F468145

General Info

Members Datasets Scaffolds Average Seq Length
602 309 1204 177

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100212130|Ga0070694_1002121302
Length 185
Sequence MLARMTALSAEIGQTALDIVVADITTLDVDAIVNAANRSLLGGGGVDGAIHRTAGPDLLAECRTLDGCETGSAKITRGYRLKARHVIHAVGPVWGGHEDEEGLLAGCYRTALDLVAANNLRSVAYPAISTGIYRFPPDLAARIAVGTVASEIAARPRGIARVIFCCFSPDSAEHHKDAFAGLGLV

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 5.81
Rhizosphere 90.2
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100212130 3300005444 Bacteria 1448
2 JGI24739J22299_10021600 3300001989 Bacteria 2290
3 JGI25405J52794_10001194 3300003911 Bacteria 4203
4 Ga0070658_10027098 3300005327 Bacteria 4600
5 Ga0070690_100003993 3300005330 Bacteria 8156
6 Ga0070680_100050680 3300005336 Bacteria 3386
7 Ga0070682_100028050 3300005337 Bacteria 3384
8 Ga0070682_100105891 3300005337 Bacteria 1865
9 Ga0070660_100223740 3300005339 Bacteria 1530
10 Ga0070689_100003169 3300005340 Bacteria 10878
11 Ga0070691_10003200 3300005341 Bacteria 7335
12 Ga0070687_100007601 3300005343 Bacteria 4532
13 Ga0070692_10004911 3300005345 Bacteria 5633
14 Ga0070668_100008207 3300005347 Bacteria 7754
15 Ga0070668_100053344 3300005347 Bacteria 3118
16 Ga0070669_100006407 3300005353 Bacteria 8473
17 Ga0070675_100111970 3300005354 Bacteria 2310
18 Ga0070671_100006812 3300005355 Bacteria 9145
19 Ga0070674_100003624 3300005356 Bacteria 8692
20 Ga0070673_100039574 3300005364 Bacteria 3609
21 Ga0070659_100008845 3300005366 Bacteria 7378
22 Ga0070659_100011030 3300005366 Bacteria 6675
23 Ga0070659_100674706 3300005366 Bacteria 892
24 Ga0070667_100010942 3300005367 Bacteria 7504
25 Ga0070667_100062475 3300005367 Bacteria 3155
26 Ga0070709_10546071 3300005434 Bacteria 886
27 Ga0070709_11351465 3300005434 Bacteria 576
28 Ga0070714_100141129 3300005435 Bacteria 2163
29 Ga0070714_100238228 3300005435 Bacteria 1679
30 Ga0070713_100005976 3300005436 Bacteria 8373
31 Ga0070701_10024804 3300005438 Bacteria 2904
32 Ga0070701_10162696 3300005438 Bacteria 1294
33 Ga0070711_100063100 3300005439 Bacteria 2585
34 Ga0070711_100200426 3300005439 Bacteria 1540
35 Ga0070705_100008363 3300005440 Bacteria 5124
36 Ga0070700_100004693 3300005441 Bacteria 7166
37 Ga0070694_100004919 3300005444 Bacteria 8053
38 Ga0070663_100005405 3300005455 Bacteria 7588
39 Ga0070678_100013818 3300005456 Bacteria 5074
40 Ga0070662_100265975 3300005457 Bacteria 1383
41 Ga0070662_100326479 3300005457 Bacteria 1252
42 Ga0070662_100655434 3300005457 Bacteria 886
43 Ga0070681_10033541 3300005458 Bacteria 5153
44 Ga0070681_10214714 3300005458 Bacteria 1840
45 Ga0068867_100026859 3300005459 Bacteria 4136
46 Ga0070685_10251266 3300005466 Bacteria 1171
47 Ga0070699_100015756 3300005518 Bacteria 6490
48 Ga0070699_100403670 3300005518 Unclassified 1236
49 Ga0070679_100009044 3300005530 Bacteria 9397
50 Ga0070684_100004147 3300005535 Bacteria 10974
51 Ga0070684_100099577 3300005535 Bacteria 2594
52 Ga0070697_100008926 3300005536 Bacteria 7830
53 Ga0070697_100334451 3300005536 Bacteria 1306
54 Ga0068853_100043532 3300005539 Bacteria 3841
55 Ga0070672_100094446 3300005543 Bacteria 2417
56 Ga0070686_100020155 3300005544 Bacteria 3943
57 Ga0070686_100264061 3300005544 Bacteria 1263
58 Ga0070686_100542887 3300005544 Bacteria 908
59 Ga0070696_100014491 3300005546 Bacteria 5290
60 Ga0070693_100009520 3300005547 Bacteria 4832
61 Ga0070693_100010287 3300005547 Bacteria 4683
62 Ga0070693_100024346 3300005547 Bacteria 3245
63 Ga0070665_100010334 3300005548 Bacteria 9442
64 Ga0070665_100045542 3300005548 Bacteria 4405
65 Ga0070665_100251053 3300005548 Bacteria 1770
66 Ga0070665_100309367 3300005548 Bacteria 1583
67 Ga0070704_100002515 3300005549 Bacteria 10312
68 Ga0070704_100696168 3300005549 Bacteria 901
69 Ga0068855_100021836 3300005563 Bacteria 7677
70 Ga0068855_100057391 3300005563 Bacteria 4564
71 Ga0070664_100010044 3300005564 Bacteria 7672
72 Ga0068857_100032033 3300005577 Bacteria 4647
73 Ga0068857_100061168 3300005577 Bacteria 3345
74 Ga0068854_100022937 3300005578 Bacteria 4258
75 Ga0068856_100057512 3300005614 Bacteria 3839
76 Ga0068856_100151383 3300005614 Bacteria 2329
77 Ga0070702_100010691 3300005615 Bacteria 4533
78 Ga0068852_100135695 3300005616 Bacteria 2272
79 Ga0068859_100015267 3300005617 Bacteria 7713
80 Ga0068859_100289391 3300005617 Bacteria 1731
81 Ga0068864_100010782 3300005618 Bacteria 7552
82 Ga0068864_100059298 3300005618 Bacteria 3311
83 Ga0068864_101071037 3300005618 Bacteria 801
84 Ga0068866_10074744 3300005718 Bacteria 1802
85 Ga0068866_10442569 3300005718 Bacteria 848
86 Ga0068861_100010451 3300005719 Bacteria 6443
87 Ga0068861_100093025 3300005719 Bacteria 2383
88 Ga0068851_10150209 3300005834 Bacteria 1273
89 Ga0068870_10318185 3300005840 Bacteria 988
90 Ga0068863_100003180 3300005841 Bacteria 16236
91 Ga0068863_100344785 3300005841 Bacteria 1450
92 Ga0068858_100029156 3300005842 Bacteria 5124
93 Ga0068858_100055626 3300005842 Bacteria 3658
94 Ga0068858_100106843 3300005842 Bacteria 2612
95 Ga0068860_100008580 3300005843 Bacteria 10188
96 Ga0068862_100035434 3300005844 Bacteria 4226
97 Ga0068862_100103146 3300005844 Bacteria 2497
98 Ga0081455_10000002 3300005937 Bacteria 460472
99 Ga0081455_10001108 3300005937 Bacteria 33842
100 Ga0081455_10068786 3300005937 Bacteria 2946
101 Ga0081539_10056668 3300005985 Bacteria 2173
102 Ga0070717_10039263 3300006028 Bacteria 3851
103 Ga0075365_10000908 3300006038 Bacteria 12433
104 Ga0075365_10273268 3300006038 Bacteria 1189
105 Ga0075368_10038194 3300006042 Bacteria 1879
106 Ga0075363_100141981 3300006048 Bacteria 1352
107 Ga0075364_10007090 3300006051 Bacteria 6626
108 Ga0075432_10013834 3300006058 Bacteria 2745
109 Ga0070715_10000602 3300006163 Bacteria 9501
110 Ga0070715_10081747 3300006163 Bacteria 1468
111 Ga0070716_100004542 3300006173 Bacteria 6651
112 Ga0070716_100202582 3300006173 Bacteria 1320
113 Ga0070716_100347824 3300006173 Bacteria 1048
114 Ga0070716_100752943 3300006173 Bacteria 750
115 Ga0070712_100017867 3300006175 Bacteria 4596
116 Ga0070712_100208257 3300006175 Bacteria 1541
117 Ga0075362_10010188 3300006177 Bacteria 3663
118 Ga0075367_10000841 3300006178 Bacteria 12199
119 Ga0075367_10048819 3300006178 Bacteria 2494
120 Ga0097621_100192123 3300006237 Bacteria 1768
121 Ga0075370_10023723 3300006353 Bacteria 3382
122 Ga0068871_100041142 3300006358 Bacteria 3704
123 Ga0075428_100003846 3300006844 Bacteria 16484
124 Ga0075428_100084913 3300006844 Bacteria 3453
125 Ga0075428_100526692 3300006844 Bacteria 1264
126 Ga0075430_100823025 3300006846 Bacteria 765
127 Ga0075431_100063517 3300006847 Bacteria 3811
128 Ga0075431_100149755 3300006847 Bacteria 2403
129 Ga0075431_100996259 3300006847 Bacteria 805
130 Ga0075433_10023452 3300006852 Bacteria 5194
131 Ga0075434_100759468 3300006871 Bacteria 986
132 Ga0075434_100860506 3300006871 Bacteria 922
133 Ga0075429_100009391 3300006880 Bacteria 8492
134 Ga0068865_100024505 3300006881 Bacteria 3959
135 Ga0068865_100207961 3300006881 Bacteria 1523
136 Ga0075436_100022632 3300006914 Bacteria 4317
137 Ga0075436_100391712 3300006914 Bacteria 1006
138 Ga0097620_100015267 3300006931 Bacteria 7713
139 Ga0097620_100041043 3300006931 Bacteria 4648
140 Ga0097620_100289400 3300006931 Bacteria 1731
141 Ga0075435_100154572 3300007076 Bacteria 1930
142 Ga0105250_10016807 3300009092 Bacteria 2978
143 Ga0105245_10388723 3300009098 Bacteria 1391
144 Ga0105247_10002622 3300009101 Bacteria 12145
145 Ga0105243_10008434 3300009148 Bacteria 7912
146 Ga0105243_10204770 3300009148 Bacteria 1733
147 Ga0105241_10065012 3300009174 Bacteria 2818
148 Ga0105241_10559167 3300009174 Bacteria 1028
149 Ga0105248_10014102 3300009177 Bacteria 8795
150 Ga0105248_10033863 3300009177 Bacteria 5708
151 Ga0105237_10000878 3300009545 Bacteria 40706
152 Ga0105237_10109817 3300009545 Bacteria 2750
153 Ga0105238_10031082 3300009551 Bacteria 5436
154 Ga0105249_10020214 3300009553 Bacteria 5951
155 Ga0105249_10083553 3300009553 Bacteria 2973
156 Ga0099796_10082933 3300010159 Bacteria 1179
157 Ga0105239_10029242 3300010375 Bacteria 6059
158 Ga0105239_10045501 3300010375 Bacteria 4810
159 Ga0105239_10164164 3300010375 Bacteria 2483
160 Ga0105246_10065541 3300011119 Bacteria 2540
161 Ga0105246_10123520 3300011119 Bacteria 1922
162 Ga0157373_10019957 3300013100 Bacteria 4876
163 Ga0157373_10025701 3300013100 Bacteria 4257
164 Ga0157370_10007741 3300013104 Bacteria 11648
165 Ga0157370_10244815 3300013104 Bacteria 1659
166 Ga0157370_10249234 3300013104 Bacteria 1643
167 Ga0157369_10063264 3300013105 Bacteria 3987
168 Ga0157369_10070327 3300013105 Bacteria 3760
169 Ga0157374_10058606 3300013296 Bacteria 3598
170 Ga0157374_10385483 3300013296 Bacteria 1396
171 Ga0163162_10120442 3300013306 Bacteria 2728
172 Ga0157372_10017960 3300013307 Bacteria 7601
173 Ga0157372_10031292 3300013307 Bacteria 5826
174 Ga0157372_10240827 3300013307 Bacteria 2099
175 Ga0157375_10042791 3300013308 Bacteria 4387
176 Ga0157375_10153516 3300013308 Bacteria 2440
177 Ga0157375_10357660 3300013308 Bacteria 1626
178 Ga0157375_10414297 3300013308 Bacteria 1513
179 Ga0163163_10013681 3300014325 Bacteria 7433
180 Ga0163163_10118499 3300014325 Bacteria 2680
181 Ga0157380_10006192 3300014326 Bacteria 8395
182 Ga0157380_10384159 3300014326 Bacteria 1326
183 Ga0157380_10863714 3300014326 Bacteria 928
184 Ga0157379_11188010 3300014968 Bacteria 733
185 Ga0157376_10006307 3300014969 Bacteria 8370
186 Ga0157376_10067216 3300014969 Bacteria 3031
187 Ga0157376_10072702 3300014969 Bacteria 2926
188 Ga0163161_10003188 3300017792 Bacteria 11542
189 Ga0206356_10188763 3300020070 Bacteria 1173
190 Ga0213873_10078809 3300021358 Bacteria 919
191 Ga0213876_10007613 3300021384 Bacteria 5879
192 Ga0213875_10114780 3300021388 Bacteria 1258
193 Ga0207697_10089271 3300025315 Bacteria 1305
194 Ga0207656_10146815 3300025321 Bacteria 1115
195 Ga0207653_10017603 3300025885 Bacteria 2250
196 Ga0207692_10057541 3300025898 Bacteria 2000
197 Ga0207710_10078188 3300025900 Bacteria 1530
198 Ga0207680_10302349 3300025903 Bacteria 1115
199 Ga0207647_10041403 3300025904 Bacteria 2896
200 Ga0207685_10048861 3300025905 Bacteria 1623
201 Ga0207685_10087473 3300025905 Bacteria 1304
202 Ga0207699_10093055 3300025906 Bacteria 1896
203 Ga0207645_10084892 3300025907 Bacteria 2032
204 Ga0207643_10404331 3300025908 Bacteria 864
205 Ga0207705_10261891 3300025909 Bacteria 1320
206 Ga0207654_10049671 3300025911 Bacteria 2407
207 Ga0207654_10463309 3300025911 Bacteria 890
208 Ga0207707_10016386 3300025912 Bacteria 6464
209 Ga0207707_10041525 3300025912 Bacteria 4017
210 Ga0207707_10175916 3300025912 Bacteria 1870
211 Ga0207695_10713988 3300025913 Bacteria 883
212 Ga0207671_10552694 3300025914 Bacteria 918
213 Ga0207693_10001757 3300025915 Bacteria 19030
214 Ga0207693_10046227 3300025915 Bacteria 3419
215 Ga0207663_10092408 3300025916 Bacteria 2011
216 Ga0207663_10205053 3300025916 Bacteria 1425
217 Ga0207663_10697112 3300025916 Bacteria 804
218 Ga0207660_10007194 3300025917 Bacteria 7203
219 Ga0207660_10063951 3300025917 Bacteria 2654
220 Ga0207662_10003632 3300025918 Bacteria 7981
221 Ga0207657_10010226 3300025919 Bacteria 9370
222 Ga0207657_10043794 3300025919 Bacteria 3939
223 Ga0207649_10033014 3300025920 Bacteria 3089
224 Ga0207652_10044534 3300025921 Bacteria 3780
225 Ga0207652_10867685 3300025921 Bacteria 799
226 Ga0207646_10638907 3300025922 Bacteria 954
227 Ga0207694_10323891 3300025924 Bacteria 1272
228 Ga0207659_10021430 3300025926 Bacteria 4289
229 Ga0207700_10021362 3300025928 Bacteria 4418
230 Ga0207700_10024727 3300025928 Bacteria 4161
231 Ga0207664_10132622 3300025929 Bacteria 2099
232 Ga0207664_10284069 3300025929 Bacteria 1453
233 Ga0207644_10128164 3300025931 Bacteria 1939
234 Ga0207690_10018038 3300025932 Bacteria 4322
235 Ga0207690_10185702 3300025932 Bacteria 1568
236 Ga0207690_10363168 3300025932 Bacteria 1147
237 Ga0207706_10010825 3300025933 Bacteria 8321
238 Ga0207706_10240724 3300025933 Bacteria 1582
239 Ga0207706_10268502 3300025933 Bacteria 1489
240 Ga0207686_10004384 3300025934 Bacteria 7567
241 Ga0207709_10149259 3300025935 Bacteria 1617
242 Ga0207709_10245791 3300025935 Bacteria 1304
243 Ga0207709_10424901 3300025935 Bacteria 1022
244 Ga0207704_10542023 3300025938 Bacteria 944
245 Ga0207665_10005563 3300025939 Bacteria 8402
246 Ga0207665_10469211 3300025939 Bacteria 968
247 Ga0207665_10844635 3300025939 Bacteria 725
248 Ga0207691_10043162 3300025940 Bacteria 4156
249 Ga0207689_10065249 3300025942 Bacteria 2995
250 Ga0207661_10074121 3300025944 Bacteria 2790
251 Ga0207667_10204464 3300025949 Bacteria 2025
252 Ga0207712_10971413 3300025961 Bacteria 753
253 Ga0207668_10004655 3300025972 Bacteria 8067
254 Ga0207668_10045383 3300025972 Bacteria 2997
255 Ga0207668_10922803 3300025972 Bacteria 778
256 Ga0207640_10148307 3300025981 Bacteria 1720
257 Ga0207640_10585773 3300025981 Bacteria 942
258 Ga0207640_10774323 3300025981 Bacteria 829
259 Ga0207703_10128323 3300026035 Bacteria 2186
260 Ga0207639_10014112 3300026041 Bacteria 5610
261 Ga0207639_10074597 3300026041 Bacteria 2664
262 Ga0207678_10002695 3300026067 Bacteria 16103
263 Ga0207678_10009458 3300026067 Bacteria 8574
264 Ga0207678_10023671 3300026067 Bacteria 5371
265 Ga0207708_10319413 3300026075 Bacteria 1267
266 Ga0207702_10181041 3300026078 Bacteria 1941
267 Ga0207648_10040729 3300026089 Bacteria 4081
268 Ga0207676_10198400 3300026095 Bacteria 1771
269 Ga0207676_10369106 3300026095 Bacteria 1332
270 Ga0207674_10016024 3300026116 Bacteria 8211
271 Ga0207674_10040295 3300026116 Bacteria 4840
272 Ga0207675_100018613 3300026118 Bacteria 6480
273 Ga0207675_100018950 3300026118 Bacteria 6424
274 Ga0207675_100149303 3300026118 Bacteria 2224
275 Ga0207683_10008823 3300026121 Bacteria 8599
276 Ga0207698_10092476 3300026142 Bacteria 2480
277 Ga0209983_1009245 3300027665 Bacteria 2014
278 Ga0209974_10031421 3300027876 Bacteria 1758
279 Ga0268266_10020476 3300028379 Bacteria 5638
280 Ga0268266_10384538 3300028379 Bacteria 1324
281 Ga0268265_10148205 3300028380 Bacteria 1975
282 Ga0268265_10296188 3300028380 Bacteria 1454
283 Ga0268264_10130696 3300028381 Bacteria 2225
284 Ga0265338_10078068 3300028800 Bacteria 2794
285 Ga0265330_10157176 3300031235 Bacteria 965
286 Ga0265339_10095471 3300031249 Bacteria 1553
287 Ga0265316_10198180 3300031344 Bacteria 1489
288 Ga0265316_10385068 3300031344 Unclassified 1011
289 Ga0307513_10073469 3300031456 Bacteria 3560
290 Ga0265314_10064623 3300031711 Bacteria 2476
291 Ga0265342_10064028 3300031712 Bacteria 2159
292 Ga0316583_10002728 3300032133 Bacteria 6173
293 Ga0373948_0014131 3300034817 Bacteria 1451
294 Ga0373926_0087999 3300035083 Bacteria 1153
295 Ga0373928_0009242 3300035084 Bacteria 1924
296 Ga0373936_0077955 3300035113 Bacteria 1375
297 Ga0373945_0013875 3300035116 Bacteria 2694
298 Ga0373954_0251529 3300035118 Bacteria 870
299 Ga0373943_0090211 3300035170 Bacteria 1586
300 Ga0373943_0261785 3300035170 Bacteria 974
301 Ga0373946_0055797 3300035171 Bacteria 1666
302 Ga0373955_0101101 3300035172 Bacteria 1655
303 Ga0373942_0066785 3300035207 Unclassified 1042
304 Ga0373931_0019412 3300035691 Bacteria 3393
305 Ga0373931_0032772 3300035691 Bacteria 2690
306 Ga0373931_0129786 3300035691 Bacteria 1449
307 Ga0373927_0016170 3300035695 Bacteria 4923
308 Ga0373933_0018191 3300035724 Bacteria 3949
309 Ga0373947_0070905 3300035725 Bacteria 2136
310 Ga0373947_0317191 3300035725 Bacteria 1042
311 Ga0373937_0098426 3300036401 Bacteria 2713
312 Ga0373937_0162805 3300036401 Bacteria 2092
313 Ga0316582_0152645 3300036647 Bacteria 1562
314 Ga0373925_0033664 3300037068 Bacteria 3775
315 Ga0395899_0401672 3300037312 Bacteria 907
316 Ga0395900_0019961 3300037418 Bacteria 6831
317 Ga0395905_0001184 3300037471 Bacteria 32610
318 Ga0395905_1121745 3300037471 Bacteria 690
319 Ga0436364_0169255 3300037853 Bacteria 1104
320 Ga0436364_1052957 3300037853 Bacteria 1307
321 Ga0436364_1189360 3300037853 Bacteria 1416
322 Ga0395901_0290978 3300038443 Bacteria 1695
323 Ga0395901_1034797 3300038443 Bacteria 795
324 Ga0436365_0326704 3300039437 Bacteria 29811
325 Ga0436360_0104681 3300039438 Bacteria 3882
326 Ga0436360_0263699 3300039438 Bacteria 798
327 Ga0436360_0451182 3300039438 Bacteria 2282
328 Ga0436361_0809138 3300039447 Bacteria 2197
329 Ga0436362_0037740 3300039453 Bacteria 1421
330 Ga0439448_0085742 3300042005 Bacteria 1061
331 Ga0439460_0057767 3300042461 Bacteria 1178
332 Ga0453683_0000998 3300044673 Bacteria 26602
333 Ga0453684_0005410 3300044712 Bacteria 25318
334 Ga0453684_0411072 3300044712 Bacteria 1513
335 Ga0451576_0023264 3300045051 Bacteria 6711
336 Ga0451576_0221650 3300045051 Bacteria 1975
337 Ga0451576_0718338 3300045051 Bacteria 1050
338 Ga0495603_0000026 3300046455 Bacteria 61348
339 Ga0495629_0001467 3300046459 Bacteria 18588
340 Ga0495641_0032215 3300046461 Bacteria 2496
341 Ga0495580_0002524 3300046472 Bacteria 15974
342 Ga0495582_0000385 3300046473 Bacteria 24035
343 Ga0495639_0000233 3300046475 Bacteria 27728
344 Ga0495584_0104273 3300046491 Bacteria 1434
345 Ga0495606_0223434 3300046507 Bacteria 1060
346 Ga0495608_0014614 3300046511 Bacteria 5446
347 Ga0495643_0298710 3300046522 Bacteria 735
348 Ga0495652_0088629 3300046529 Bacteria 2535
349 Ga0495652_0156695 3300046529 Bacteria 1773
350 Ga0495665_0027683 3300046531 Bacteria 3041
351 Ga0495587_0242522 3300046536 Bacteria 1014
352 Ga0495622_0000481 3300046557 Bacteria 25103
353 Ga0495667_0391078 3300046559 Bacteria 876
354 Ga0495634_0022887 3300046642 Bacteria 4399
355 Ga0495588_0012099 3300046674 Bacteria 4068
356 Ga0495658_0010712 3300046683 Bacteria 4590
357 Ga0495613_0000386 3300046689 Bacteria 38025
358 Ga0495660_0265888 3300046810 Bacteria 790
359 Ga0495581_0006648 3300047315 Bacteria 6698
360 Ga0495676_0007864 3300047321 Bacteria 9779
361 Ga0495680_0008171 3300047322 Bacteria 9541
362 Ga0495686_0400510 3300047472 Bacteria 737
363 Ga0495593_0000434 3300047673 Bacteria 23326
364 Ga0495602_0306702 3300048088 Bacteria 1160
365 Ga0495614_0009828 3300048089 Bacteria 4226
366 Ga0495614_0012601 3300048089 Bacteria 3709
367 Ga0496100_0218265 3300048903 Bacteria 1398
368 Ga0496101_0204218 3300048904 Bacteria 1528
369 Ga0496102_0047983 3300048905 Bacteria 3882
370 Ga0496102_0580722 3300048905 Bacteria 1043
371 Ga0496103_0634302 3300048906 Bacteria 679
372 Ga0496104_0057153 3300048907 Bacteria 3692
373 Ga0496104_0068629 3300048907 Bacteria 3369
374 Ga0496105_0142122 3300048908 Bacteria 1975
375 Ga0496105_0195785 3300048908 Bacteria 1651
376 Ga0496106_0041230 3300048909 Bacteria 3459
377 Ga0496106_0049588 3300048909 Bacteria 3163
378 Ga0496106_0068013 3300048909 Bacteria 2716
379 Ga0496106_0548540 3300048909 Bacteria 927
380 Ga0496107_0024669 3300048910 Bacteria 4254
381 Ga0496107_0041799 3300048910 Bacteria 3292
382 Ga0496107_0161132 3300048910 Bacteria 1663
383 Ga0496107_0198004 3300048910 Bacteria 1493
384 Ga0496108_0707169 3300048911 Bacteria 873
385 Ga0496109_0049104 3300048912 Bacteria 3841
386 Ga0496109_0112316 3300048912 Bacteria 2534
387 Ga0496109_0186971 3300048912 Bacteria 1946
388 Ga0496109_0247805 3300048912 Bacteria 1677
389 Ga0496110_0036161 3300048913 Bacteria 4287
390 Ga0496110_0382187 3300048913 Bacteria 1283
391 Ga0496111_0013683 3300048914 Bacteria 5525
392 Ga0496112_0029146 3300048915 Bacteria 5336
393 Ga0496112_0522498 3300048915 Bacteria 1121
394 Ga0496112_0995994 3300048915 Bacteria 758
395 Ga0496113_0160120 3300048916 Bacteria 1779
396 Ga0496113_0276910 3300048916 Bacteria 1341
397 Ga0496114_0043548 3300048917 Bacteria 3722
398 Ga0496114_0103340 3300048917 Bacteria 2435
399 Ga0496114_0743807 3300048917 Bacteria 858
400 Ga0496115_0040043 3300048918 Bacteria 3724
401 Ga0496115_0220631 3300048918 Bacteria 1565
402 Ga0501031_0078400 3300049568 Bacteria 2153
403 Ga0501031_0181985 3300049568 Bacteria 1373
404 Ga0501033_0037432 3300049570 Bacteria 3632
405 Ga0501033_0107902 3300049570 Bacteria 2028
406 Ga0501034_0502015 3300049571 Bacteria 1127
407 Ga0501036_0008919 3300049572 Bacteria 8242
408 Ga0501036_0024555 3300049572 Bacteria 5082
409 Ga0501036_0053008 3300049572 Bacteria 3435
410 Ga0501036_0130954 3300049572 Bacteria 2118
411 Ga0501036_0662625 3300049572 Unclassified 864
412 Ga0501037_0019432 3300049573 Bacteria 5012
413 Ga0501037_0040288 3300049573 Bacteria 3437
414 Ga0501037_0120587 3300049573 Bacteria 1886
415 Ga0501037_0300884 3300049573 Unclassified 1114
416 Ga0501038_0005001 3300049574 Bacteria 12310
417 Ga0501038_0023931 3300049574 Bacteria 5454
418 Ga0501038_0027727 3300049574 Bacteria 5035
419 Ga0501038_0150756 3300049574 Bacteria 1896
420 Ga0501038_0194423 3300049574 Bacteria 1631
421 Ga0501039_0009395 3300049575 Bacteria 7453
422 Ga0501039_0064235 3300049575 Bacteria 2845
423 Ga0501039_0084666 3300049575 Bacteria 2470
424 Ga0501039_0106419 3300049575 Bacteria 2191
425 Ga0501039_0109087 3300049575 Bacteria 2163
426 Ga0501039_0128629 3300049575 Bacteria 1987
427 Ga0501039_0144659 3300049575 Bacteria 1868
428 Ga0501040_0003295 3300049576 Bacteria 10434
429 Ga0501040_0037610 3300049576 Bacteria 3289
430 Ga0501040_0039403 3300049576 Bacteria 3213
431 Ga0501040_0058716 3300049576 Bacteria 2642
432 Ga0501040_0173096 3300049576 Bacteria 1529
433 Ga0501040_0186508 3300049576 Bacteria 1471
434 Ga0501041_0002841 3300049577 Bacteria 9908
435 Ga0501041_0005550 3300049577 Bacteria 7377
436 Ga0501041_0048435 3300049577 Bacteria 2588
437 Ga0501041_0147976 3300049577 Bacteria 1466
438 Ga0501041_0196440 3300049577 Bacteria 1264
439 Ga0501041_0201407 3300049577 Bacteria 1248
440 Ga0501041_0516401 3300049577 Bacteria 760
441 Ga0501042_0008617 3300049578 Bacteria 6748
442 Ga0501042_0073942 3300049578 Bacteria 2438
443 Ga0501042_0094815 3300049578 Bacteria 2143
444 Ga0501042_0097683 3300049578 Bacteria 2111
445 Ga0501042_0141698 3300049578 Bacteria 1733
446 Ga0501042_0305824 3300049578 Bacteria 1149
447 Ga0501042_0438225 3300049578 Bacteria 947
448 Ga0501042_0758668 3300049578 Bacteria 706
449 Ga0501042_0958879 3300049578 Bacteria 623
450 Ga0501043_0450726 3300049579 Bacteria 967
451 Ga0501046_0012532 3300049580 Bacteria 7211
452 Ga0501046_0017612 3300049580 Bacteria 5958
453 Ga0501046_0241269 3300049580 Bacteria 1333
454 Ga0501046_0366148 3300049580 Bacteria 1045
455 Ga0501046_0412388 3300049580 Bacteria 974
456 Ga0501046_0457388 3300049580 Bacteria 917
457 Ga0501047_0320506 3300049581 Bacteria 1390
458 Ga0501048_0003031 3300049582 Bacteria 12824
459 Ga0501048_0021937 3300049582 Bacteria 4674
460 Ga0501048_0059188 3300049582 Bacteria 2715
461 Ga0501048_0170245 3300049582 Bacteria 1543
462 Ga0501048_0458429 3300049582 Bacteria 913
463 Ga0501067_0123826 3300049583 Bacteria 1439
464 Ga0501068_0020830 3300049584 Bacteria 3826
465 Ga0501068_0023205 3300049584 Bacteria 3634
466 Ga0501068_0110137 3300049584 Bacteria 1712
467 Ga0501068_0161455 3300049584 Bacteria 1412
468 Ga0501069_0023473 3300049585 Bacteria 3364
469 Ga0501070_0083605 3300049586 Bacteria 2643
470 Ga0501070_0182665 3300049586 Bacteria 1726
471 Ga0501070_0216861 3300049586 Bacteria 1570
472 Ga0501070_0283389 3300049586 Bacteria 1352
473 Ga0501070_0317682 3300049586 Bacteria 1267
474 Ga0501071_0003312 3300049587 Bacteria 10059
475 Ga0501071_0010710 3300049587 Bacteria 6150
476 Ga0501071_0059045 3300049587 Bacteria 2775
477 Ga0501071_0069508 3300049587 Bacteria 2564
478 Ga0501071_0074215 3300049587 Bacteria 2482
479 Ga0501071_0116463 3300049587 Bacteria 1978
480 Ga0501071_0117638 3300049587 Bacteria 1968
481 Ga0501071_0160749 3300049587 Bacteria 1679
482 Ga0501071_0210914 3300049587 Bacteria 1460
483 Ga0501071_0283943 3300049587 Bacteria 1253
484 Ga0501071_0487076 3300049587 Bacteria 945
485 Ga0501072_0000996 3300049588 Bacteria 20934
486 Ga0501072_0004975 3300049588 Bacteria 10108
487 Ga0501072_0017201 3300049588 Bacteria 5557
488 Ga0501072_0038288 3300049588 Bacteria 3763
489 Ga0501072_0046400 3300049588 Bacteria 3419
490 Ga0501072_0143835 3300049588 Bacteria 1901
491 Ga0501072_0235447 3300049588 Bacteria 1458
492 Ga0501072_0484832 3300049588 Bacteria 978
493 Ga0501072_0694216 3300049588 Bacteria 800
494 Ga0501072_0828669 3300049588 Bacteria 724
495 Ga0501073_0651442 3300049589 Bacteria 727
496 Ga0501074_0012927 3300049590 Bacteria 6069
497 Ga0501074_0057590 3300049590 Bacteria 2799
498 Ga0501074_0319121 3300049590 Bacteria 1103
499 Ga0501074_0325208 3300049590 Bacteria 1092
500 Ga0501075_0028634 3300049591 Bacteria 4112
501 Ga0501075_0037651 3300049591 Bacteria 3614
502 Ga0501075_0098146 3300049591 Bacteria 2224
503 Ga0501075_0109388 3300049591 Bacteria 2101
504 Ga0501075_0129532 3300049591 Bacteria 1922
505 Ga0501075_0258016 3300049591 Bacteria 1328
506 Ga0501076_0008194 3300049592 Bacteria 7653
507 Ga0501076_0017390 3300049592 Bacteria 5464
508 Ga0501076_0032407 3300049592 Bacteria 4078
509 Ga0501076_0056933 3300049592 Bacteria 3103
510 Ga0501076_0106056 3300049592 Bacteria 2268
511 Ga0501076_0125512 3300049592 Bacteria 2079
512 Ga0501076_0242090 3300049592 Bacteria 1476
513 Ga0501076_0254703 3300049592 Bacteria 1437
514 Ga0501076_0770514 3300049592 Bacteria 794
515 Ga0501077_0009076 3300049593 Bacteria 6174
516 Ga0501077_0029435 3300049593 Bacteria 3490
517 Ga0501077_0046923 3300049593 Bacteria 2744
518 Ga0501077_0098169 3300049593 Bacteria 1857
519 Ga0501077_0138586 3300049593 Bacteria 1542
520 Ga0501077_0165123 3300049593 Bacteria 1406
521 Ga0501077_0208370 3300049593 Bacteria 1242
522 Ga0501077_0305958 3300049593 Bacteria 1013
523 Ga0501077_0425168 3300049593 Bacteria 850
524 Ga0501079_0007319 3300049741 Bacteria 8341
525 Ga0501079_0009820 3300049741 Bacteria 7258
526 Ga0501079_0027470 3300049741 Bacteria 4364
527 Ga0501079_0120965 3300049741 Bacteria 2036
528 Ga0501079_0149819 3300049741 Bacteria 1818
529 Ga0501079_0150479 3300049741 Bacteria 1814
530 Ga0501079_0157669 3300049741 Bacteria 1769
531 Ga0501079_0364558 3300049741 Bacteria 1132
532 Ga0501079_0431042 3300049741 Bacteria 1035
533 Ga0501079_0655595 3300049741 Bacteria 826
534 Ga0501080_0003570 3300049742 Bacteria 13691
535 Ga0501080_0015979 3300049742 Bacteria 6925
536 Ga0501080_0121785 3300049742 Bacteria 2417
537 Ga0501080_0171954 3300049742 Bacteria 1998
538 Ga0501080_0359546 3300049742 Bacteria 1314
539 Ga0501081_0013333 3300049743 Bacteria 5406
540 Ga0501081_0015345 3300049743 Bacteria 5053
541 Ga0501081_0016023 3300049743 Bacteria 4950
542 Ga0501081_0100020 3300049743 Bacteria 2049
543 Ga0501081_0537651 3300049743 Bacteria 872
544 Ga0501081_0623836 3300049743 Bacteria 807
545 Ga0501083_0065447 3300049744 Bacteria 2421
546 Ga0501083_0104034 3300049744 Bacteria 1871
547 Ga0501083_0251608 3300049744 Bacteria 1150
548 Ga0501083_0345891 3300049744 Bacteria 967
549 Ga0501035_0011674 3300049822 Bacteria 8142
550 Ga0501035_0218990 3300049822 Bacteria 1626
551 Ga0501035_0391800 3300049822 Bacteria 1157
552 Ga0501044_0221877 3300049823 Bacteria 1841
553 Ga0501044_0722637 3300049823 Bacteria 880
554 Ga0501045_0000433 3300049824 Bacteria 25593
555 Ga0501045_0006247 3300049824 Bacteria 8244
556 Ga0501045_0023378 3300049824 Bacteria 4429
557 Ga0501045_0143733 3300049824 Bacteria 1774
558 Ga0501045_0183451 3300049824 Bacteria 1559
559 nmdc:mga03683_22138_c1 3300050489 Bacteria 2461
560 nmdc:mga03n38_123757_c1 3300050490 Bacteria 1274
561 nmdc:mga00v17_135068_c1 3300050491 Bacteria 1579
562 nmdc:mga06z11_14125_c1 3300050494 Bacteria 3529
563 nmdc:mga06z11_9136_c1 3300050494 Bacteria 4163
564 nmdc:mga04h51_9002_c1 3300050495 Bacteria 2689
565 nmdc:mga07m45_164160_c1 3300050496 Bacteria 1290
566 nmdc:mga09592_116030_c1 3300050508 Bacteria 2298
567 nmdc:mga0qj67_534696_c1 3300050509 Bacteria 941
568 nmdc:mga06r32_33912_c1 3300050510 Bacteria 4811
569 nmdc:mga06r32_61915_c1 3300050510 Bacteria 3603
570 nmdc:mga08y16_140287_c1 3300050511 Bacteria 2513
571 nmdc:mga0n895_191968_c1 3300050512 Bacteria 2074
572 nmdc:mga0rr50_293738_c1 3300050513 Bacteria 1358
573 nmdc:mga0rr50_77994_c1 3300050513 Bacteria 2548
574 nmdc:mga08x19_303582_c1 3300050514 Bacteria 1109
575 nmdc:mga08x19_463357_c1 3300050514 Bacteria 893
576 nmdc:mga08x19_746024_c1 3300050514 Bacteria 695
577 nmdc:mga0a205_559055_c1 3300050515 Bacteria 999
578 Ga0495601_0023202 3300053077 Bacteria 3812
579 Ga0495612_0024514 3300053078 Bacteria 2422
580 Ga0495595_0002467 3300053084 Bacteria 7233
581 Ga0495619_0001086 3300053085 Bacteria 17862
582 Ga0495619_0002041 3300053085 Bacteria 13423
583 Ga0495619_0449895 3300053085 Bacteria 888
584 Ga0500628_002051 3300053129 Bacteria 3383
585 Ga0501084_0006611 3300054114 Bacteria 9532
586 Ga0501084_0011834 3300054114 Bacteria 7221
587 Ga0501084_0067118 3300054114 Bacteria 3002
588 Ga0501084_0131785 3300054114 Bacteria 2104
589 Ga0501084_0259075 3300054114 Bacteria 1468
590 Ga0501084_0268530 3300054114 Bacteria 1440
591 Ga0501084_0475870 3300054114 Bacteria 1056
592 Ga0501082_0004184 3300060353 Bacteria 12607
593 Ga0501082_0039976 3300060353 Bacteria 4046
594 Ga0501082_0094463 3300060353 Bacteria 2584
595 Ga0501082_0285576 3300060353 Bacteria 1436
596 Ga0501082_0351774 3300060353 Bacteria 1285
597 Ga0501082_1497697 3300060353 Bacteria 589
598 Ga0530510_0006701 3300061734 Bacteria 8029
599 Ga0530510_0015792 3300061734 Bacteria 5338
600 Ga0530510_0053424 3300061734 Bacteria 2920
601 Ga0530510_0069577 3300061734 Bacteria 2554
602 Ga0530510_0209483 3300061734 Bacteria 1448
603 Ga0070694_100212130
604 JGI24739J22299_10021600
605 JGI25405J52794_10001194
606 Ga0070658_10027098
607 Ga0070690_100003993
608 Ga0070680_100050680
609 Ga0070682_100028050
610 Ga0070682_100105891
611 Ga0070660_100223740
612 Ga0070689_100003169
613 Ga0070691_10003200
614 Ga0070687_100007601
615 Ga0070692_10004911
616 Ga0070668_100008207
617 Ga0070668_100053344
618 Ga0070669_100006407
619 Ga0070675_100111970
620 Ga0070671_100006812
621 Ga0070674_100003624
622 Ga0070673_100039574
623 Ga0070659_100008845
624 Ga0070659_100011030
625 Ga0070659_100674706
626 Ga0070667_100010942
627 Ga0070667_100062475
628 Ga0070709_10546071
629 Ga0070709_11351465
630 Ga0070714_100141129
631 Ga0070714_100238228
632 Ga0070713_100005976
633 Ga0070701_10024804
634 Ga0070701_10162696
635 Ga0070711_100063100
636 Ga0070711_100200426
637 Ga0070705_100008363
638 Ga0070700_100004693
639 Ga0070694_100004919
640 Ga0070663_100005405
641 Ga0070678_100013818
642 Ga0070662_100265975
643 Ga0070662_100326479
644 Ga0070662_100655434
645 Ga0070681_10033541
646 Ga0070681_10214714
647 Ga0068867_100026859
648 Ga0070685_10251266
649 Ga0070699_100015756
650 Ga0070699_100403670
651 Ga0070679_100009044
652 Ga0070684_100004147
653 Ga0070684_100099577
654 Ga0070697_100008926
655 Ga0070697_100334451
656 Ga0068853_100043532
657 Ga0070672_100094446
658 Ga0070686_100020155
659 Ga0070686_100264061
660 Ga0070686_100542887
661 Ga0070696_100014491
662 Ga0070693_100009520
663 Ga0070693_100010287
664 Ga0070693_100024346
665 Ga0070665_100010334
666 Ga0070665_100045542
667 Ga0070665_100251053
668 Ga0070665_100309367
669 Ga0070704_100002515
670 Ga0070704_100696168
671 Ga0068855_100021836
672 Ga0068855_100057391
673 Ga0070664_100010044
674 Ga0068857_100032033
675 Ga0068857_100061168
676 Ga0068854_100022937
677 Ga0068856_100057512
678 Ga0068856_100151383
679 Ga0070702_100010691
680 Ga0068852_100135695
681 Ga0068859_100015267
682 Ga0068859_100289391
683 Ga0068864_100010782
684 Ga0068864_100059298
685 Ga0068864_101071037
686 Ga0068866_10074744
687 Ga0068866_10442569
688 Ga0068861_100010451
689 Ga0068861_100093025
690 Ga0068851_10150209
691 Ga0068870_10318185
692 Ga0068863_100003180
693 Ga0068863_100344785
694 Ga0068858_100029156
695 Ga0068858_100055626
696 Ga0068858_100106843
697 Ga0068860_100008580
698 Ga0068862_100035434
699 Ga0068862_100103146
700 Ga0081455_10000002
701 Ga0081455_10001108
702 Ga0081455_10068786
703 Ga0081539_10056668
704 Ga0070717_10039263
705 Ga0075365_10000908
706 Ga0075365_10273268
707 Ga0075368_10038194
708 Ga0075363_100141981
709 Ga0075364_10007090
710 Ga0075432_10013834
711 Ga0070715_10000602
712 Ga0070715_10081747
713 Ga0070716_100004542
714 Ga0070716_100202582
715 Ga0070716_100347824
716 Ga0070716_100752943
717 Ga0070712_100017867
718 Ga0070712_100208257
719 Ga0075362_10010188
720 Ga0075367_10000841
721 Ga0075367_10048819
722 Ga0097621_100192123
723 Ga0075370_10023723
724 Ga0068871_100041142
725 Ga0075428_100003846
726 Ga0075428_100084913
727 Ga0075428_100526692
728 Ga0075430_100823025
729 Ga0075431_100063517
730 Ga0075431_100149755
731 Ga0075431_100996259
732 Ga0075433_10023452
733 Ga0075434_100759468
734 Ga0075434_100860506
735 Ga0075429_100009391
736 Ga0068865_100024505
737 Ga0068865_100207961
738 Ga0075436_100022632
739 Ga0075436_100391712
740 Ga0097620_100015267
741 Ga0097620_100041043
742 Ga0097620_100289400
743 Ga0075435_100154572
744 Ga0105250_10016807
745 Ga0105245_10388723
746 Ga0105247_10002622
747 Ga0105243_10008434
748 Ga0105243_10204770
749 Ga0105241_10065012
750 Ga0105241_10559167
751 Ga0105248_10014102
752 Ga0105248_10033863
753 Ga0105237_10000878
754 Ga0105237_10109817
755 Ga0105238_10031082
756 Ga0105249_10020214
757 Ga0105249_10083553
758 Ga0099796_10082933
759 Ga0105239_10029242
760 Ga0105239_10045501
761 Ga0105239_10164164
762 Ga0105246_10065541
763 Ga0105246_10123520
764 Ga0157373_10019957
765 Ga0157373_10025701
766 Ga0157370_10007741
767 Ga0157370_10244815
768 Ga0157370_10249234
769 Ga0157369_10063264
770 Ga0157369_10070327
771 Ga0157374_10058606
772 Ga0157374_10385483
773 Ga0163162_10120442
774 Ga0157372_10017960
775 Ga0157372_10031292
776 Ga0157372_10240827
777 Ga0157375_10042791
778 Ga0157375_10153516
779 Ga0157375_10357660
780 Ga0157375_10414297
781 Ga0163163_10013681
782 Ga0163163_10118499
783 Ga0157380_10006192
784 Ga0157380_10384159
785 Ga0157380_10863714
786 Ga0157379_11188010
787 Ga0157376_10006307
788 Ga0157376_10067216
789 Ga0157376_10072702
790 Ga0163161_10003188
791 Ga0206356_10188763
792 Ga0213873_10078809
793 Ga0213876_10007613
794 Ga0213875_10114780
795 Ga0207697_10089271
796 Ga0207656_10146815
797 Ga0207653_10017603
798 Ga0207692_10057541
799 Ga0207710_10078188
800 Ga0207680_10302349
801 Ga0207647_10041403
802 Ga0207685_10048861
803 Ga0207685_10087473
804 Ga0207699_10093055
805 Ga0207645_10084892
806 Ga0207643_10404331
807 Ga0207705_10261891
808 Ga0207654_10049671
809 Ga0207654_10463309
810 Ga0207707_10016386
811 Ga0207707_10041525
812 Ga0207707_10175916
813 Ga0207695_10713988
814 Ga0207671_10552694
815 Ga0207693_10001757
816 Ga0207693_10046227
817 Ga0207663_10092408
818 Ga0207663_10205053
819 Ga0207663_10697112
820 Ga0207660_10007194
821 Ga0207660_10063951
822 Ga0207662_10003632
823 Ga0207657_10010226
824 Ga0207657_10043794
825 Ga0207649_10033014
826 Ga0207652_10044534
827 Ga0207652_10867685
828 Ga0207646_10638907
829 Ga0207694_10323891
830 Ga0207659_10021430
831 Ga0207700_10021362
832 Ga0207700_10024727
833 Ga0207664_10132622
834 Ga0207664_10284069
835 Ga0207644_10128164
836 Ga0207690_10018038
837 Ga0207690_10185702
838 Ga0207690_10363168
839 Ga0207706_10010825
840 Ga0207706_10240724
841 Ga0207706_10268502
842 Ga0207686_10004384
843 Ga0207709_10149259
844 Ga0207709_10245791
845 Ga0207709_10424901
846 Ga0207704_10542023
847 Ga0207665_10005563
848 Ga0207665_10469211
849 Ga0207665_10844635
850 Ga0207691_10043162
851 Ga0207689_10065249
852 Ga0207661_10074121
853 Ga0207667_10204464
854 Ga0207712_10971413
855 Ga0207668_10004655
856 Ga0207668_10045383
857 Ga0207668_10922803
858 Ga0207640_10148307
859 Ga0207640_10585773
860 Ga0207640_10774323
861 Ga0207703_10128323
862 Ga0207639_10014112
863 Ga0207639_10074597
864 Ga0207678_10002695
865 Ga0207678_10009458
866 Ga0207678_10023671
867 Ga0207708_10319413
868 Ga0207702_10181041
869 Ga0207648_10040729
870 Ga0207676_10198400
871 Ga0207676_10369106
872 Ga0207674_10016024
873 Ga0207674_10040295
874 Ga0207675_100018613
875 Ga0207675_100018950
876 Ga0207675_100149303
877 Ga0207683_10008823
878 Ga0207698_10092476
879 Ga0209983_1009245
880 Ga0209974_10031421
881 Ga0268266_10020476
882 Ga0268266_10384538
883 Ga0268265_10148205
884 Ga0268265_10296188
885 Ga0268264_10130696
886 Ga0265338_10078068
887 Ga0265330_10157176
888 Ga0265339_10095471
889 Ga0265316_10198180
890 Ga0265316_10385068
891 Ga0307513_10073469
892 Ga0265314_10064623
893 Ga0265342_10064028
894 Ga0316583_10002728
895 Ga0373948_0014131
896 Ga0373926_0087999
897 Ga0373928_0009242
898 Ga0373936_0077955
899 Ga0373945_0013875
900 Ga0373954_0251529
901 Ga0373943_0090211
902 Ga0373943_0261785
903 Ga0373946_0055797
904 Ga0373955_0101101
905 Ga0373942_0066785
906 Ga0373931_0019412
907 Ga0373931_0032772
908 Ga0373931_0129786
909 Ga0373927_0016170
910 Ga0373933_0018191
911 Ga0373947_0070905
912 Ga0373947_0317191
913 Ga0373937_0098426
914 Ga0373937_0162805
915 Ga0316582_0152645
916 Ga0373925_0033664
917 Ga0395899_0401672
918 Ga0395900_0019961
919 Ga0395905_0001184
920 Ga0395905_1121745
921 Ga0436364_0169255
922 Ga0436364_1052957
923 Ga0436364_1189360
924 Ga0395901_0290978
925 Ga0395901_1034797
926 Ga0436365_0326704
927 Ga0436360_0104681
928 Ga0436360_0263699
929 Ga0436360_0451182
930 Ga0436361_0809138
931 Ga0436362_0037740
932 Ga0439448_0085742
933 Ga0439460_0057767
934 Ga0453683_0000998
935 Ga0453684_0005410
936 Ga0453684_0411072
937 Ga0451576_0023264
938 Ga0451576_0221650
939 Ga0451576_0718338
940 Ga0495603_0000026
941 Ga0495629_0001467
942 Ga0495641_0032215
943 Ga0495580_0002524
944 Ga0495582_0000385
945 Ga0495639_0000233
946 Ga0495584_0104273
947 Ga0495606_0223434
948 Ga0495608_0014614
949 Ga0495643_0298710
950 Ga0495652_0088629
951 Ga0495652_0156695
952 Ga0495665_0027683
953 Ga0495587_0242522
954 Ga0495622_0000481
955 Ga0495667_0391078
956 Ga0495634_0022887
957 Ga0495588_0012099
958 Ga0495658_0010712
959 Ga0495613_0000386
960 Ga0495660_0265888
961 Ga0495581_0006648
962 Ga0495676_0007864
963 Ga0495680_0008171
964 Ga0495686_0400510
965 Ga0495593_0000434
966 Ga0495602_0306702
967 Ga0495614_0009828
968 Ga0495614_0012601
969 Ga0496100_0218265
970 Ga0496101_0204218
971 Ga0496102_0047983
972 Ga0496102_0580722
973 Ga0496103_0634302
974 Ga0496104_0057153
975 Ga0496104_0068629
976 Ga0496105_0142122
977 Ga0496105_0195785
978 Ga0496106_0041230
979 Ga0496106_0049588
980 Ga0496106_0068013
981 Ga0496106_0548540
982 Ga0496107_0024669
983 Ga0496107_0041799
984 Ga0496107_0161132
985 Ga0496107_0198004
986 Ga0496108_0707169
987 Ga0496109_0049104
988 Ga0496109_0112316
989 Ga0496109_0186971
990 Ga0496109_0247805
991 Ga0496110_0036161
992 Ga0496110_0382187
993 Ga0496111_0013683
994 Ga0496112_0029146
995 Ga0496112_0522498
996 Ga0496112_0995994
997 Ga0496113_0160120
998 Ga0496113_0276910
999 Ga0496114_0043548
1000 Ga0496114_0103340
1001 Ga0496114_0743807
1002 Ga0496115_0040043
1003 Ga0496115_0220631
1004 Ga0501031_0078400
1005 Ga0501031_0181985
1006 Ga0501033_0037432
1007 Ga0501033_0107902
1008 Ga0501034_0502015
1009 Ga0501036_0008919
1010 Ga0501036_0024555
1011 Ga0501036_0053008
1012 Ga0501036_0130954
1013 Ga0501036_0662625
1014 Ga0501037_0019432
1015 Ga0501037_0040288
1016 Ga0501037_0120587
1017 Ga0501037_0300884
1018 Ga0501038_0005001
1019 Ga0501038_0023931
1020 Ga0501038_0027727
1021 Ga0501038_0150756
1022 Ga0501038_0194423
1023 Ga0501039_0009395
1024 Ga0501039_0064235
1025 Ga0501039_0084666
1026 Ga0501039_0106419
1027 Ga0501039_0109087
1028 Ga0501039_0128629
1029 Ga0501039_0144659
1030 Ga0501040_0003295
1031 Ga0501040_0037610
1032 Ga0501040_0039403
1033 Ga0501040_0058716
1034 Ga0501040_0173096
1035 Ga0501040_0186508
1036 Ga0501041_0002841
1037 Ga0501041_0005550
1038 Ga0501041_0048435
1039 Ga0501041_0147976
1040 Ga0501041_0196440
1041 Ga0501041_0201407
1042 Ga0501041_0516401
1043 Ga0501042_0008617
1044 Ga0501042_0073942
1045 Ga0501042_0094815
1046 Ga0501042_0097683
1047 Ga0501042_0141698
1048 Ga0501042_0305824
1049 Ga0501042_0438225
1050 Ga0501042_0758668
1051 Ga0501042_0958879
1052 Ga0501043_0450726
1053 Ga0501046_0012532
1054 Ga0501046_0017612
1055 Ga0501046_0241269
1056 Ga0501046_0366148
1057 Ga0501046_0412388
1058 Ga0501046_0457388
1059 Ga0501047_0320506
1060 Ga0501048_0003031
1061 Ga0501048_0021937
1062 Ga0501048_0059188
1063 Ga0501048_0170245
1064 Ga0501048_0458429
1065 Ga0501067_0123826
1066 Ga0501068_0020830
1067 Ga0501068_0023205
1068 Ga0501068_0110137
1069 Ga0501068_0161455
1070 Ga0501069_0023473
1071 Ga0501070_0083605
1072 Ga0501070_0182665
1073 Ga0501070_0216861
1074 Ga0501070_0283389
1075 Ga0501070_0317682
1076 Ga0501071_0003312
1077 Ga0501071_0010710
1078 Ga0501071_0059045
1079 Ga0501071_0069508
1080 Ga0501071_0074215
1081 Ga0501071_0116463
1082 Ga0501071_0117638
1083 Ga0501071_0160749
1084 Ga0501071_0210914
1085 Ga0501071_0283943
1086 Ga0501071_0487076
1087 Ga0501072_0000996
1088 Ga0501072_0004975
1089 Ga0501072_0017201
1090 Ga0501072_0038288
1091 Ga0501072_0046400
1092 Ga0501072_0143835
1093 Ga0501072_0235447
1094 Ga0501072_0484832
1095 Ga0501072_0694216
1096 Ga0501072_0828669
1097 Ga0501073_0651442
1098 Ga0501074_0012927
1099 Ga0501074_0057590
1100 Ga0501074_0319121
1101 Ga0501074_0325208
1102 Ga0501075_0028634
1103 Ga0501075_0037651
1104 Ga0501075_0098146
1105 Ga0501075_0109388
1106 Ga0501075_0129532
1107 Ga0501075_0258016
1108 Ga0501076_0008194
1109 Ga0501076_0017390
1110 Ga0501076_0032407
1111 Ga0501076_0056933
1112 Ga0501076_0106056
1113 Ga0501076_0125512
1114 Ga0501076_0242090
1115 Ga0501076_0254703
1116 Ga0501076_0770514
1117 Ga0501077_0009076
1118 Ga0501077_0029435
1119 Ga0501077_0046923
1120 Ga0501077_0098169
1121 Ga0501077_0138586
1122 Ga0501077_0165123
1123 Ga0501077_0208370
1124 Ga0501077_0305958
1125 Ga0501077_0425168
1126 Ga0501079_0007319
1127 Ga0501079_0009820
1128 Ga0501079_0027470
1129 Ga0501079_0120965
1130 Ga0501079_0149819
1131 Ga0501079_0150479
1132 Ga0501079_0157669
1133 Ga0501079_0364558
1134 Ga0501079_0431042
1135 Ga0501079_0655595
1136 Ga0501080_0003570
1137 Ga0501080_0015979
1138 Ga0501080_0121785
1139 Ga0501080_0171954
1140 Ga0501080_0359546
1141 Ga0501081_0013333
1142 Ga0501081_0015345
1143 Ga0501081_0016023
1144 Ga0501081_0100020
1145 Ga0501081_0537651
1146 Ga0501081_0623836
1147 Ga0501083_0065447
1148 Ga0501083_0104034
1149 Ga0501083_0251608
1150 Ga0501083_0345891
1151 Ga0501035_0011674
1152 Ga0501035_0218990
1153 Ga0501035_0391800
1154 Ga0501044_0221877
1155 Ga0501044_0722637
1156 Ga0501045_0000433
1157 Ga0501045_0006247
1158 Ga0501045_0023378
1159 Ga0501045_0143733
1160 Ga0501045_0183451
1161 nmdc:mga03683_22138_c1
1162 nmdc:mga03n38_123757_c1
1163 nmdc:mga00v17_135068_c1
1164 nmdc:mga06z11_14125_c1
1165 nmdc:mga06z11_9136_c1
1166 nmdc:mga04h51_9002_c1
1167 nmdc:mga07m45_164160_c1
1168 nmdc:mga09592_116030_c1
1169 nmdc:mga0qj67_534696_c1
1170 nmdc:mga06r32_33912_c1
1171 nmdc:mga06r32_61915_c1
1172 nmdc:mga08y16_140287_c1
1173 nmdc:mga0n895_191968_c1
1174 nmdc:mga0rr50_293738_c1
1175 nmdc:mga0rr50_77994_c1
1176 nmdc:mga08x19_303582_c1
1177 nmdc:mga08x19_463357_c1
1178 nmdc:mga08x19_746024_c1
1179 nmdc:mga0a205_559055_c1
1180 Ga0495601_0023202
1181 Ga0495612_0024514
1182 Ga0495595_0002467
1183 Ga0495619_0001086
1184 Ga0495619_0002041
1185 Ga0495619_0449895
1186 Ga0500628_002051
1187 Ga0501084_0006611
1188 Ga0501084_0011834
1189 Ga0501084_0067118
1190 Ga0501084_0131785
1191 Ga0501084_0259075
1192 Ga0501084_0268530
1193 Ga0501084_0475870
1194 Ga0501082_0004184
1195 Ga0501082_0039976
1196 Ga0501082_0094463
1197 Ga0501082_0285576
1198 Ga0501082_0351774
1199 Ga0501082_1497697
1200 Ga0530510_0006701
1201 Ga0530510_0015792
1202 Ga0530510_0053424
1203 Ga0530510_0069577
1204 Ga0530510_0209483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01661

Macro

Macro domain

33

144

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cb3-assembly1.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9754 4 168
5cms-assembly2.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9744 4 169
5cb5-assembly10.cif.gz_I structural insights into the mechanism of escherichia coli ymdb 0.9736 3 169
6y4y-assembly1.cif.gz_A the crystal structure of human macrod2 in space group p41212 0.9686 4 169
4iqy-assembly2.cif.gz_B crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2 0.9651 4 169
ID Description Score Start End Superfamily
5cb5C00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9735 3 169 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.964 4 169 3.40.220.10
af_F6PBM1_89_319_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9623 4 164 3.40.220.10
5l9kA00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9606 5 173 3.40.220.10
af_Q4DQ03_1_267_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9598 4 172 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A537CYL7-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.005 8 100 GO:0061463
AF-J9BST1-F1-model_v4 Appr-1-p processing domain-containing protein 1.004 6 100 GO:0019213
AF-A0A662AKW8-F1-model_v4 RNase III inhibitor 1.002 4 112 GO:0019213
AF-J9FCM5-F1-model_v4 Phosphatase 1.001 6 109
AF-A0A2M6Y3W6-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.001 8 109

Map