F468098

General Info

Members Datasets Scaffolds Average Seq Length
601 415 502 214

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0032650|Ga0495683_0032650_313_1056
Length 247
Sequence MAVASAALIRFTSCDRPEHFMNNLMQASFGVVDFWTFFLGTLFIVLLPGPNSLYVLSVAAQRGVRQGYLGACGVFVGDWILMILSACGAASLLKTSPVLFMAVKFIGAAYLGWIGLQMLIGCWRRLRAGSDVDAXXXAARMLAPVVRGVHPFKKALAISLLNPKAILFFISFFVQFVDPHFHSSLVSFGMLGLICQLLSFTYLTALIFLGTRLAAVFQRRRRLSAGLSAGVGALFMGFGLKLATATL

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
9 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
10 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
11 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
12 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
13 2643221585 Pelomonas sp. Root662 Isolate Unclassified
14 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
15 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
16 2643221604 Nocardioides sp. Root190 Isolate Unclassified
17 2643221617 Nocardioides sp. Root79 Isolate Unclassified
18 2643221620 Nocardioides sp. Root240 Isolate Unclassified
19 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
20 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
21 2643221641 Nocardioides sp. Root122 Isolate Unclassified
22 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
23 2643221656 Pelomonas sp. Root405 Isolate Unclassified
24 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
25 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
26 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
27 2738541305 Nocardioides sp. CF167 Isolate Unclassified
28 2738541337 Pelomonas sp. BT06 Isolate Unclassified
29 2739367898 Nocardioides sp. CF479 Isolate Unclassified
30 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
31 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
32 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
33 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
34 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
35 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
36 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
37 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
38 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
39 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
40 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
41 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
42 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
43 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
44 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
45 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
46 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
47 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
48 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
49 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
50 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
51 2862574272 Streptomyces sp. AcE210 Isolate Nodule
52 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
53 2867428634 Streptomyces sp. RP5T Isolate Unclassified
54 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
55 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
56 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
57 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
58 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
59 2885266251 Ralstonia sp. SET104 Isolate Nodule
60 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
61 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
62 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
63 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
64 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
65 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
66 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
67 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
68 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
69 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
70 2928058823 Ralstonia sp. 1138 Isolate Unclassified
71 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
72 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
73 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
74 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
75 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
76 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
77 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
78 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
79 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
80 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
81 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
82 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
83 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
84 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
85 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
86 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
87 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
88 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
89 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
92 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
93 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
96 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
97 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
100 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
101 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
102 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
103 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
104 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
105 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
108 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
109 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
110 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
111 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
112 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
113 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
114 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
115 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
151 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
152 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
165 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
236 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
237 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
238 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
245 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
246 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
247 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
248 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
249 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
250 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
251 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
252 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
253 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
363 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
364 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
380 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
381 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
382 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
383 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
384 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
385 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
386 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
387 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
388 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
399 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
400 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
403 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
404 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
408 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
409 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
410 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
411 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
412 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
413 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
414 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
415 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.53
Metatranscriptomes 1
Isolates 16.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.81
Nodule 1.5
Rhizoplane 1.16
Rhizosphere 66.39
Stem 0
Stem Tuber 0
Unclassified 18.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000679 3300001915 Bacteria 10254
2 JGI24740J21852_10029859 3300001979 Bacteria 1784
3 JGI24740J21852_10030041 3300001979 Bacteria 1775
4 JGI25156J39149_1018101 3300002705 Bacteria 1313
5 JGI25156J39149_1024588 3300002705 Bacteria 983
6 JGI25154J39366_1000136 3300002738 Bacteria 57760
7 JGI25151J46595_10004611 3300003187 Bacteria 7254
8 JGI25151J46595_10026146 3300003187 Bacteria 2360
9 JGI25151J46595_10035285 3300003187 Bacteria 1901
10 JGI25153J46596_10054376 3300003215 Bacteria 1127
11 rootH1_10007098 3300003316 Bacteria 1112
12 rootH1_10037411 3300003316 Bacteria 5055
13 rootH1_10054269 3300003323 Bacteria 1325
14 JGI25160J50197_1020461 3300003354 Bacteria 1995
15 Ga0006562J51391_1026270 3300003578 Bacteria 873
16 Ga0006562J51391_1041146 3300003578 Bacteria 1090
17 Ga0055539_1000061 3300003752 Bacteria 144457
18 Ga0055532_1000042 3300003758 Bacteria 195195
19 Ga0055525_1000480 3300003759 Bacteria 21423
20 Ga0055525_1000616 3300003759 Bacteria 14804
21 Ga0055527_1000169 3300003760 Bacteria 45013
22 Ga0055535_1000031 3300003761 Bacteria 195195
23 Ga0055542_1001292 3300003762 Bacteria 13371
24 Ga0055529_1000075 3300003763 Bacteria 156291
25 Ga0055526_1026693 3300003771 Bacteria 1811
26 Ga0055524_1002307 3300003775 Bacteria 9936
27 Ga0055524_1008846 3300003775 Bacteria 4147
28 Ga0055536_1000108 3300003781 Bacteria 73142
29 Ga0055534_1010636 3300003784 Bacteria 1913
30 Ga0055531_10000011 3300003794 Bacteria 195010
31 Ga0055541_1002919 3300003841 Bacteria 3299
32 Ga0055541_1015165 3300003841 Bacteria 1033
33 Ga0058692_1000025 3300003856 Bacteria 217356
34 Ga0058692_1001325 3300003856 Bacteria 9285
35 Ga0070683_100003993 3300005329 Bacteria 12083
36 Ga0070680_100082043 3300005336 Bacteria 2661
37 Ga0070682_100213578 3300005337 Bacteria 1369
38 Ga0070661_100002111 3300005344 Bacteria 13690
39 Ga0070661_100407762 3300005344 Bacteria 1076
40 Ga0070659_100028665 3300005366 Bacteria 4302
41 Ga0070709_10025818 3300005434 Bacteria 3473
42 Ga0070663_100000086 3300005455 Bacteria 41783
43 Ga0070684_100004378 3300005535 Bacteria 10735
44 Ga0070684_100256708 3300005535 Bacteria 1598
45 Ga0070664_100000210 3300005564 Bacteria 41664
46 Ga0068857_100323692 3300005577 Bacteria 1424
47 Ga0068854_100000176 3300005578 Bacteria 43579
48 Ga0068856_100000539 3300005614 Bacteria 41776
49 Ga0068856_100813534 3300005614 Bacteria 954
50 Ga0068852_100293395 3300005616 Bacteria 1572
51 Ga0081539_10000709 3300005985 Bacteria 66741
52 Ga0075363_100152709 3300006048 Bacteria 1304
53 Ga0075364_10043348 3300006051 Bacteria 2925
54 Ga0075367_10390260 3300006178 Bacteria 880
55 Ga0075366_10002780 3300006195 Bacteria 9062
56 Ga0075366_10060088 3300006195 Bacteria 2258
57 Ga0075370_10077364 3300006353 Bacteria 1909
58 Ga0075370_10344754 3300006353 Bacteria 889
59 Ga0075430_100136085 3300006846 Bacteria 2047
60 Ga0075431_100077526 3300006847 Bacteria 3430
61 Ga0099826_10000029 3300006948 Bacteria 128855
62 Ga0105251_10018652 3300009011 Bacteria 3683
63 Ga0105251_10035794 3300009011 Bacteria 2447
64 Ga0105251_10145367 3300009011 Bacteria 1072
65 Ga0105244_10000076 3300009036 Bacteria 110824
66 Ga0105240_10454623 3300009093 Bacteria 1432
67 Ga0111539_11030966 3300009094 Bacteria 956
68 Ga0105245_10100173 3300009098 Bacteria 2680
69 Ga0114129_10377697 3300009147 Bacteria 1872
70 Ga0105243_10288804 3300009148 Bacteria 1481
71 Ga0105243_11016140 3300009148 Bacteria 833
72 Ga0105249_10004632 3300009553 Bacteria 11881
73 Ga0105239_10195606 3300010375 Bacteria 2264
74 Ga0105246_10245508 3300011119 Bacteria 1418
75 Ga0157373_10129255 3300013100 Bacteria 1776
76 Ga0157371_10006566 3300013102 Bacteria 9565
77 Ga0157369_10007469 3300013105 Bacteria 12585
78 Ga0157369_10596192 3300013105 Bacteria 1141
79 Ga0157372_10006060 3300013307 Bacteria 12846
80 Ga0157372_10017379 3300013307 Bacteria 7720
81 Ga0157372_10034019 3300013307 Bacteria 5599
82 Ga0157372_11297528 3300013307 Bacteria 840
83 Ga0182008_10000119 3300014497 Bacteria 59427
84 Ga0182006_1000067 3300015261 Bacteria 147932
85 Ga0182007_10000123 3300015262 Bacteria 53953
86 Ga0182005_1000002 3300015265 Bacteria 908499
87 Ga0163161_10020619 3300017792 Bacteria 4628
88 Ga0163161_10550756 3300017792 Bacteria 945
89 Ga0206352_10334922 3300020078 Bacteria 1820
90 Ga0206353_10552251 3300020082 Bacteria 2105
91 Ga0213872_10001107 3300021361 Bacteria 18438
92 Ga0213872_10006231 3300021361 Bacteria 6024
93 Ga0213872_10088999 3300021361 Bacteria 1383
94 Ga0209784_100003 3300025224 Bacteria 1379451
95 Ga0209784_100686 3300025224 Bacteria 9430
96 Ga0209566_100002 3300025225 Bacteria 2614868
97 Ga0209566_100330 3300025225 Bacteria 42404
98 Ga0209566_102470 3300025225 Bacteria 3401
99 Ga0209674_100094 3300025226 Bacteria 169506
100 Ga0209674_104116 3300025226 Bacteria 2451
101 Ga0209672_100096 3300025228 Bacteria 112947
102 Ga0209147_100002 3300025229 Bacteria 2158988
103 Ga0209563_100004 3300025230 Bacteria 1814108
104 Ga0209258_100002 3300025242 Bacteria 2158988
105 Ga0209646_1000019 3300025246 Bacteria 475248
106 Ga0209026_1011832 3300025250 Bacteria 1547
107 Ga0209677_100071 3300025253 Bacteria 139425
108 Ga0209148_1000118 3300025254 Bacteria 188330
109 Ga0209759_1004997 3300025256 Bacteria 4776
110 Ga0209759_1012625 3300025256 Bacteria 2328
111 Ga0209565_1000084 3300025263 Bacteria 153894
112 Ga0209565_1010070 3300025263 Bacteria 2360
113 Ga0209455_1000009 3300025272 Bacteria 1042273
114 Ga0209673_1034247 3300025273 Bacteria 1537
115 Ga0209130_1006165 3300025284 Bacteria 3954
116 Ga0209675_1000464 3300025291 Bacteria 31142
117 Ga0209676_1000012 3300025292 Bacteria 841431
118 Ga0209025_1000214 3300025294 Bacteria 138780
119 Ga0209025_1001025 3300025294 Bacteria 41120
120 Ga0209025_1007952 3300025294 Bacteria 7760
121 Ga0209025_1032342 3300025294 Bacteria 2448
122 Ga0209564_1022535 3300025295 Bacteria 2222
123 Ga0209564_1025321 3300025295 Bacteria 2000
124 Ga0209564_1026027 3300025295 Bacteria 1947
125 Ga0209758_1006507 3300025297 Bacteria 8345
126 Ga0209758_1023388 3300025297 Bacteria 2796
127 Ga0209050_1009066 3300025298 Bacteria 5170
128 Ga0209256_1000468 3300025299 Bacteria 60770
129 Ga0209256_1001006 3300025299 Bacteria 33408
130 Ga0207426_1004524 3300025302 Bacteria 6728
131 Ga0207426_1008470 3300025302 Bacteria 4148
132 Ga0207426_1016632 3300025302 Bacteria 2634
133 Ga0209051_1002325 3300025303 Bacteria 13807
134 Ga0209051_1012366 3300025303 Bacteria 4135
135 Ga0209257_1000017 3300025304 Bacteria 866287
136 Ga0207655_1000030 3300025728 Bacteria 413221
137 Ga0207655_1001093 3300025728 Bacteria 26680
138 Ga0207655_1001907 3300025728 Bacteria 17900
139 Ga0207713_1032021 3300025735 Bacteria 2315
140 Ga0207699_10021514 3300025906 Bacteria 3478
141 Ga0207695_10003065 3300025913 Bacteria 23956
142 Ga0207695_10483383 3300025913 Bacteria 1120
143 Ga0207660_10402059 3300025917 Bacteria 1103
144 Ga0207690_10001107 3300025932 Bacteria 17169
145 Ga0207709_10744361 3300025935 Bacteria 787
146 Ga0207704_10345353 3300025938 Bacteria 1157
147 Ga0207661_10000747 3300025944 Bacteria 21096
148 Ga0207679_10000240 3300025945 Bacteria 41798
149 Ga0207679_10014167 3300025945 Bacteria 5236
150 Ga0207712_10004502 3300025961 Bacteria 8805
151 Ga0207640_10000049 3300025981 Bacteria 97025
152 Ga0207678_10000353 3300026067 Bacteria 41741
153 Ga0207702_10000550 3300026078 Bacteria 41779
154 Ga0207702_10715809 3300026078 Bacteria 987
155 Ga0207641_10098511 3300026088 Bacteria 2571
156 Ga0207674_10283821 3300026116 Bacteria 1604
157 Ga0209371_1000036 3300027312 Bacteria 367250
158 Ga0209371_1002657 3300027312 Bacteria 9739
159 Ga0209371_1011550 3300027312 Bacteria 2616
160 Ga0209282_1001593 3300027666 Bacteria 12556
161 Ga0268266_11082022 3300028379 Bacteria 776
162 Ga0307517_10002842 3300028786 Bacteria 27511
163 Ga0307515_10000497 3300028794 Bacteria 94190
164 Ga0307515_10054430 3300028794 Bacteria 5875
165 Ga0307515_10088171 3300028794 Bacteria 3926
166 Ga0307515_10234736 3300028794 Bacteria 1618
167 Ga0265338_10285782 3300028800 Bacteria 1204
168 Ga0268256_1000040 3300030500 Bacteria 348002
169 Ga0268256_1002353 3300030500 Bacteria 9739
170 Ga0307511_10000238 3300030521 Bacteria 56455
171 Ga0307512_10015539 3300030522 Bacteria 7051
172 Ga0265332_10000013 3300031238 Bacteria 250095
173 Ga0265325_10057382 3300031241 Bacteria 1985
174 Ga0265327_10122603 3300031251 Unclassified 1230
175 Ga0265316_10290426 3300031344 Bacteria 1193
176 Ga0307513_10069290 3300031456 Bacteria 3691
177 Ga0307509_10013379 3300031507 Bacteria 9719
178 Ga0307509_10020287 3300031507 Bacteria 7544
179 Ga0307509_10033994 3300031507 Bacteria 5605
180 Ga0307408_100000114 3300031548 Bacteria 89451
181 Ga0307508_10016710 3300031616 Bacteria 6676
182 Ga0307514_10006271 3300031649 Bacteria 10408
183 Ga0307514_10079711 3300031649 Bacteria 2426
184 Ga0307514_10114363 3300031649 Bacteria 1902
185 Ga0307514_10154087 3300031649 Bacteria 1536
186 Ga0307516_10003058 3300031730 Bacteria 21831
187 Ga0307516_10018858 3300031730 Bacteria 7161
188 Ga0307518_10114000 3300031838 Bacteria 1922
189 Ga0307410_10322209 3300031852 Bacteria 1227
190 Ga0307410_10364955 3300031852 Bacteria 1158
191 Ga0307406_10173533 3300031901 Bacteria 1563
192 Ga0307414_10004465 3300032004 Bacteria 7598
193 Ga0307414_10209347 3300032004 Bacteria 1592
194 Ga0307411_10000823 3300032005 Bacteria 11600
195 Ga0307507_10117085 3300033179 Bacteria 2149
196 Ga0307510_10004320 3300033180 Bacteria 16724
197 Ga0307510_10007211 3300033180 Bacteria 13244
198 Ga0307510_10015697 3300033180 Bacteria 8958
199 Ga0373948_0010565 3300034817 Bacteria 1615
200 Ga0373940_0008308 3300035088 Bacteria 2376
201 Ga0373939_0000029 3300035114 Bacteria 52306
202 Ga0373960_0002621 3300035121 Bacteria 4068
203 Ga0373931_0008333 3300035691 Bacteria 4910
204 Ga0395900_0066377 3300037418 Bacteria 3707
205 Ga0395900_0079576 3300037418 Bacteria 3368
206 Ga0395900_0097583 3300037418 Bacteria 3019
207 Ga0395900_0388450 3300037418 Bacteria 1362
208 Ga0395898_0028535 3300037466 Bacteria 5591
209 Ga0395905_0001795 3300037471 Bacteria 24890
210 Ga0395905_0087003 3300037471 Bacteria 2930
211 Ga0395901_0225283 3300038443 Bacteria 1959
212 Ga0395901_0305528 3300038443 Bacteria 1649
213 Ga0436361_0007228 3300039447 Bacteria 1845
214 Ga0436361_0028828 3300039447 Bacteria 968
215 Ga0436361_0505573 3300039447 Bacteria 1738
216 Ga0436361_0662050 3300039447 Unclassified 3482
217 Ga0436361_0802016 3300039447 Bacteria 24229
218 Ga0436361_0921973 3300039447 Bacteria 1083
219 Ga0436361_0922237 3300039447 Bacteria 22454
220 Ga0439436_0003137 3300041404 Bacteria 5010
221 Ga0439439_0001872 3300041406 Bacteria 4342
222 Ga0439439_0004865 3300041406 Bacteria 3044
223 Ga0451837_1229693 3300041494 Bacteria 1228
224 Ga0451843_1180629 3300041509 Bacteria 910
225 Ga0451853_0516285 3300041512 Bacteria 1075
226 Ga0451853_0887708 3300041512 Bacteria 1145
227 Ga0439433_0001405 3300041999 Bacteria 4954
228 Ga0439449_0014625 3300042007 Bacteria 2949
229 Ga0439449_0037525 3300042007 Bacteria 1802
230 Ga0439455_0000348 3300042012 Bacteria 5982
231 Ga0439457_001796 3300042014 Bacteria 6338
232 Ga0439457_018010 3300042014 Bacteria 1567
233 Ga0450917_000376 3300042120 Bacteria 3350
234 Ga0450888_000028 3300042126 Bacteria 10038
235 Ga0450890_003595 3300042127 Bacteria 2056
236 Ga0450891_000149 3300042129 Bacteria 6505
237 Ga0450892_000225 3300042130 Bacteria 6792
238 Ga0450894_000045 3300042131 Bacteria 18255
239 Ga0450896_009320 3300042133 Bacteria 1366
240 Ga0450899_000042 3300042135 Bacteria 9738
241 Ga0450900_012816 3300042136 Bacteria 1103
242 Ga0450903_000542 3300042138 Bacteria 7873
243 Ga0450903_010568 3300042138 Bacteria 1492
244 Ga0450906_003844 3300042145 Bacteria 3194
245 Ga0439458_0001470 3300042157 Bacteria 5937
246 Ga0439459_0054317 3300042438 Bacteria 889
247 Ga0450893_0001575 3300042532 Bacteria 3500
248 Ga0451577_0149432 3300042876 Bacteria 2101
249 Ga0451577_0288609 3300042876 Bacteria 1487
250 Ga0451577_0679423 3300042876 Bacteria 933
251 Ga0466969_0026071 3300044656 Bacteria 3000
252 Ga0466969_0074981 3300044656 Bacteria 1622
253 Ga0466972_0080702 3300044658 Bacteria 1549
254 Ga0466977_0008418 3300044666 Bacteria 5721
255 Ga0453683_0064929 3300044673 Bacteria 2282
256 Ga0466965_0137220 3300044683 Bacteria 1271
257 Ga0466966_0039685 3300044684 Bacteria 3032
258 Ga0466966_0173147 3300044684 Bacteria 1311
259 Ga0466961_0000765 3300044693 Bacteria 20117
260 Ga0466961_0014177 3300044693 Bacteria 5115
261 Ga0466961_0145682 3300044693 Bacteria 1481
262 Ga0466961_0206610 3300044693 Bacteria 1213
263 Ga0466961_0320073 3300044693 Bacteria 946
264 Ga0466963_0068156 3300044694 Bacteria 2389
265 Ga0466963_0363597 3300044694 Bacteria 1019
266 Ga0466964_0100956 3300044706 Bacteria 1272
267 Ga0453684_0000657 3300044712 Bacteria 124222
268 Ga0453684_0000826 3300044712 Bacteria 104663
269 Ga0453684_0027032 3300044712 Bacteria 8252
270 Ga0453684_0916520 3300044712 Bacteria 937
271 Ga0466971_0019939 3300044719 Bacteria 2980
272 Ga0466971_0226851 3300044719 Bacteria 886
273 Ga0466970_0006415 3300044765 Bacteria 5883
274 Ga0466970_0008543 3300044765 Bacteria 5157
275 Ga0466970_0034858 3300044765 Bacteria 2665
276 Ga0466970_0165540 3300044765 Bacteria 1224
277 Ga0466957_0382457 3300044842 Bacteria 960
278 Ga0466959_0004532 3300045049 Bacteria 9319
279 Ga0466959_0122595 3300045049 Bacteria 1846
280 Ga0451576_0003274 3300045051 Bacteria 22482
281 Ga0451576_0015862 3300045051 Bacteria 8334
282 Ga0451576_0280189 3300045051 Bacteria 1743
283 Ga0451576_0560495 3300045051 Bacteria 1200
284 Ga0466958_0067631 3300045836 Bacteria 2183
285 Ga0466958_0491299 3300045836 Bacteria 796
286 Ga0466967_0016519 3300045976 Bacteria 5825
287 Ga0466967_0057144 3300045976 Bacteria 3443
288 Ga0466967_0903863 3300045976 Bacteria 878
289 Ga0495592_0037407 3300046454 Bacteria 3654
290 Ga0495592_0185898 3300046454 Bacteria 1411
291 Ga0495603_0007330 3300046455 Bacteria 6632
292 Ga0495603_0007840 3300046455 Bacteria 6438
293 Ga0495603_0033176 3300046455 Bacteria 3106
294 Ga0495603_0069558 3300046455 Bacteria 2070
295 Ga0495590_0123847 3300046457 Bacteria 927
296 Ga0495629_0007540 3300046459 Bacteria 8020
297 Ga0495629_0008794 3300046459 Bacteria 7425
298 Ga0495629_0030418 3300046459 Bacteria 3827
299 Ga0495629_0134359 3300046459 Bacteria 1722
300 Ga0495629_0270034 3300046459 Bacteria 1168
301 Ga0495638_0051398 3300046460 Bacteria 2570
302 Ga0495651_0033152 3300046462 Bacteria 4028
303 Ga0495651_0177013 3300046462 Bacteria 1513
304 Ga0495653_0070603 3300046463 Bacteria 2613
305 Ga0495650_0000056 3300046471 Bacteria 307565
306 Ga0495650_0002634 3300046471 Bacteria 14043
307 Ga0495580_0055666 3300046472 Bacteria 2786
308 Ga0495605_0033687 3300046474 Bacteria 2598
309 Ga0495605_0095038 3300046474 Bacteria 1376
310 Ga0495662_0001795 3300046476 Bacteria 10744
311 Ga0495662_0004825 3300046476 Bacteria 6758
312 Ga0495662_0009839 3300046476 Bacteria 4697
313 Ga0495662_0010977 3300046476 Bacteria 4430
314 Ga0495662_0028001 3300046476 Bacteria 2721
315 Ga0495584_0122503 3300046491 Bacteria 1317
316 Ga0495585_0164829 3300046492 Bacteria 1148
317 Ga0495594_0009975 3300046499 Bacteria 4918
318 Ga0495594_0011844 3300046499 Bacteria 4537
319 Ga0495594_0030329 3300046499 Bacteria 2925
320 Ga0495596_0023925 3300046500 Bacteria 2476
321 Ga0495607_0089016 3300046501 Bacteria 1676
322 Ga0495606_0001978 3300046507 Bacteria 25275
323 Ga0495608_0075832 3300046511 Bacteria 2191
324 Ga0495610_0039594 3300046512 Bacteria 2382
325 Ga0495616_0042417 3300046513 Bacteria 2316
326 Ga0495618_0212259 3300046514 Bacteria 1223
327 Ga0495628_0065534 3300046516 Bacteria 2840
328 Ga0495630_0118545 3300046517 Bacteria 2007
329 Ga0495630_0240170 3300046517 Bacteria 1384
330 Ga0495643_0078160 3300046522 Bacteria 1728
331 Ga0495648_0231871 3300046524 Bacteria 903
332 Ga0495666_0001499 3300046526 Bacteria 11413
333 Ga0495652_0058218 3300046529 Bacteria 3273
334 Ga0495665_0012858 3300046531 Bacteria 4530
335 Ga0495586_0217432 3300046535 Bacteria 1085
336 Ga0495587_0001425 3300046536 Bacteria 15904
337 Ga0495609_0038915 3300046538 Bacteria 2142
338 Ga0495645_0009259 3300046543 Bacteria 6886
339 Ga0495645_0044479 3300046543 Bacteria 3238
340 Ga0495645_0147370 3300046543 Bacteria 1638
341 Ga0495633_0001151 3300046558 Bacteria 21225
342 Ga0495667_0023067 3300046559 Bacteria 4192
343 Ga0495656_0142997 3300046615 Bacteria 1149
344 Ga0495668_0000103 3300046616 Bacteria 135853
345 Ga0495634_0002605 3300046642 Bacteria 14837
346 Ga0495634_0137943 3300046642 Bacteria 1550
347 Ga0495625_0000643 3300046660 Bacteria 50299
348 Ga0495625_0013459 3300046660 Bacteria 6574
349 Ga0495625_0383906 3300046660 Bacteria 881
350 Ga0495635_0005300 3300046663 Bacteria 8973
351 Ga0495661_0051196 3300046665 Bacteria 2495
352 Ga0495661_0094528 3300046665 Bacteria 1694
353 Ga0495588_0027301 3300046674 Bacteria 2853
354 Ga0495588_0030163 3300046674 Bacteria 2724
355 Ga0495588_0205182 3300046674 Bacteria 1041
356 Ga0495657_0004044 3300046675 Bacteria 11759
357 Ga0495657_0061541 3300046675 Bacteria 2482
358 Ga0495623_0099321 3300046679 Bacteria 1775
359 Ga0495623_0195779 3300046679 Bacteria 1165
360 Ga0495646_0011392 3300046680 Bacteria 5646
361 Ga0495646_0014474 3300046680 Bacteria 5016
362 Ga0495658_0020216 3300046683 Bacteria 3491
363 Ga0495669_0265186 3300046684 Bacteria 825
364 Ga0495613_0024695 3300046689 Bacteria 4477
365 Ga0495613_0085682 3300046689 Bacteria 2285
366 Ga0495670_0017680 3300046691 Bacteria 3511
367 Ga0495671_0040339 3300046692 Bacteria 2354
368 Ga0495671_0130589 3300046692 Bacteria 1225
369 Ga0495671_0351320 3300046692 Bacteria 707
370 Ga0495649_0079256 3300046694 Bacteria 1757
371 Ga0495589_0011121 3300046794 Bacteria 4670
372 Ga0495589_0120458 3300046794 Bacteria 1263
373 Ga0495589_0168587 3300046794 Bacteria 1041
374 Ga0495600_0021500 3300046809 Bacteria 4132
375 Ga0495600_0307741 3300046809 Bacteria 998
376 Ga0495581_0005898 3300047315 Bacteria 7105
377 Ga0495581_0036491 3300047315 Bacteria 2844
378 Ga0495604_0000264 3300047317 Bacteria 46714
379 Ga0495604_0000590 3300047317 Bacteria 31463
380 Ga0495604_0020111 3300047317 Bacteria 5335
381 Ga0495636_0004733 3300047318 Bacteria 5340
382 Ga0495636_0011296 3300047318 Bacteria 3533
383 Ga0495636_0021870 3300047318 Bacteria 2583
384 Ga0495674_0602085 3300047319 Bacteria 870
385 Ga0495676_0013764 3300047321 Bacteria 7254
386 Ga0495676_0036088 3300047321 Bacteria 4131
387 Ga0495683_0032650 3300047323 Bacteria 2651
388 Ga0495683_0034182 3300047323 Bacteria 2586
389 Ga0495683_0101669 3300047323 Bacteria 1381
390 Ga0495687_002653 3300047443 Bacteria 13957
391 Ga0495687_036832 3300047443 Bacteria 2184
392 Ga0495687_173310 3300047443 Bacteria 712
393 Ga0495675_0009963 3300047444 Bacteria 5926
394 Ga0495675_0278198 3300047444 Bacteria 998
395 Ga0495685_002027 3300047447 Bacteria 6294
396 Ga0495685_003406 3300047447 Bacteria 5076
397 Ga0495685_005251 3300047447 Bacteria 4218
398 Ga0495685_010802 3300047447 Bacteria 3068
399 Ga0495685_101466 3300047447 Bacteria 950
400 Ga0495681_0000442 3300047470 Bacteria 31718
401 Ga0495681_0025275 3300047470 Bacteria 3109
402 Ga0495684_0058636 3300047471 Bacteria 2932
403 Ga0495684_0071566 3300047471 Bacteria 2634
404 Ga0495686_0057500 3300047472 Bacteria 2427
405 Ga0495686_0073026 3300047472 Bacteria 2108
406 Ga0495593_0035696 3300047673 Bacteria 2697
407 Ga0495602_0086611 3300048088 Bacteria 2614
408 Ga0495602_0089577 3300048088 Bacteria 2558
409 Ga0495614_0003037 3300048089 Bacteria 7478
410 Ga0495614_0020431 3300048089 Bacteria 2863
411 Ga0495614_0080362 3300048089 Bacteria 1412
412 Ga0495626_0000197 3300048091 Bacteria 73484
413 Ga0496102_0167677 3300048905 Bacteria 2067
414 Ga0496104_0393896 3300048907 Bacteria 1297
415 Ga0496104_0581793 3300048907 Bacteria 1030
416 Ga0496109_0025467 3300048912 Bacteria 5273
417 Ga0496111_0371751 3300048914 Bacteria 1058
418 Ga0496116_0002105 3300048919 Bacteria 21249
419 Ga0496116_0075488 3300048919 Bacteria 2115
420 Ga0496116_0080291 3300048919 Bacteria 2026
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496118_0000002 3300048921 Bacteria 1690764
423 Ga0496119_0003104 3300048922 Bacteria 17531
424 Ga0496120_0000028 3300048923 Bacteria 230249
425 Ga0496121_0006753 3300048924 Bacteria 14081
426 Ga0496121_0013269 3300048924 Bacteria 8872
427 Ga0496121_0193629 3300048924 Bacteria 1455
428 Ga0496122_0001676 3300048925 Bacteria 34352
429 Ga0496122_0085638 3300048925 Bacteria 2173
430 Ga0496123_0002807 3300048926 Bacteria 20674
431 Ga0496123_0067793 3300048926 Bacteria 2251
432 Ga0496124_0001246 3300048927 Bacteria 39090
433 Ga0496124_0058684 3300048927 Bacteria 3235
434 Ga0496125_0214382 3300048928 Bacteria 1247
435 Ga0496125_0305834 3300048928 Bacteria 971
436 Ga0496126_0045207 3300048929 Bacteria 4049
437 Ga0501309_007469 3300049129 Bacteria 1356
438 Ga0501310_003134 3300049130 Bacteria 1607
439 Ga0495678_005338 3300049459 Bacteria 7126
440 Ga0495678_018990 3300049459 Bacteria 3077
441 Ga0495682_0003131 3300049460 Bacteria 7477
442 Ga0501294_002385 3300049517 Bacteria 1788
443 Ga0501300_003939 3300049523 Bacteria 2209
444 Ga0501031_0007119 3300049568 Bacteria 7300
445 Ga0501032_0012805 3300049569 Bacteria 5981
446 Ga0501032_0208143 3300049569 Bacteria 1276
447 Ga0501033_0002135 3300049570 Bacteria 17104
448 Ga0501033_0141413 3300049570 Bacteria 1739
449 Ga0501033_0208126 3300049570 Bacteria 1395
450 Ga0501033_0403142 3300049570 Bacteria 954
451 Ga0501034_0001049 3300049571 Bacteria 39330
452 Ga0501034_0147089 3300049571 Bacteria 2333
453 Ga0501034_0147508 3300049571 Bacteria 2329
454 Ga0501034_0983704 3300049571 Bacteria 728
455 Ga0501036_0000576 3300049572 Bacteria 26456
456 Ga0501036_0021103 3300049572 Bacteria 5471
457 Ga0501036_0393124 3300049572 Bacteria 1157
458 Ga0501037_0009522 3300049573 Bacteria 7129
459 Ga0501037_0139961 3300049573 Bacteria 1732
460 Ga0501037_0268865 3300049573 Bacteria 1190
461 Ga0501038_0006067 3300049574 Bacteria 11179
462 Ga0501038_0195117 3300049574 Bacteria 1628
463 Ga0501039_0093817 3300049575 Bacteria 2339
464 Ga0501040_0829734 3300049576 Bacteria 669
465 Ga0501043_0003457 3300049579 Bacteria 12972
466 Ga0501043_0570764 3300049579 Bacteria 838
467 Ga0501046_0015957 3300049580 Bacteria 6300
468 Ga0501047_0011643 3300049581 Bacteria 8318
469 Ga0501071_0236477 3300049587 Bacteria 1377
470 Ga0501075_0633400 3300049591 Bacteria 815
471 Ga0501202_051415 3300049652 Bacteria 914
472 Ga0501217_083728 3300049661 Bacteria 886
473 Ga0501235_009196 3300049669 Bacteria 2159
474 Ga0501258_011087 3300049687 Bacteria 962
475 Ga0501221_000105 3300049704 Bacteria 10203
476 Ga0501262_007915 3300049759 Bacteria 1294
477 Ga0501265_040925 3300049762 Bacteria 700
478 Ga0501267_003397 3300049764 Bacteria 1449
479 Ga0501272_000243 3300049769 Bacteria 4546
480 Ga0501283_026424 3300049779 Bacteria 955
481 Ga0501035_0007650 3300049822 Bacteria 10093
482 Ga0501035_0050113 3300049822 Bacteria 3743
483 Ga0501035_0415271 3300049822 Bacteria 1118
484 Ga0501044_0002016 3300049823 Bacteria 23415
485 Ga0501044_0008136 3300049823 Bacteria 11508
486 Ga0501045_0097017 3300049824 Bacteria 2181
487 nmdc:mga00v17_294249_c1 3300050491 Bacteria 1054
488 nmdc:mga0k408_1230_c1 3300050493 Bacteria 14028
489 nmdc:mga0k408_4433_c1 3300050493 Bacteria 7449
490 nmdc:mga07m45_82083_c1 3300050496 Bacteria 1841
491 nmdc:mga0qj67_126676_c1 3300050509 Bacteria 2066
492 nmdc:mga06r32_131566_c1 3300050510 Bacteria 2474
493 Ga0495619_0098691 3300053085 Bacteria 1986
494 Ga0500640_061984 3300053095 Bacteria 1619
495 Ga0500560_059194 3300053107 Bacteria 1245
496 Ga0500614_010439 3300053123 Bacteria 1995
497 Ga0500559_0190818 3300053136 Bacteria 966
498 Ga0500573_0146753 3300053140 Bacteria 1295
499 Ga0500586_119098 3300053145 Bacteria 920
500 Ga0500600_0086445 3300053149 Bacteria 1683
501 Ga0501082_0428053 3300060353 Bacteria 1156
502 Ga0466962_0025883 3300061719 Bacteria 2816

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0139961 Ga0501037_0139961_12_530 172
2 3300049576 Ga0501040_0829734 Ga0501040_0829734_14_577 176
3 3300046455 Ga0495603_0069558 Ga0495603_0069558_35_610 183
4 3300049572 Ga0501036_0021103 Ga0501036_0021103_3025_3684 184
5 3300037418 Ga0395900_0388450 Ga0395900_0388450_261_896 186
6 3300038443 Ga0395901_0225283 Ga0395901_0225283_1189_1824 186
7 3300044712 Ga0453684_0916520 Ga0453684_0916520_31_669 187
8 3300045051 Ga0451576_0280189 Ga0451576_0280189_258_896 187
9 3300047319 Ga0495674_0602085 Ga0495674_0602085_250_834 187
10 3300009148 Ga0105243_10288804 Ga0105243_102888042 188
11 3300025938 Ga0207704_10345353 Ga0207704_103453532 188
12 3300031548 Ga0307408_100000114 Ga0307408_10000011453 188
13 3300044765 Ga0466970_0008543 Ga0466970_0008543_3850_4536 189
14 3300003316 rootH1_10037411 rootH1_100374111 190
15 3300003794 Ga0055531_10000011 Ga0055531_1000001195 190
16 3300005337 Ga0070682_100213578 Ga0070682_1002135782 190
17 3300005614 Ga0068856_100813534 Ga0068856_1008135342 190
18 3300006353 Ga0075370_10344754 Ga0075370_103447542 190
19 3300025298 Ga0209050_1009066 Ga0209050_10090662 190
20 3300025303 Ga0209051_1002325 Ga0209051_100232513 190
21 3300025304 Ga0209257_1000017 Ga0209257_1000017267 190
22 3300026078 Ga0207702_10715809 Ga0207702_107158092 190
23 3300034817 Ga0373948_0010565 Ga0373948_0010565_585_1223 190
24 3300035088 Ga0373940_0008308 Ga0373940_0008308_1570_2208 190
25 3300035114 Ga0373939_0000029 Ga0373939_0000029_3754_4392 190
26 3300035121 Ga0373960_0002621 Ga0373960_0002621_1231_1869 190
27 3300035691 Ga0373931_0008333 Ga0373931_0008333_1159_1797 190
28 3300037471 Ga0395905_0001795 Ga0395905_0001795_10947_11585 190
29 3300045051 Ga0451576_0560495 Ga0451576_0560495_336_974 190
30 3300005434 Ga0070709_10025818 Ga0070709_100258181 191
31 3300006353 Ga0075370_10077364 Ga0075370_100773642 191
32 3300025906 Ga0207699_10021514 Ga0207699_100215144 191
33 3300028794 Ga0307515_10088171 Ga0307515_100881712 191
34 3300032004 Ga0307414_10004465 Ga0307414_100044656 191
35 3300032005 Ga0307411_10000823 Ga0307411_100008232 191
36 3300042120 Ga0450917_000376 Ga0450917_000376_2276_2917 191
37 3300042126 Ga0450888_000028 Ga0450888_000028_8080_8721 191
38 3300042127 Ga0450890_003595 Ga0450890_003595_380_1021 191
39 3300042129 Ga0450891_000149 Ga0450891_000149_4721_5362 191
40 3300042130 Ga0450892_000225 Ga0450892_000225_747_1388 191
41 3300042138 Ga0450903_010568 Ga0450903_010568_406_1047 191
42 3300042438 Ga0439459_0054317 Ga0439459_0054317_26_670 191
43 3300042532 Ga0450893_0001575 Ga0450893_0001575_1003_1644 191
44 3300046462 Ga0495651_0177013 Ga0495651_0177013_276_914 191
45 3300049517 Ga0501294_002385 Ga0501294_002385_511_1152 191
46 3300049523 Ga0501300_003939 Ga0501300_003939_761_1402 191
47 3300049652 Ga0501202_051415 Ga0501202_051415_160_801 191
48 3300049661 Ga0501217_083728 Ga0501217_083728_79_720 191
49 3300049669 Ga0501235_009196 Ga0501235_009196_1054_1695 191
50 3300049687 Ga0501258_011087 Ga0501258_011087_206_847 191
51 3300049704 Ga0501221_000105 Ga0501221_000105_9268_9909 191
52 3300049759 Ga0501262_007915 Ga0501262_007915_459_1100 191
53 3300049762 Ga0501265_040925 Ga0501265_040925_10_651 191
54 3300049764 Ga0501267_003397 Ga0501267_003397_307_948 191
55 3300049779 Ga0501283_026424 Ga0501283_026424_281_922 191
56 3300050496 nmdc:mga07m45_82083_c1 nmdc:mga07m45_82083_c1_110_751 191
57 3300006847 Ga0075431_100077526 Ga0075431_1000775263 192
58 3300041509 Ga0451843_1180629 Ga0451843_1180629_176_823 192
59 3300041512 Ga0451853_0887708 Ga0451853_0887708_236_883 192
60 3300049129 Ga0501309_007469 Ga0501309_007469_498_1139 192
61 3300049130 Ga0501310_003134 Ga0501310_003134_457_1098 192
62 3300049769 Ga0501272_000243 Ga0501272_000243_2750_3391 192
63 3300050510 nmdc:mga06r32_131566_c1 nmdc:mga06r32_131566_c1_72_695 192
64 3300031456 Ga0307513_10069290 Ga0307513_100692903 193
65 3300049823 Ga0501044_0008136 Ga0501044_0008136_2707_3360 193
66 3300030522 Ga0307512_10015539 Ga0307512_100155396 194
67 3300031649 Ga0307514_10114363 Ga0307514_101143632 194
68 3300041404 Ga0439436_0003137 Ga0439436_0003137_498_1151 195
69 3300041406 Ga0439439_0004865 Ga0439439_0004865_132_785 195
70 3300041999 Ga0439433_0001405 Ga0439433_0001405_1952_2605 195
71 3300042007 Ga0439449_0014625 Ga0439449_0014625_39_692 195
72 3300042014 Ga0439457_018010 Ga0439457_018010_371_1024 195
73 3300046507 Ga0495606_0001978 Ga0495606_0001978_20088_20744 195
74 3300046616 Ga0495668_0000103 Ga0495668_0000103_54163_54819 195
75 3300046660 Ga0495625_0000643 Ga0495625_0000643_2919_3575 195
76 3300047323 Ga0495683_0101669 Ga0495683_0101669_34_690 195
77 3300048091 Ga0495626_0000197 Ga0495626_0000197_33205_33861 195
78 3300005336 Ga0070680_100082043 Ga0070680_1000820434 196
79 3300025917 Ga0207660_10402059 Ga0207660_104020592 196
80 3300031507 Ga0307509_10033994 Ga0307509_100339944 196
81 3300033179 Ga0307507_10117085 Ga0307507_101170852 196
82 3300033180 Ga0307510_10007211 Ga0307510_1000721112 196
83 3300046454 Ga0495592_0037407 Ga0495592_0037407_2763_3419 196
84 3300046459 Ga0495629_0030418 Ga0495629_0030418_381_1037 196
85 3300046476 Ga0495662_0004825 Ga0495662_0004825_4796_5452 196
86 3300046514 Ga0495618_0212259 Ga0495618_0212259_482_1138 196
87 3300046517 Ga0495630_0240170 Ga0495630_0240170_547_1203 196
88 3300046529 Ga0495652_0058218 Ga0495652_0058218_1222_1878 196
89 3300046535 Ga0495586_0217432 Ga0495586_0217432_301_957 196
90 3300046536 Ga0495587_0001425 Ga0495587_0001425_6251_6907 196
91 3300046543 Ga0495645_0147370 Ga0495645_0147370_196_852 196
92 3300046642 Ga0495634_0002605 Ga0495634_0002605_7772_8428 196
93 3300046663 Ga0495635_0005300 Ga0495635_0005300_6649_7305 196
94 3300046675 Ga0495657_0004044 Ga0495657_0004044_4832_5488 196
95 3300046679 Ga0495623_0195779 Ga0495623_0195779_379_1035 196
96 3300046680 Ga0495646_0014474 Ga0495646_0014474_1444_2100 196
97 3300046809 Ga0495600_0021500 Ga0495600_0021500_3033_3689 196
98 3300047315 Ga0495581_0005898 Ga0495581_0005898_2273_2929 196
99 3300047317 Ga0495604_0000264 Ga0495604_0000264_38564_39220 196
100 3300047321 Ga0495676_0013764 Ga0495676_0013764_5131_5787 196
101 3300047471 Ga0495684_0058636 Ga0495684_0058636_2101_2757 196
102 3300047472 Ga0495686_0057500 Ga0495686_0057500_1026_1676 196
103 3300047673 Ga0495593_0035696 Ga0495593_0035696_44_700 196
104 3300048088 Ga0495602_0089577 Ga0495602_0089577_433_1089 196
105 3300048089 Ga0495614_0003037 Ga0495614_0003037_2319_2975 196
106 3300053095 Ga0500640_061984 Ga0500640_061984_787_1443 196
107 3300053123 Ga0500614_010439 Ga0500614_010439_1119_1775 196
108 3300053136 Ga0500559_0190818 Ga0500559_0190818_97_753 196
109 3300053140 Ga0500573_0146753 Ga0500573_0146753_446_1102 196
110 3300053145 Ga0500586_119098 Ga0500586_119098_111_767 196
111 3300028786 Ga0307517_10002842 Ga0307517_1000284210 197
112 3300028794 Ga0307515_10000497 Ga0307515_1000049773 197
113 3300030521 Ga0307511_10000238 Ga0307511_1000023826 197
114 3300031507 Ga0307509_10020287 Ga0307509_100202873 197
115 3300031649 Ga0307514_10079711 Ga0307514_100797112 197
116 3300031649 Ga0307514_10154087 Ga0307514_101540872 197
117 3300031730 Ga0307516_10018858 Ga0307516_100188584 197
118 3300031838 Ga0307518_10114000 Ga0307518_101140002 197
119 3300033180 Ga0307510_10015697 Ga0307510_100156974 197
120 3300046459 Ga0495629_0008794 Ga0495629_0008794_5374_6033 197
121 3300046460 Ga0495638_0051398 Ga0495638_0051398_1159_1815 197
122 3300046499 Ga0495594_0011844 Ga0495594_0011844_1099_1755 197
123 3300046660 Ga0495625_0013459 Ga0495625_0013459_4309_4968 197
124 3300046674 Ga0495588_0030163 Ga0495588_0030163_689_1348 197
125 3300046683 Ga0495658_0020216 Ga0495658_0020216_2783_3442 197
126 3300046692 Ga0495671_0130589 Ga0495671_0130589_368_1024 197
127 3300047443 Ga0495687_002653 Ga0495687_002653_10054_10710 197
128 3300047470 Ga0495681_0000442 Ga0495681_0000442_10188_10847 197
129 3300047472 Ga0495686_0073026 Ga0495686_0073026_763_1422 197
130 3300048089 Ga0495614_0020431 Ga0495614_0020431_919_1578 197
131 3300053107 Ga0500560_059194 Ga0500560_059194_286_945 197
132 3300028794 Ga0307515_10054430 Ga0307515_100544303 198
133 3300044684 Ga0466966_0173147 Ga0466966_0173147_601_1254 198
134 3300044693 Ga0466961_0206610 Ga0466961_0206610_455_1108 198
135 3300044694 Ga0466963_0363597 Ga0466963_0363597_175_828 198
136 3300044765 Ga0466970_0006415 Ga0466970_0006415_4734_5387 198
137 3300044842 Ga0466957_0382457 Ga0466957_0382457_104_757 198
138 3300045836 Ga0466958_0491299 Ga0466958_0491299_89_742 198
139 3300045976 Ga0466967_0016519 Ga0466967_0016519_340_993 198
140 3300053085 Ga0495619_0098691 Ga0495619_0098691_815_1432 198
141 3300010375 Ga0105239_10195606 Ga0105239_101956062 199
142 3300013105 Ga0157369_10007469 Ga0157369_100074696 199
143 3300009093 Ga0105240_10454623 Ga0105240_104546232 200
144 3300025728 Ga0207655_1001093 Ga0207655_100109317 200
145 3300025913 Ga0207695_10483383 Ga0207695_104833832 200
146 3300031344 Ga0265316_10290426 Ga0265316_102904261 200
147 3300042136 Ga0450900_012816 Ga0450900_012816_269_919 200
148 3300044673 Ga0453683_0064929 Ga0453683_0064929_866_1513 201
149 3300048929 Ga0496126_0045207 Ga0496126_0045207_1684_2349 201
150 3300013105 Ga0157369_10596192 Ga0157369_105961922 202
151 iso_pu_bacteria 2935390628 2935391863 202
152 3300042876 Ga0451577_0149432 Ga0451577_0149432_543_1190 203
153 3300044712 Ga0453684_0000826 Ga0453684_0000826_58280_58927 203
154 3300045051 Ga0451576_0015862 Ga0451576_0015862_6061_6708 203
155 3300049459 Ga0495678_005338 Ga0495678_005338_342_1019 203
156 3300045836 Ga0466958_0067631 Ga0466958_0067631_71_859 204
157 3300005329 Ga0070683_100003993 Ga0070683_1000039938 205
158 3300005535 Ga0070684_100004378 Ga0070684_1000043782 205
159 3300005577 Ga0068857_100323692 Ga0068857_1003236922 205
160 3300025944 Ga0207661_10000747 Ga0207661_1000074716 205
161 3300025945 Ga0207679_10014167 Ga0207679_100141672 205
162 3300026116 Ga0207674_10283821 Ga0207674_102838212 205
163 3300028794 Ga0307515_10234736 Ga0307515_102347362 205
164 iso_pu_bacteria 2643221544 2643745898 205
165 iso_pu_bacteria 2643221585 2643935239 205
166 iso_pu_bacteria 2643221604 2644035148 205
167 iso_pu_bacteria 2643221617 2644101297 205
168 iso_pu_bacteria 2643221620 2644119297 205
169 iso_pu_bacteria 2643221639 2644221903 205
170 iso_pu_bacteria 2643221646 2644257301 205
171 iso_pu_bacteria 2643221656 2644314863 205
172 iso_pu_bacteria 2738541305 2738868926 205
173 iso_pu_bacteria 2738541337 2739055118 205
174 iso_pu_bacteria 2808606359 2808848785 205
175 iso_pu_bacteria 2808606375 2808913109 205
176 iso_pu_bacteria 2808606982 2811844909 205
177 iso_pu_bacteria 2811994874 2812330378 205
178 iso_pu_bacteria 2861520306 2861521800 205
179 iso_pu_bacteria 2887478801 2887481910 205
180 iso_pu_bacteria 2919468124 2919469159 205
181 iso_pu_bacteria 8001781756 8001781803 205
182 iso_pu_bacteria 8001781756 8001788840 205
183 iso_pu_bacteria 8008574985 8008577617 205
184 iso_pu_bacteria 2547132103 2547374326 206
185 iso_pu_bacteria 2582581313 2585306160 206
186 iso_pu_bacteria 2643221587 2643941826 206
187 iso_pu_bacteria 2643221677 2644428909 206
188 iso_pu_bacteria 2784746768 2785370991 206
189 iso_pu_bacteria 2786546132 2786672188 206
190 iso_pu_bacteria 2843690924 2843694812 206
191 iso_pu_bacteria 2846033681 2846033718 206
192 iso_pu_bacteria 2846037992 2846040261 206
193 iso_pu_bacteria 2852635781 2852640180 206
194 iso_pu_bacteria 2862281513 2862287207 206
195 iso_pu_bacteria 2862507626 2862512057 206
196 iso_pu_bacteria 2862574272 2862577981 206
197 iso_pu_bacteria 2867428634 2867435204 206
198 iso_pu_bacteria 2873151551 2873154539 206
199 iso_pu_bacteria 2877676314 2877679586 206
200 iso_pu_bacteria 2884693830 2884695862 206
201 iso_pu_bacteria 2895442618 2895445424 206
202 iso_pu_bacteria 2939602548 2939605330 206
203 iso_pu_bacteria 2946064051 2946069359 206
204 iso_pu_bacteria 2954380949 2954384499 206
205 iso_pu_bacteria 2954673503 2954678465 206
206 iso_pu_bacteria 2954682443 2954685690 206
207 iso_pu_bacteria 2954691527 2954695356 206
208 iso_pu_bacteria 2954701450 2954710547 206
209 iso_pu_bacteria 2954711539 2954714792 206
210 iso_pu_bacteria 2954721474 2954724737 206
211 iso_pu_bacteria 2954740390 2954743661 206
212 iso_pu_bacteria 2954759201 2954762614 206
213 iso_pu_bacteria 2998344455 2998345725 206
214 iso_pu_bacteria 3006393351 3006399110 206
215 3300044693 Ga0466961_0145682 Ga0466961_0145682_531_1274 207
216 3300044694 Ga0466963_0068156 Ga0466963_0068156_144_887 207
217 3300044719 Ga0466971_0226851 Ga0466971_0226851_110_853 207
218 iso_pu_bacteria 2643221601 2644014864 207
219 iso_pu_bacteria 2643221631 2644176299 207
220 iso_pu_bacteria 2784746763 2785341676 207
221 iso_pu_bacteria 2862290372 2862293396 207
222 iso_pu_bacteria 2862382967 2862384082 207
223 iso_pu_bacteria 2863404153 2863411356 207
224 iso_pu_bacteria 8008558824 8008566756 207
225 3300013307 Ga0157372_11297528 Ga0157372_112975282 208
226 3300015261 Ga0182006_1000067 Ga0182006_100006796 208
227 3300015262 Ga0182007_10000123 Ga0182007_1000012346 208
228 3300015265 Ga0182005_1000002 Ga0182005_100000237 208
229 3300021361 Ga0213872_10001107 Ga0213872_100011074 208
230 3300031507 Ga0307509_10013379 Ga0307509_1001337910 208
231 3300031616 Ga0307508_10016710 Ga0307508_100167103 208
232 3300031901 Ga0307406_10173533 Ga0307406_101735332 208
233 3300039447 Ga0436361_0007228 Ga0436361_0007228_1073_1711 208
234 3300039447 Ga0436361_0802016 Ga0436361_0802016_19142_19780 208
235 3300042131 Ga0450894_000045 Ga0450894_000045_526_1170 208
236 3300042133 Ga0450896_009320 Ga0450896_009320_430_1074 208
237 3300042135 Ga0450899_000042 Ga0450899_000042_2060_2704 208
238 3300042145 Ga0450906_003844 Ga0450906_003844_665_1309 208
239 3300044719 Ga0466971_0019939 Ga0466971_0019939_406_1194 208
240 3300045049 Ga0466959_0004532 Ga0466959_0004532_2584_3372 208
241 3300048914 Ga0496111_0371751 Ga0496111_0371751_220_894 208
242 3300048920 Ga0496117_0000001 Ga0496117_0000001_899862_900536 208
243 3300048921 Ga0496118_0000002 Ga0496118_0000002_899862_900536 208
244 3300048924 Ga0496121_0013269 Ga0496121_0013269_7797_8471 208
245 3300048927 Ga0496124_0058684 Ga0496124_0058684_2280_2954 208
246 iso_pu_bacteria 2643221641 2644231776 208
247 iso_pu_bacteria 2739367898 2740165394 208
248 iso_pu_bacteria 2895427314 2895438934 208
249 iso_pu_bacteria 2995463766 2995471378 208
250 iso_pu_bacteria 8055172936 8055173736 208
251 iso_pu_bacteria 8057568493 8057572345 208
252 3300006178 Ga0075367_10390260 Ga0075367_103902601 209
253 3300006195 Ga0075366_10060088 Ga0075366_100600882 209
254 3300009094 Ga0111539_11030966 Ga0111539_110309661 209
255 3300025935 Ga0207709_10744361 Ga0207709_107443611 209
256 3300037418 Ga0395900_0066377 Ga0395900_0066377_2636_3292 209
257 3300038443 Ga0395901_0305528 Ga0395901_0305528_634_1290 209
258 3300044658 Ga0466972_0080702 Ga0466972_0080702_620_1270 209
259 3300044683 Ga0466965_0137220 Ga0466965_0137220_563_1216 209
260 3300044765 Ga0466970_0034858 Ga0466970_0034858_1928_2581 209
261 3300045976 Ga0466967_0057144 Ga0466967_0057144_2654_3307 209
262 3300045976 Ga0466967_0903863 Ga0466967_0903863_197_850 209
263 3300046543 Ga0495645_0009259 Ga0495645_0009259_5479_6171 209
264 3300046558 Ga0495633_0001151 Ga0495633_0001151_1182_1856 209
265 3300049570 Ga0501033_0208126 Ga0501033_0208126_699_1349 209
266 3300049822 Ga0501035_0050113 Ga0501035_0050113_3012_3662 209
267 3300050493 nmdc:mga0k408_4433_c1 nmdc:mga0k408_4433_c1_3319_3966 209
268 3300061719 Ga0466962_0025883 Ga0466962_0025883_1609_2259 209
269 iso_pu_bacteria 2547132512 2548849143 209
270 iso_pu_bacteria 2643221665 2644361719 209
271 iso_pu_bacteria 2744054655 2745160028 209
272 iso_pu_bacteria 2744054655 2745161652 209
273 iso_pu_bacteria 2875391855 2875396200 209
274 iso_pu_bacteria 2918501144 2918505989 209
275 iso_pu_bacteria 2919688452 2919692129 209
276 iso_pu_bacteria 2928515477 2928517107 209
277 3300003316 rootH1_10007098 rootH1_100070982 210
278 3300003323 rootH1_10054269 rootH1_100542691 210
279 3300003856 Ga0058692_1000025 Ga0058692_1000025219 210
280 3300003856 Ga0058692_1001325 Ga0058692_100132511 210
281 3300006048 Ga0075363_100152709 Ga0075363_1001527092 210
282 3300009011 Ga0105251_10035794 Ga0105251_100357942 210
283 3300009011 Ga0105251_10145367 Ga0105251_101453671 210
284 3300009098 Ga0105245_10100173 Ga0105245_101001733 210
285 3300011119 Ga0105246_10245508 Ga0105246_102455081 210
286 3300017792 Ga0163161_10550756 Ga0163161_105507562 210
287 3300021361 Ga0213872_10006231 Ga0213872_100062314 210
288 3300025297 Ga0209758_1006507 Ga0209758_10065072 210
289 3300025728 Ga0207655_1000030 Ga0207655_100003094 210
290 3300027312 Ga0209371_1000036 Ga0209371_1000036214 210
291 3300027312 Ga0209371_1002657 Ga0209371_10026573 210
292 3300027312 Ga0209371_1011550 Ga0209371_10115502 210
293 3300030500 Ga0268256_1000040 Ga0268256_1000040105 210
294 3300030500 Ga0268256_1002353 Ga0268256_10023538 210
295 3300031649 Ga0307514_10006271 Ga0307514_100062715 210
296 3300031730 Ga0307516_10003058 Ga0307516_1000305825 210
297 3300031852 Ga0307410_10322209 Ga0307410_103222092 210
298 3300033180 Ga0307510_10004320 Ga0307510_100043205 210
299 3300037418 Ga0395900_0079576 Ga0395900_0079576_2428_3081 210
300 3300037466 Ga0395898_0028535 Ga0395898_0028535_3466_4119 210
301 3300037471 Ga0395905_0087003 Ga0395905_0087003_1137_1790 210
302 3300039447 Ga0436361_0921973 Ga0436361_0921973_351_1001 210
303 3300039447 Ga0436361_0922237 Ga0436361_0922237_19170_19820 210
304 3300042012 Ga0439455_0000348 Ga0439455_0000348_1943_2593 210
305 3300042138 Ga0450903_000542 Ga0450903_000542_6749_7399 210
306 3300042157 Ga0439458_0001470 Ga0439458_0001470_454_1104 210
307 3300044656 Ga0466969_0074981 Ga0466969_0074981_400_1185 210
308 3300046455 Ga0495603_0007330 Ga0495603_0007330_4041_4691 210
309 3300046455 Ga0495603_0007840 Ga0495603_0007840_5299_5949 210
310 3300046455 Ga0495603_0033176 Ga0495603_0033176_1593_2249 210
311 3300046459 Ga0495629_0007540 Ga0495629_0007540_717_1367 210
312 3300046459 Ga0495629_0134359 Ga0495629_0134359_50_700 210
313 3300046459 Ga0495629_0270034 Ga0495629_0270034_237_887 210
314 3300046474 Ga0495605_0095038 Ga0495605_0095038_431_1087 210
315 3300046476 Ga0495662_0009839 Ga0495662_0009839_1002_1652 210
316 3300046476 Ga0495662_0010977 Ga0495662_0010977_2817_3467 210
317 3300046492 Ga0495585_0164829 Ga0495585_0164829_261_917 210
318 3300046499 Ga0495594_0009975 Ga0495594_0009975_3169_3819 210
319 3300046499 Ga0495594_0030329 Ga0495594_0030329_1138_1794 210
320 3300046660 Ga0495625_0383906 Ga0495625_0383906_68_724 210
321 3300046665 Ga0495661_0051196 Ga0495661_0051196_1639_2295 210
322 3300046674 Ga0495588_0027301 Ga0495588_0027301_2143_2793 210
323 3300046689 Ga0495613_0085682 Ga0495613_0085682_1136_1786 210
324 3300046691 Ga0495670_0017680 Ga0495670_0017680_643_1299 210
325 3300046794 Ga0495589_0011121 Ga0495589_0011121_1142_1798 210
326 3300046794 Ga0495589_0120458 Ga0495589_0120458_375_1031 210
327 3300047315 Ga0495581_0036491 Ga0495581_0036491_332_982 210
328 3300047318 Ga0495636_0004733 Ga0495636_0004733_4490_5140 210
329 3300047318 Ga0495636_0011296 Ga0495636_0011296_1101_1751 210
330 3300047318 Ga0495636_0021870 Ga0495636_0021870_1906_2556 210
331 3300047321 Ga0495676_0036088 Ga0495676_0036088_2618_3274 210
332 3300047323 Ga0495683_0034182 Ga0495683_0034182_843_1499 210
333 3300047443 Ga0495687_036832 Ga0495687_036832_283_933 210
334 3300047443 Ga0495687_173310 Ga0495687_173310_23_679 210
335 3300047447 Ga0495685_002027 Ga0495685_002027_2873_3529 210
336 3300047447 Ga0495685_003406 Ga0495685_003406_2679_3329 210
337 3300047447 Ga0495685_005251 Ga0495685_005251_3225_3875 210
338 3300047447 Ga0495685_010802 Ga0495685_010802_14_664 210
339 3300047470 Ga0495681_0025275 Ga0495681_0025275_1191_1841 210
340 3300048089 Ga0495614_0080362 Ga0495614_0080362_491_1141 210
341 3300048907 Ga0496104_0581793 Ga0496104_0581793_365_1015 210
342 3300048912 Ga0496109_0025467 Ga0496109_0025467_788_1438 210
343 3300049570 Ga0501033_0141413 Ga0501033_0141413_110_769 210
344 3300049571 Ga0501034_0147089 Ga0501034_0147089_205_864 210
345 iso_pu_bacteria 2616644941 2616903068 210
346 iso_pu_bacteria 2891554331 2891558662 210
347 iso_pu_bacteria 8033232454 8033234578 210
348 iso_pu_bacteria 8048406513 8048412228 210
349 3300020082 Ga0206353_10552251 Ga0206353_105522513 211
350 3300026088 Ga0207641_10098511 Ga0207641_100985111 211
351 3300041406 Ga0439439_0001872 Ga0439439_0001872_998_1651 211
352 3300042007 Ga0439449_0037525 Ga0439449_0037525_1072_1722 211
353 3300042014 Ga0439457_001796 Ga0439457_001796_268_921 211
354 3300042876 Ga0451577_0679423 Ga0451577_0679423_46_693 211
355 3300044693 Ga0466961_0014177 Ga0466961_0014177_1271_1936 211
356 3300044765 Ga0466970_0165540 Ga0466970_0165540_183_845 211
357 3300046476 Ga0495662_0028001 Ga0495662_0028001_1725_2384 211
358 3300046674 Ga0495588_0205182 Ga0495588_0205182_206_868 211
359 3300046679 Ga0495623_0099321 Ga0495623_0099321_191_850 211
360 3300047317 Ga0495604_0020111 Ga0495604_0020111_2582_3241 211
361 3300047444 Ga0495675_0009963 Ga0495675_0009963_1756_2415 211
362 3300047447 Ga0495685_101466 Ga0495685_101466_43_705 211
363 3300049568 Ga0501031_0007119 Ga0501031_0007119_313_948 211
364 3300049569 Ga0501032_0012805 Ga0501032_0012805_347_982 211
365 3300049570 Ga0501033_0002135 Ga0501033_0002135_9864_10499 211
366 3300049571 Ga0501034_0147508 Ga0501034_0147508_1500_2135 211
367 3300049571 Ga0501034_0983704 Ga0501034_0983704_52_687 211
368 3300049572 Ga0501036_0000576 Ga0501036_0000576_24866_25501 211
369 3300049573 Ga0501037_0009522 Ga0501037_0009522_3727_4362 211
370 3300049574 Ga0501038_0006067 Ga0501038_0006067_7165_7800 211
371 3300049579 Ga0501043_0003457 Ga0501043_0003457_11111_11746 211
372 3300049580 Ga0501046_0015957 Ga0501046_0015957_5559_6194 211
373 3300049581 Ga0501047_0011643 Ga0501047_0011643_5256_5891 211
374 3300049822 Ga0501035_0007650 Ga0501035_0007650_1455_2090 211
375 3300049822 Ga0501035_0415271 Ga0501035_0415271_416_1051 211
376 3300049823 Ga0501044_0002016 Ga0501044_0002016_8748_9383 211
377 3300053149 Ga0500600_0086445 Ga0500600_0086445_959_1609 211
378 iso_pu_bacteria 2582581312 2585296090 211
379 3300003354 JGI25160J50197_1020461 JGI25160J50197_10204612 212
380 3300005535 Ga0070684_100256708 Ga0070684_1002567081 212
381 3300006051 Ga0075364_10043348 Ga0075364_100433485 212
382 3300020078 Ga0206352_10334922 Ga0206352_103349221 212
383 3300025302 Ga0207426_1004524 Ga0207426_10045243 212
384 3300025302 Ga0207426_1008470 Ga0207426_10084704 212
385 3300025302 Ga0207426_1016632 Ga0207426_10166321 212
386 3300028379 Ga0268266_11082022 Ga0268266_110820221 212
387 3300031852 Ga0307410_10364955 Ga0307410_103649551 212
388 3300039447 Ga0436361_0028828 Ga0436361_0028828_31_687 212
389 3300041494 Ga0451837_1229693 Ga0451837_1229693_113_784 212
390 3300046454 Ga0495592_0185898 Ga0495592_0185898_736_1395 212
391 3300046462 Ga0495651_0033152 Ga0495651_0033152_29_688 212
392 3300046463 Ga0495653_0070603 Ga0495653_0070603_864_1523 212
393 3300046472 Ga0495580_0055666 Ga0495580_0055666_2011_2670 212
394 3300046476 Ga0495662_0001795 Ga0495662_0001795_5285_5944 212
395 3300046511 Ga0495608_0075832 Ga0495608_0075832_797_1456 212
396 3300046516 Ga0495628_0065534 Ga0495628_0065534_235_894 212
397 3300046517 Ga0495630_0118545 Ga0495630_0118545_1336_1995 212
398 3300046526 Ga0495666_0001499 Ga0495666_0001499_9675_10334 212
399 3300046531 Ga0495665_0012858 Ga0495665_0012858_1650_2309 212
400 3300046543 Ga0495645_0044479 Ga0495645_0044479_17_676 212
401 3300046559 Ga0495667_0023067 Ga0495667_0023067_3341_4000 212
402 3300046642 Ga0495634_0137943 Ga0495634_0137943_29_688 212
403 3300046675 Ga0495657_0061541 Ga0495657_0061541_1268_1927 212
404 3300046680 Ga0495646_0011392 Ga0495646_0011392_235_894 212
405 3300046689 Ga0495613_0024695 Ga0495613_0024695_1754_2413 212
406 3300046809 Ga0495600_0307741 Ga0495600_0307741_311_970 212
407 3300047317 Ga0495604_0000590 Ga0495604_0000590_8282_8941 212
408 3300047444 Ga0495675_0278198 Ga0495675_0278198_311_970 212
409 3300047471 Ga0495684_0071566 Ga0495684_0071566_1947_2606 212
410 3300048088 Ga0495602_0086611 Ga0495602_0086611_788_1447 212
411 3300049569 Ga0501032_0208143 Ga0501032_0208143_340_1011 212
412 3300049570 Ga0501033_0403142 Ga0501033_0403142_234_905 212
413 3300049572 Ga0501036_0393124 Ga0501036_0393124_446_1117 212
414 3300049573 Ga0501037_0268865 Ga0501037_0268865_24_695 212
415 3300049574 Ga0501038_0195117 Ga0501038_0195117_466_1137 212
416 3300049575 Ga0501039_0093817 Ga0501039_0093817_866_1537 212
417 3300049587 Ga0501071_0236477 Ga0501071_0236477_549_1220 212
418 3300049591 Ga0501075_0633400 Ga0501075_0633400_109_780 212
419 3300049824 Ga0501045_0097017 Ga0501045_0097017_158_829 212
420 3300050491 nmdc:mga00v17_294249_c1 nmdc:mga00v17_294249_c1_156_827 212
421 3300060353 Ga0501082_0428053 Ga0501082_0428053_40_711 212
422 iso_pu_bacteria 2891633521 2891634418 212
423 3300006195 Ga0075366_10002780 Ga0075366_1000278013 213
424 3300009011 Ga0105251_10018652 Ga0105251_100186523 213
425 3300009036 Ga0105244_10000076 Ga0105244_1000007698 213
426 3300009147 Ga0114129_10377697 Ga0114129_103776972 213
427 3300009553 Ga0105249_10004632 Ga0105249_100046329 213
428 3300013102 Ga0157371_10006566 Ga0157371_100065669 213
429 3300013307 Ga0157372_10017379 Ga0157372_100173794 213
430 3300013307 Ga0157372_10034019 Ga0157372_100340193 213
431 3300021361 Ga0213872_10088999 Ga0213872_100889992 213
432 3300025728 Ga0207655_1001907 Ga0207655_100190713 213
433 3300025735 Ga0207713_1032021 Ga0207713_10320211 213
434 3300025961 Ga0207712_10004502 Ga0207712_100045024 213
435 3300031238 Ga0265332_10000013 Ga0265332_10000013228 213
436 3300031241 Ga0265325_10057382 Ga0265325_100573823 213
437 3300039447 Ga0436361_0505573 Ga0436361_0505573_486_1145 213
438 3300041512 Ga0451853_0516285 Ga0451853_0516285_168_815 213
439 3300042876 Ga0451577_0288609 Ga0451577_0288609_450_1097 213
440 3300044656 Ga0466969_0026071 Ga0466969_0026071_1519_2178 213
441 3300044684 Ga0466966_0039685 Ga0466966_0039685_2054_2713 213
442 3300044693 Ga0466961_0000765 Ga0466961_0000765_56_715 213
443 3300044706 Ga0466964_0100956 Ga0466964_0100956_580_1239 213
444 3300045049 Ga0466959_0122595 Ga0466959_0122595_1042_1701 213
445 3300046692 Ga0495671_0351320 Ga0495671_0351320_30_683 213
446 3300048919 Ga0496116_0002105 Ga0496116_0002105_14472_15119 213
447 3300048922 Ga0496119_0003104 Ga0496119_0003104_6783_7430 213
448 3300048923 Ga0496120_0000028 Ga0496120_0000028_81384_82031 213
449 3300048927 Ga0496124_0001246 Ga0496124_0001246_2593_3240 213
450 3300050493 nmdc:mga0k408_1230_c1 nmdc:mga0k408_1230_c1_6688_7338 213
451 iso_pu_bacteria 2891395885 2891400959 213
452 3300005344 Ga0070661_100407762 Ga0070661_1004077622 214
453 3300005985 Ga0081539_10000709 Ga0081539_1000070911 214
454 3300009148 Ga0105243_11016140 Ga0105243_110161401 214
455 3300050509 nmdc:mga0qj67_126676_c1 nmdc:mga0qj67_126676_c1_330_998 214
456 3300028800 Ga0265338_10285782 Ga0265338_102857822 215
457 3300044712 Ga0453684_0027032 Ga0453684_0027032_4962_5642 215
458 3300045051 Ga0451576_0003274 Ga0451576_0003274_14417_15097 215
459 3300003578 Ga0006562J51391_1041146 Ga0006562J51391_10411461 216
460 3300031251 Ga0265327_10122603 Ga0265327_101226032 216
461 3300037418 Ga0395900_0097583 Ga0395900_0097583_751_1440 216
462 3300044693 Ga0466961_0320073 Ga0466961_0320073_113_796 216
463 3300044712 Ga0453684_0000657 Ga0453684_0000657_65272_65931 216
464 iso_pu_bacteria 2643221678 2644438682 216
465 iso_pu_bacteria 2811994879 2812356504 216
466 3300039447 Ga0436361_0662050 Ga0436361_0662050_1366_2028 217
467 3300046471 Ga0495650_0000056 Ga0495650_0000056_91315_91980 217
468 3300046471 Ga0495650_0002634 Ga0495650_0002634_1202_1867 217
469 3300046522 Ga0495643_0078160 Ga0495643_0078160_1025_1690 217
470 iso_pu_bacteria 2582581314 2585316078 217
471 iso_pu_bacteria 2600255292 2601668145 217
472 iso_pu_bacteria 2857547612 2857550379 217
473 iso_pu_bacteria 2885080285 2885081797 217
474 iso_pu_bacteria 2932410948 2932411851 217
475 iso_pu_bacteria 2932416698 2932418582 217
476 3300044666 Ga0466977_0008418 Ga0466977_0008418_415_1083 218
477 3300049459 Ga0495678_018990 Ga0495678_018990_2343_3011 218
478 3300049579 Ga0501043_0570764 Ga0501043_0570764_120_788 218
479 iso_pu_bacteria 2513237150 2513956419 218
480 iso_pu_bacteria 2513237165 2514041519 218
481 iso_pu_bacteria 2834641062 2834645023 218
482 iso_pu_bacteria 2858688981 2858695242 218
483 iso_pu_bacteria 644736347 644748299 218
484 iso_pu_bacteria 8003400568 8003401409 218
485 3300006846 Ga0075430_100136085 Ga0075430_1001360852 219
486 3300017792 Ga0163161_10020619 Ga0163161_100206192 220
487 3300025273 Ga0209673_1034247 Ga0209673_10342472 220
488 3300032004 Ga0307414_10209347 Ga0307414_102093472 220
489 3300049571 Ga0501034_0001049 Ga0501034_0001049_38294_38965 220
490 iso_pu_bacteria 2596583598 2597031968 220
491 iso_pu_bacteria 2599185178 2599444087 220
492 iso_pu_bacteria 2885266251 2885269881 220
493 iso_pu_bacteria 2900577576 2900579348 220
494 iso_pu_bacteria 2928058823 2928062310 220
495 3300003187 JGI25151J46595_10035285 JGI25151J46595_100352852 221
496 3300003215 JGI25153J46596_10054376 JGI25153J46596_100543761 221
497 3300003771 Ga0055526_1026693 Ga0055526_10266932 221
498 3300003775 Ga0055524_1002307 Ga0055524_10023072 221
499 3300014497 Ga0182008_10000119 Ga0182008_1000011937 221
500 3300025263 Ga0209565_1000084 Ga0209565_10000847 221
501 3300025294 Ga0209025_1000214 Ga0209025_100021476 221
502 3300025295 Ga0209564_1022535 Ga0209564_10225352 221
503 3300025297 Ga0209758_1023388 Ga0209758_10233882 221
504 3300025299 Ga0209256_1001006 Ga0209256_10010065 221
505 3300048919 Ga0496116_0075488 Ga0496116_0075488_995_1675 221
506 3300048924 Ga0496121_0006753 Ga0496121_0006753_315_989 221
507 3300048925 Ga0496122_0001676 Ga0496122_0001676_17082_17756 221
508 3300048926 Ga0496123_0002807 Ga0496123_0002807_4060_4734 221
509 3300048928 Ga0496125_0305834 Ga0496125_0305834_32_706 221
510 3300049460 Ga0495682_0003131 Ga0495682_0003131_5670_6344 221
511 3300003187 JGI25151J46595_10004611 JGI25151J46595_100046112 222
512 3300003187 JGI25151J46595_10026146 JGI25151J46595_100261462 222
513 3300003775 Ga0055524_1008846 Ga0055524_10088464 222
514 3300003781 Ga0055536_1000108 Ga0055536_100010860 222
515 3300003784 Ga0055534_1010636 Ga0055534_10106362 222
516 3300006948 Ga0099826_10000029 Ga0099826_1000002977 222
517 3300025263 Ga0209565_1010070 Ga0209565_10100702 222
518 3300025284 Ga0209130_1006165 Ga0209130_10061652 222
519 3300025291 Ga0209675_1000464 Ga0209675_10004642 222
520 3300025292 Ga0209676_1000012 Ga0209676_1000012184 222
521 3300025294 Ga0209025_1001025 Ga0209025_100102524 222
522 3300025294 Ga0209025_1007952 Ga0209025_10079527 222
523 3300025294 Ga0209025_1032342 Ga0209025_10323422 222
524 3300025295 Ga0209564_1025321 Ga0209564_10253212 222
525 3300025295 Ga0209564_1026027 Ga0209564_10260272 222
526 3300025299 Ga0209256_1000468 Ga0209256_10004687 222
527 3300025303 Ga0209051_1012366 Ga0209051_10123662 222
528 3300027666 Ga0209282_1001593 Ga0209282_10015935 222
529 3300046457 Ga0495590_0123847 Ga0495590_0123847_71_748 222
530 3300046474 Ga0495605_0033687 Ga0495605_0033687_856_1533 222
531 3300046491 Ga0495584_0122503 Ga0495584_0122503_529_1206 222
532 3300046500 Ga0495596_0023925 Ga0495596_0023925_1114_1791 222
533 3300046501 Ga0495607_0089016 Ga0495607_0089016_239_916 222
534 3300046512 Ga0495610_0039594 Ga0495610_0039594_818_1495 222
535 3300046513 Ga0495616_0042417 Ga0495616_0042417_768_1445 222
536 3300046524 Ga0495648_0231871 Ga0495648_0231871_86_763 222
537 3300046538 Ga0495609_0038915 Ga0495609_0038915_561_1238 222
538 3300046615 Ga0495656_0142997 Ga0495656_0142997_210_887 222
539 3300046665 Ga0495661_0094528 Ga0495661_0094528_395_1072 222
540 3300046684 Ga0495669_0265186 Ga0495669_0265186_49_726 222
541 3300046692 Ga0495671_0040339 Ga0495671_0040339_820_1497 222
542 3300046694 Ga0495649_0079256 Ga0495649_0079256_908_1585 222
543 3300046794 Ga0495589_0168587 Ga0495589_0168587_230_907 222
544 3300048905 Ga0496102_0167677 Ga0496102_0167677_708_1385 222
545 3300048907 Ga0496104_0393896 Ga0496104_0393896_572_1249 222
546 3300048919 Ga0496116_0080291 Ga0496116_0080291_602_1279 222
547 3300048924 Ga0496121_0193629 Ga0496121_0193629_231_908 222
548 3300048925 Ga0496122_0085638 Ga0496122_0085638_898_1575 222
549 3300048926 Ga0496123_0067793 Ga0496123_0067793_755_1432 222
550 3300048928 Ga0496125_0214382 Ga0496125_0214382_304_981 222
551 3300047323 Ga0495683_0032650 Ga0495683_0032650_313_1056 223
552 3300001915 JGI24741J21665_1000679 JGI24741J21665_10006792 224
553 3300001979 JGI24740J21852_10029859 JGI24740J21852_100298592 224
554 3300001979 JGI24740J21852_10030041 JGI24740J21852_100300411 224
555 3300002705 JGI25156J39149_1018101 JGI25156J39149_10181012 224
556 3300002705 JGI25156J39149_1024588 JGI25156J39149_10245881 224
557 3300002738 JGI25154J39366_1000136 JGI25154J39366_100013653 224
558 3300003578 Ga0006562J51391_1026270 Ga0006562J51391_10262701 224
559 3300003752 Ga0055539_1000061 Ga0055539_100006168 224
560 3300003758 Ga0055532_1000042 Ga0055532_100004253 224
561 3300003759 Ga0055525_1000480 Ga0055525_10004807 224
562 3300003759 Ga0055525_1000616 Ga0055525_100061615 224
563 3300003760 Ga0055527_1000169 Ga0055527_100016920 224
564 3300003761 Ga0055535_1000031 Ga0055535_1000031149 224
565 3300003762 Ga0055542_1001292 Ga0055542_10012929 224
566 3300003763 Ga0055529_1000075 Ga0055529_1000075103 224
567 3300003841 Ga0055541_1002919 Ga0055541_10029191 224
568 3300003841 Ga0055541_1015165 Ga0055541_10151652 224
569 3300005344 Ga0070661_100002111 Ga0070661_10000211114 224
570 3300005366 Ga0070659_100028665 Ga0070659_1000286652 224
571 3300005455 Ga0070663_100000086 Ga0070663_10000008620 224
572 3300005564 Ga0070664_100000210 Ga0070664_10000021020 224
573 3300005578 Ga0068854_100000176 Ga0068854_10000017618 224
574 3300005614 Ga0068856_100000539 Ga0068856_10000053920 224
575 3300005616 Ga0068852_100293395 Ga0068852_1002933952 224
576 3300013100 Ga0157373_10129255 Ga0157373_101292552 224
577 3300013307 Ga0157372_10006060 Ga0157372_1000606015 224
578 3300025224 Ga0209784_100003 Ga0209784_1000031332 224
579 3300025224 Ga0209784_100686 Ga0209784_10068610 224
580 3300025225 Ga0209566_100002 Ga0209566_1000022286 224
581 3300025225 Ga0209566_100330 Ga0209566_10033045 224
582 3300025225 Ga0209566_102470 Ga0209566_1024702 224
583 3300025226 Ga0209674_100094 Ga0209674_100094103 224
584 3300025226 Ga0209674_104116 Ga0209674_1041162 224
585 3300025228 Ga0209672_100096 Ga0209672_10009671 224
586 3300025229 Ga0209147_100002 Ga0209147_100002989 224
587 3300025230 Ga0209563_100004 Ga0209563_1000041703 224
588 3300025242 Ga0209258_100002 Ga0209258_100002989 224
589 3300025246 Ga0209646_1000019 Ga0209646_1000019255 224
590 3300025250 Ga0209026_1011832 Ga0209026_10118322 224
591 3300025253 Ga0209677_100071 Ga0209677_10007173 224
592 3300025254 Ga0209148_1000118 Ga0209148_100011895 224
593 3300025256 Ga0209759_1004997 Ga0209759_10049973 224
594 3300025256 Ga0209759_1012625 Ga0209759_10126252 224
595 3300025272 Ga0209455_1000009 Ga0209455_1000009870 224
596 3300025913 Ga0207695_10003065 Ga0207695_100030659 224
597 3300025932 Ga0207690_10001107 Ga0207690_100011076 224
598 3300025945 Ga0207679_10000240 Ga0207679_1000024019 224
599 3300025981 Ga0207640_10000049 Ga0207640_1000004968 224
600 3300026067 Ga0207678_10000353 Ga0207678_1000035318 224
601 3300026078 Ga0207702_10000550 Ga0207702_1000055018 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

246

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4553 14 194
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4135 17 200
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.3772 14 194
5f4y-assembly1.cif.gz_A structure of the sd2 domain of human shroom2 0.3354 36 189
5f5p-assembly1.cif.gz_A molecular basis for shroom2 recognition by rock1 0.3187 32 192
ID Description Score Start End Superfamily
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4592 14 193 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4546 16 191 1.20.1250.20
af_Q6P2T9_1_103_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4519 78 191 1.20.120.350
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4287 3 193 1.20.1250.20
af_Q6P2T9_1_103_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.415 78 191 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A6H0CX50-F1-model_v4 Leucine efflux protein LeuE 0.9373 9 221 GO:0005886
GO:0015190
GO:0015820
AF-A0A1G7VGT7-F1-model_v4 Leucine efflux protein 0.9372 8 220 GO:0005886
GO:0015190
GO:0015820
AF-P38102-F1-model_v4 Uncharacterized membrane protein PA4757 0.9348 9 224 GO:0005886
GO:0015190
GO:0015820
AF-A0A5M3XKK9-F1-model_v4 Leucine efflux protein 0.9234 8 220 GO:0005886
GO:0015190
GO:0015820
AF-A0A3N0D5H8-F1-model_v4 Leucine efflux protein LeuE 0.9218 9 220 GO:0005886
GO:0015190
GO:0015820

Feature Viewer

pLDDT pTM Quality
84.76 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map