100016824 | |||
| 811 | Ga0207675_100263342 | |||
| 812 | Ga0207683_10003942 | |||
| 813 | Ga0207698_10102741 | |||
| 814 | Ga0209813_10021816 | |||
| 815 | Ga0268266_10274768 | |||
| 816 | Ga0268264_10000155 | |||
| 817 | Ga0268264_10078407 | |||
| 818 | Ga0268264_10167726 | |||
| 819 | Ga0268264_10318702 | |||
| 820 | Ga0265337_1000562 | |||
| 821 | Ga0265326_10003273 | |||
| 822 | Ga0265319_1003722 | |||
| 823 | Ga0265334_10001608 | |||
| 824 | Ga0265323_10005530 | |||
| 825 | Ga0265336_10002575 | |||
| 826 | Ga0265336_10004427 | |||
| 827 | Ga0307517_10061247 | |||
| 828 | Ga0307515_10000192 | |||
| 829 | Ga0307515_10006596 | |||
| 830 | Ga0307515_10023361 | |||
| 831 | Ga0307515_10023982 | |||
| 832 | Ga0265338_10001286 | |||
| 833 | Ga0265338_10012392 | |||
| 834 | Ga0307511_10000710 | |||
| 835 | Ga0307512_10011862 | |||
| 836 | Ga0307512_10025132 | |||
| 837 | Ga0265320_10010522 | |||
| 838 | Ga0265339_10021613 | |||
| 839 | Ga0265316_10004139 | |||
| 840 | Ga0307513_10007180 | |||
| 841 | Ga0307509_10010476 | |||
| 842 | Ga0265313_10033810 | |||
| 843 | Ga0307508_10005172 | |||
| 844 | Ga0307508_10016687 | |||
| 845 | Ga0307508_10065510 | |||
| 846 | Ga0265314_10020889 | |||
| 847 | Ga0265342_10002027 | |||
| 848 | Ga0307516_10001960 | |||
| 849 | Ga0307516_10018627 | |||
| 850 | Ga0307516_10087317 | |||
| 851 | Ga0307413_10089426 | |||
| 852 | Ga0307413_10123552 | |||
| 853 | Ga0307414_10170901 | |||
| 854 | Ga0307415_100001831 | |||
| 855 | Ga0307415_100020508 | |||
| 856 | Ga0307507_10014654 | |||
| 857 | Ga0316212_1002246 | |||
| 858 | Ga0373948_0003054 | |||
| 859 | Ga0373950_0012198 | |||
| 860 | Ga0373926_0002418 | |||
| 861 | Ga0373926_0012522 | |||
| 862 | Ga0373926_0042178 | |||
| 863 | Ga0373928_0006227 | |||
| 864 | Ga0373940_0001991 | |||
| 865 | Ga0373944_0007878 | |||
| 866 | Ga0373949_0002005 | |||
| 867 | Ga0373951_0006183 | |||
| 868 | Ga0373952_0004632 | |||
| 869 | Ga0373923_0019756 | |||
| 870 | Ga0373932_0009608 | |||
| 871 | Ga0373936_0001965 | |||
| 872 | Ga0373936_0004348 | |||
| 873 | Ga0373936_0033028 | |||
| 874 | Ga0373941_0007715 | |||
| 875 | Ga0373945_0000063 | |||
| 876 | Ga0373945_0005414 | |||
| 877 | Ga0373953_0012778 | |||
| 878 | Ga0373954_0004140 | |||
| 879 | Ga0373956_0008351 | |||
| 880 | Ga0373956_0028041 | |||
| 881 | Ga0373957_0001854 | |||
| 882 | Ga0373957_0009269 | |||
| 883 | Ga0373957_0022048 | |||
| 884 | Ga0373943_0006467 | |||
| 885 | Ga0373946_0002355 | |||
| 886 | Ga0373955_0004276 | |||
| 887 | Ga0373955_0006902 | |||
| 888 | Ga0373955_0011472 | |||
| 889 | Ga0373955_0035511 | |||
| 890 | Ga0373942_0000165 | |||
| 891 | Ga0373962_0021876 | |||
| 892 | Ga0373924_0006572 | |||
| 893 | Ga0373924_0014245 | |||
| 894 | Ga0373931_0213426 | |||
| 895 | Ga0373935_0006081 | |||
| 896 | Ga0373935_0010347 | |||
| 897 | Ga0373935_0027858 | |||
| 898 | Ga0373927_0001934 | |||
| 899 | Ga0373933_0003594 | |||
| 900 | Ga0373933_0005089 | |||
| 901 | Ga0373933_0037092 | |||
| 902 | Ga0373933_0052521 | |||
| 903 | Ga0373933_0062470 | |||
| 904 | Ga0373933_0124188 | |||
| 905 | Ga0373947_0000011 | |||
| 906 | Ga0373947_0000952 | |||
| 907 | Ga0373947_0001869 | |||
| 908 | Ga0373947_0058970 | |||
| 909 | Ga0373937_0041749 | |||
| 910 | Ga0373937_0047667 | |||
| 911 | Ga0373937_0056951 | |||
| 912 | Ga0373937_0084328 | |||
| 913 | Ga0373937_0123759 | |||
| 914 | Ga0372808_000114 | |||
| 915 | Ga0372808_004314 | |||
| 916 | Ga0373925_0000072 | |||
| 917 | Ga0373925_0002590 | |||
| 918 | Ga0373925_0007631 | |||
| 919 | Ga0373925_0099768 | |||
| 920 | Ga0395900_0023945 | |||
| 921 | Ga0395900_0114385 | |||
| 922 | Ga0395898_0096601 | |||
| 923 | Ga0436364_0690278 | |||
| 924 | Ga0436364_1422257 | |||
| 925 | Ga0395901_0172038 | |||
| 926 | Ga0395901_0338593 | |||
| 927 | Ga0451793_0535357 | |||
| 928 | Ga0451833_0215925 | |||
| 929 | Ga0451843_1022262 | |||
| 930 | Ga0451853_0390109 | |||
| 931 | Ga0439431_0017807 | |||
| 932 | Ga0439452_027813 | |||
| 933 | Ga0466969_0010807 | |||
| 934 | Ga0466972_0014962 | |||
| 935 | Ga0466965_0017059 | |||
| 936 | Ga0466965_0019370 | |||
| 937 | Ga0466965_0035271 | |||
| 938 | Ga0466965_0045200 | |||
| 939 | Ga0466966_0001650 | |||
| 940 | Ga0466966_0012869 | |||
| 941 | Ga0466966_0021303 | |||
| 942 | Ga0466966_0033145 | |||
| 943 | Ga0466966_0040362 | |||
| 944 | Ga0466966_0083926 | |||
| 945 | Ga0466961_0004276 | |||
| 946 | Ga0466961_0016413 | |||
| 947 | Ga0466961_0021602 | |||
| 948 | Ga0466961_0022184 | |||
| 949 | Ga0466961_0039976 | |||
| 950 | Ga0466961_0085174 | |||
| 951 | Ga0466961_0105489 | |||
| 952 | Ga0466963_0059827 | |||
| 953 | Ga0466963_0074315 | |||
| 954 | Ga0466963_0086500 | |||
| 955 | Ga0466970_0023693 | |||
| 956 | Ga0466970_0032971 | |||
| 957 | Ga0466970_0055576 | |||
| 958 | Ga0466970_0084852 | |||
| 959 | Ga0466957_0090615 | |||
| 960 | Ga0466960_0004437 | |||
| 961 | Ga0466960_0006092 | |||
| 962 | Ga0466959_0011146 | |||
| 963 | Ga0466959_0011833 | |||
| 964 | Ga0466958_0001690 | |||
| 965 | Ga0466958_0008621 | |||
| 966 | Ga0466958_0079511 | |||
| 967 | Ga0466958_0111356 | |||
| 968 | Ga0466958_0169354 | |||
| 969 | Ga0466967_0002377 | |||
| 970 | Ga0466967_0004350 | |||
| 971 | Ga0466967_0010208 | |||
| 972 | Ga0466967_0022161 | |||
| 973 | Ga0466967_0054752 | |||
| 974 | Ga0466967_0062607 | |||
| 975 | Ga0466967_0157090 | |||
| 976 | Ga0466967_0251545 | |||
| 977 | Ga0495592_0000831 | |||
| 978 | Ga0495592_0012576 | |||
| 979 | Ga0495592_0036341 | |||
| 980 | Ga0495592_0058949 | |||
| 981 | Ga0495592_0066105 | |||
| 982 | Ga0495603_0026491 | |||
| 983 | Ga0495603_0075296 | |||
| 984 | Ga0495603_0087384 | |||
| 985 | Ga0495629_0011493 | |||
| 986 | Ga0495629_0014137 | |||
| 987 | Ga0495629_0111035 | |||
| 988 | Ga0495641_0011080 | |||
| 989 | Ga0495641_0013867 | |||
| 990 | Ga0495651_0022366 | |||
| 991 | Ga0495651_0025204 | |||
| 992 | Ga0495651_0035323 | |||
| 993 | Ga0495653_0007038 | |||
| 994 | Ga0495653_0092287 | |||
| 995 | Ga0495653_0110620 | |||
| 996 | Ga0495580_0012950 | |||
| 997 | Ga0495580_0028064 | |||
| 998 | Ga0495582_0030572 | |||
| 999 | Ga0495639_0029292 | |||
| 1000 | Ga0495662_0023447 | |||
| 1001 | Ga0495664_0000220 | |||
| 1002 | Ga0495664_0017525 | |||
| 1003 | Ga0495664_0035491 | |||
| 1004 | Ga0495664_0045305 | |||
| 1005 | Ga0495594_0087990 | |||
| 1006 | Ga0495594_0095368 | |||
| 1007 | Ga0495608_0006046 | |||
| 1008 | Ga0495608_0009916 | |||
| 1009 | Ga0495608_0022625 | |||
| 1010 | Ga0495608_0118775 | |||
| 1011 | Ga0495628_0035616 | |||
| 1012 | Ga0495628_0070078 | |||
| 1013 | Ga0495628_0079477 | |||
| 1014 | Ga0495628_0105280 | |||
| 1015 | Ga0495628_0172550 | |||
| 1016 | Ga0495630_0007758 | |||
| 1017 | Ga0495630_0012136 | |||
| 1018 | Ga0495630_0054191 | |||
| 1019 | Ga0495666_0005324 | |||
| 1020 | Ga0495666_0036890 | |||
| 1021 | Ga0495652_0017216 | |||
| 1022 | Ga0495652_0033278 | |||
| 1023 | Ga0495652_0138475 | |||
| 1024 | Ga0495665_0007638 | |||
| 1025 | Ga0495665_0017714 | |||
| 1026 | Ga0495640_0017105 | |||
| 1027 | Ga0495640_0033600 | |||
| 1028 | Ga0495640_0045983 | |||
| 1029 | Ga0495587_0010978 | |||
| 1030 | Ga0495587_0012217 | |||
| 1031 | Ga0495587_0024741 | |||
| 1032 | Ga0495667_0006400 | |||
| 1033 | Ga0495667_0007944 | |||
| 1034 | Ga0495667_0008522 | |||
| 1035 | Ga0495667_0040864 | |||
| 1036 | Ga0495667_0043456 | |||
| 1037 | Ga0495634_0026821 | |||
| 1038 | Ga0495634_0049158 | |||
| 1039 | Ga0495634_0067641 | |||
| 1040 | Ga0495634_0080422 | |||
| 1041 | Ga0495635_0002796 | |||
| 1042 | Ga0495635_0006437 | |||
| 1043 | Ga0495635_0027417 | |||
| 1044 | Ga0495635_0056149 | |||
| 1045 | Ga0495635_0069286 | |||
| 1046 | Ga0495635_0080743 | |||
| 1047 | Ga0495588_0050901 | |||
| 1048 | Ga0495657_0007413 | |||
| 1049 | Ga0495657_0020546 | |||
| 1050 | Ga0495599_0015523 | |||
| 1051 | Ga0495599_0033814 | |||
| 1052 | Ga0495599_0034543 | |||
| 1053 | Ga0495599_0103092 | |||
| 1054 | Ga0495623_0022658 | |||
| 1055 | Ga0495623_0045035 | |||
| 1056 | Ga0495646_0021320 | |||
| 1057 | Ga0495646_0080341 | |||
| 1058 | Ga0495658_0050333 | |||
| 1059 | Ga0495658_0051301 | |||
| 1060 | Ga0495669_0045736 | |||
| 1061 | Ga0495613_0018025 | |||
| 1062 | Ga0495613_0043773 | |||
| 1063 | Ga0495613_0140259 | |||
| 1064 | Ga0495600_0003949 | |||
| 1065 | Ga0495600_0023362 | |||
| 1066 | Ga0495600_0036524 | |||
| 1067 | Ga0495600_0044802 | |||
| 1068 | Ga0495600_0124411 | |||
| 1069 | Ga0495581_0017623 | |||
| 1070 | Ga0495581_0019788 | |||
| 1071 | Ga0495581_0068202 | |||
| 1072 | Ga0495604_0021065 | |||
| 1073 | Ga0495604_0021793 | |||
| 1074 | Ga0495604_0025955 | |||
| 1075 | Ga0495604_0027873 | |||
| 1076 | Ga0495674_0003143 | |||
| 1077 | Ga0495674_0030062 | |||
| 1078 | Ga0495676_0017043 | |||
| 1079 | Ga0495676_0158643 | |||
| 1080 | Ga0495680_0004344 | |||
| 1081 | Ga0495680_0007513 | |||
| 1082 | Ga0495680_0016778 | |||
| 1083 | Ga0495680_0044307 | |||
| 1084 | Ga0495680_0050841 | |||
| 1085 | Ga0495680_0154019 | |||
| 1086 | Ga0495675_0001647 | |||
| 1087 | Ga0495675_0020600 | |||
| 1088 | Ga0495675_0034359 | |||
| 1089 | Ga0495684_0010271 | |||
| 1090 | Ga0495684_0016550 | |||
| 1091 | Ga0495684_0031130 | |||
| 1092 | Ga0495684_0076200 | |||
| 1093 | Ga0495593_0012025 | |||
| 1094 | Ga0495593_0037528 | |||
| 1095 | Ga0495602_0007219 | |||
| 1096 | Ga0495602_0130069 | |||
| 1097 | Ga0495614_0011370 | |||
| 1098 | Ga0496101_0027213 | |||
| 1099 | Ga0496102_0000721 | |||
| 1100 | Ga0496102_0080777 | |||
| 1101 | Ga0496103_0018149 | |||
| 1102 | Ga0496103_0036334 | |||
| 1103 | Ga0496104_0029437 | |||
| 1104 | Ga0496104_0077284 | |||
| 1105 | Ga0496104_0177450 | |||
| 1106 | Ga0496105_0016141 | |||
| 1107 | Ga0496107_0077672 | |||
| 1108 | Ga0496108_0000041 | |||
| 1109 | Ga0496109_0103852 | |||
| 1110 | Ga0496110_0020301 | |||
| 1111 | Ga0496110_0031602 | |||
| 1112 | Ga0496110_0204486 | |||
| 1113 | Ga0496111_0003925 | |||
| 1114 | Ga0496112_0102848 | |||
| 1115 | Ga0496112_0174052 | |||
| 1116 | Ga0496114_0016245 | |||
| 1117 | Ga0496114_0041906 | |||
| 1118 | Ga0496114_0164934 | |||
| 1119 | Ga0496115_0044952 | |||
| 1120 | Ga0501031_0015215 | |||
| 1121 | Ga0501034_0205525 | |||
| 1122 | Ga0501036_0069665 | |||
| 1123 | Ga0501038_0000163 | |||
| 1124 | Ga0501047_0005021 | |||
| 1125 | Ga0501047_0255377 | |||
| 1126 | Ga0501048_0000286 | |||
| 1127 | Ga0501069_0116556 | |||
| 1128 | Ga0501070_0007934 | |||
| 1129 | Ga0501070_0035634 | |||
| 1130 | Ga0501070_0052385 | |||
| 1131 | Ga0501070_0104703 | |||
| 1132 | Ga0501073_0137479 | |||
| 1133 | Ga0501035_0010663 | |||
| 1134 | Ga0501035_0092318 | |||
| 1135 | Ga0501044_0037255 | |||
| 1136 | nmdc:mga03683_35533_c1 | |||
| 1137 | nmdc:mga03n38_12373_c1 | |||
| 1138 | nmdc:mga03n38_35483_c1 | |||
| 1139 | nmdc:mga00v17_125519_c1 | |||
| 1140 | nmdc:mga00v17_29992_c1 | |||
| 1141 | nmdc:mga00v17_6651_c1 | |||
| 1142 | nmdc:mga0yw44_1287_c1 | |||
| 1143 | nmdc:mga0yw44_196671_c1 | |||
| 1144 | nmdc:mga0yw44_30520_c1 | |||
| 1145 | nmdc:mga0yw44_54193_c1 | |||
| 1146 | nmdc:mga07m45_87509_c1 | |||
| 1147 | nmdc:mga05p37_191766_c1 | |||
| 1148 | nmdc:mga09592_21042_c1 | |||
| 1149 | nmdc:mga0qj67_227598_c1 | |||
| 1150 | nmdc:mga06r32_1287_c1 | |||
| 1151 | nmdc:mga0n895_39614_c1 | |||
| 1152 | Ga0495601_0021951 | |||
| 1153 | Ga0495612_0004755 | |||
| 1154 | Ga0495612_0021123 | |||
| 1155 | Ga0495612_0025030 | |||
| 1156 | Ga0495595_0005316 | |||
| 1157 | Ga0495595_0016070 | |||
| 1158 | Ga0495619_0019370 | |||
| 1159 | Ga0495619_0028982 | |||
| 1160 | Ga0495619_0134716 | |||
| 1161 | Ga0500644_0000067 | |||
| 1162 | Ga0500644_0011522 | |||
| 1163 | Ga0500644_0017444 | |||
| 1164 | Ga0500651_0130954 | |||
| 1165 | Ga0500641_0011715 | |||
| 1166 | Ga0500556_0001092 | |||
| 1167 | Ga0500569_012538 | |||
| 1168 | Ga0500593_004470 | |||
| 1169 | Ga0500652_009533 | |||
| 1170 | Ga0500573_0018194 | |||
| 1171 | Ga0500577_0007334 | |||
| 1172 | Ga0466962_0006925 | |||
| 1173 | Ga0466962_0011869 | |||
| 1174 | Ga0466962_0016610 | |||
| 1175 | Ga0466962_0029009 | |||
| 1176 | Ga0466962_0037381 | |||
| 1177 | Ga0466962_0059534 | |||
| 1178 | Ga0466962_0113879 | |||
| 1179 | Ga0530510_0144281 | |||
| 1180 | 2515494413 | |||
| 1181 | 2515719685 | |||
| 1182 | 2515756642 | |||
| 1183 | 2516084996 | |||
| 1184 | 2516088973 | |||
| 1185 | 2558905615 | |||
| 1186 | 2643825950 | |||
| 1187 | 2643891704 | |||
| 1188 | 2643960752 | |||
| 1189 | 2644035731 | |||
| 1190 | 2644089260 | |||
| 1191 | 2644101554 | |||
| 1192 | 2644115617 | |||
| 1193 | 2644319105 | |||
| 1194 | 2644531941 | |||
| 1195 | 2645721717 | |||
| 1196 | 2645724329 | |||
| 1197 | 2738868169 | |||
| 1198 | 2753265780 | |||
| 1199 | 2791910520 | |||
| 1200 | 2809196283 | |||
| 1201 | 2812333098 | |||
| 1202 | 2855387019 | |||
| 1203 | 2866618470 | |||
| 1204 | 2870787845 | |||
| 1205 | 2891970839 | |||
| 1206 | 2899367065 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rfq-assembly1.cif.gz_C | crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 | 0.9841 | 9 | 392 |
| 2rfq-assembly1.cif.gz_D | crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 | 0.983 | 9 | 392 |
| 3afe-assembly1.cif.gz_C | crystal structure of the hsaa monooxygenase from m.tuberculosis | 0.9772 | 6 | 392 |
| 3afe-assembly1.cif.gz_B | crystal structure of the hsaa monooxygenase from m.tuberculosis | 0.977 | 6 | 392 |
| 2rfq-assembly1.cif.gz_B | crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 | 0.9762 | 9 | 392 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3afeA01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 1 | 6 | 112 | 1.10.540.10 |
| 2rfqB01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9962 | 11 | 112 | 1.10.540.10 |
| 3afeA01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9817 | 6 | 112 | 1.10.540.10 |
| 3afeD02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9643 | 114 | 208 | 2.40.110.10 |
| af_O05773_204_374_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9476 | 226 | 389 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0PPE9-F1-model_v4 | deleted | 0.987 | 9 | 392 |
|
| AF-A0A6L3VWV4-F1-model_v4 | Flavin-dependent monooxygenase | 0.9859 | 6 | 392 |
GO:0003995
GO:0005737 GO:0016712 GO:0033539 GO:0050660 |
| AF-A0A6L3VWV4-F1-model_v4 | Flavin-dependent monooxygenase | 0.9809 | 6 | 392 |
GO:0003995
GO:0005737 GO:0016712 GO:0033539 GO:0050660 |
| AF-A0A351A552-F1-model_v4 | Flavin-dependent monooxygenase | 0.9788 | 7 | 148 |
GO:0004497
GO:0016627 GO:0050660 |
| AF-A0A537TNY1-F1-model_v4 | Flavin-dependent monooxygenase | 0.9737 | 21 | 392 |
GO:0003995
GO:0005737 GO:0016712 GO:0033539 GO:0050660 |