F468098
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 601 | 415 | 502 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300047323|Ga0495683_0032650|Ga0495683_0032650_313_1056 |
| Length | 247 |
| Sequence | MAVASAALIRFTSCDRPEHFMNNLMQASFGVVDFWTFFLGTLFIVLLPGPNSLYVLSVAAQRGVRQGYLGACGVFVGDWILMILSACGAASLLKTSPVLFMAVKFIGAAYLGWIGLQMLIGCWRRLRAGSDVDAXXXAARMLAPVVRGVHPFKKALAISLLNPKAILFFISFFVQFVDPHFHSSLVSFGMLGLICQLLSFTYLTALIFLGTRLAAVFQRRRRLSAGLSAGVGALFMGFGLKLATATL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 2 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 9 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 10 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 11 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 12 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 13 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 14 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 15 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 16 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 17 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 18 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 19 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 20 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 21 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 22 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 23 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 24 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 25 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 26 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 27 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 28 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 29 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 30 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 31 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 32 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 33 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 34 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 35 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 36 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 37 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 38 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 39 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 40 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 41 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 42 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 43 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 44 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 45 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 46 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 47 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 48 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 49 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 50 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 51 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 52 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 53 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 54 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 55 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 56 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 57 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 58 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 59 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 60 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 61 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 62 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 63 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 64 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 65 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 66 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 67 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 68 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 69 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 70 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 71 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 72 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 73 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 74 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 75 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 76 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 77 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 78 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 79 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 80 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 81 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 82 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 83 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 84 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 85 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 86 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 87 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 88 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 89 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 90 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 91 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 92 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 93 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 94 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 95 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 96 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 97 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 98 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 99 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 100 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 102 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 103 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 104 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 105 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 106 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 107 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 109 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 110 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 111 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 113 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 236 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 237 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 238 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 241 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 245 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 246 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 247 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 248 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 249 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 250 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 251 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 252 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 253 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 254 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 364 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 381 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 384 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 385 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 386 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 387 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 388 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 400 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 401 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 403 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 404 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 408 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 409 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 410 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 411 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 412 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 413 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 414 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 415 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.53 |
| Metatranscriptomes | 1 |
| Isolates | 16.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 1.5 |
| Rhizoplane | 1.16 |
| Rhizosphere | 66.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000679 | 3300001915 | Bacteria | 10254 |
| 2 | JGI24740J21852_10029859 | 3300001979 | Bacteria | 1784 |
| 3 | JGI24740J21852_10030041 | 3300001979 | Bacteria | 1775 |
| 4 | JGI25156J39149_1018101 | 3300002705 | Bacteria | 1313 |
| 5 | JGI25156J39149_1024588 | 3300002705 | Bacteria | 983 |
| 6 | JGI25154J39366_1000136 | 3300002738 | Bacteria | 57760 |
| 7 | JGI25151J46595_10004611 | 3300003187 | Bacteria | 7254 |
| 8 | JGI25151J46595_10026146 | 3300003187 | Bacteria | 2360 |
| 9 | JGI25151J46595_10035285 | 3300003187 | Bacteria | 1901 |
| 10 | JGI25153J46596_10054376 | 3300003215 | Bacteria | 1127 |
| 11 | rootH1_10007098 | 3300003316 | Bacteria | 1112 |
| 12 | rootH1_10037411 | 3300003316 | Bacteria | 5055 |
| 13 | rootH1_10054269 | 3300003323 | Bacteria | 1325 |
| 14 | JGI25160J50197_1020461 | 3300003354 | Bacteria | 1995 |
| 15 | Ga0006562J51391_1026270 | 3300003578 | Bacteria | 873 |
| 16 | Ga0006562J51391_1041146 | 3300003578 | Bacteria | 1090 |
| 17 | Ga0055539_1000061 | 3300003752 | Bacteria | 144457 |
| 18 | Ga0055532_1000042 | 3300003758 | Bacteria | 195195 |
| 19 | Ga0055525_1000480 | 3300003759 | Bacteria | 21423 |
| 20 | Ga0055525_1000616 | 3300003759 | Bacteria | 14804 |
| 21 | Ga0055527_1000169 | 3300003760 | Bacteria | 45013 |
| 22 | Ga0055535_1000031 | 3300003761 | Bacteria | 195195 |
| 23 | Ga0055542_1001292 | 3300003762 | Bacteria | 13371 |
| 24 | Ga0055529_1000075 | 3300003763 | Bacteria | 156291 |
| 25 | Ga0055526_1026693 | 3300003771 | Bacteria | 1811 |
| 26 | Ga0055524_1002307 | 3300003775 | Bacteria | 9936 |
| 27 | Ga0055524_1008846 | 3300003775 | Bacteria | 4147 |
| 28 | Ga0055536_1000108 | 3300003781 | Bacteria | 73142 |
| 29 | Ga0055534_1010636 | 3300003784 | Bacteria | 1913 |
| 30 | Ga0055531_10000011 | 3300003794 | Bacteria | 195010 |
| 31 | Ga0055541_1002919 | 3300003841 | Bacteria | 3299 |
| 32 | Ga0055541_1015165 | 3300003841 | Bacteria | 1033 |
| 33 | Ga0058692_1000025 | 3300003856 | Bacteria | 217356 |
| 34 | Ga0058692_1001325 | 3300003856 | Bacteria | 9285 |
| 35 | Ga0070683_100003993 | 3300005329 | Bacteria | 12083 |
| 36 | Ga0070680_100082043 | 3300005336 | Bacteria | 2661 |
| 37 | Ga0070682_100213578 | 3300005337 | Bacteria | 1369 |
| 38 | Ga0070661_100002111 | 3300005344 | Bacteria | 13690 |
| 39 | Ga0070661_100407762 | 3300005344 | Bacteria | 1076 |
| 40 | Ga0070659_100028665 | 3300005366 | Bacteria | 4302 |
| 41 | Ga0070709_10025818 | 3300005434 | Bacteria | 3473 |
| 42 | Ga0070663_100000086 | 3300005455 | Bacteria | 41783 |
| 43 | Ga0070684_100004378 | 3300005535 | Bacteria | 10735 |
| 44 | Ga0070684_100256708 | 3300005535 | Bacteria | 1598 |
| 45 | Ga0070664_100000210 | 3300005564 | Bacteria | 41664 |
| 46 | Ga0068857_100323692 | 3300005577 | Bacteria | 1424 |
| 47 | Ga0068854_100000176 | 3300005578 | Bacteria | 43579 |
| 48 | Ga0068856_100000539 | 3300005614 | Bacteria | 41776 |
| 49 | Ga0068856_100813534 | 3300005614 | Bacteria | 954 |
| 50 | Ga0068852_100293395 | 3300005616 | Bacteria | 1572 |
| 51 | Ga0081539_10000709 | 3300005985 | Bacteria | 66741 |
| 52 | Ga0075363_100152709 | 3300006048 | Bacteria | 1304 |
| 53 | Ga0075364_10043348 | 3300006051 | Bacteria | 2925 |
| 54 | Ga0075367_10390260 | 3300006178 | Bacteria | 880 |
| 55 | Ga0075366_10002780 | 3300006195 | Bacteria | 9062 |
| 56 | Ga0075366_10060088 | 3300006195 | Bacteria | 2258 |
| 57 | Ga0075370_10077364 | 3300006353 | Bacteria | 1909 |
| 58 | Ga0075370_10344754 | 3300006353 | Bacteria | 889 |
| 59 | Ga0075430_100136085 | 3300006846 | Bacteria | 2047 |
| 60 | Ga0075431_100077526 | 3300006847 | Bacteria | 3430 |
| 61 | Ga0099826_10000029 | 3300006948 | Bacteria | 128855 |
| 62 | Ga0105251_10018652 | 3300009011 | Bacteria | 3683 |
| 63 | Ga0105251_10035794 | 3300009011 | Bacteria | 2447 |
| 64 | Ga0105251_10145367 | 3300009011 | Bacteria | 1072 |
| 65 | Ga0105244_10000076 | 3300009036 | Bacteria | 110824 |
| 66 | Ga0105240_10454623 | 3300009093 | Bacteria | 1432 |
| 67 | Ga0111539_11030966 | 3300009094 | Bacteria | 956 |
| 68 | Ga0105245_10100173 | 3300009098 | Bacteria | 2680 |
| 69 | Ga0114129_10377697 | 3300009147 | Bacteria | 1872 |
| 70 | Ga0105243_10288804 | 3300009148 | Bacteria | 1481 |
| 71 | Ga0105243_11016140 | 3300009148 | Bacteria | 833 |
| 72 | Ga0105249_10004632 | 3300009553 | Bacteria | 11881 |
| 73 | Ga0105239_10195606 | 3300010375 | Bacteria | 2264 |
| 74 | Ga0105246_10245508 | 3300011119 | Bacteria | 1418 |
| 75 | Ga0157373_10129255 | 3300013100 | Bacteria | 1776 |
| 76 | Ga0157371_10006566 | 3300013102 | Bacteria | 9565 |
| 77 | Ga0157369_10007469 | 3300013105 | Bacteria | 12585 |
| 78 | Ga0157369_10596192 | 3300013105 | Bacteria | 1141 |
| 79 | Ga0157372_10006060 | 3300013307 | Bacteria | 12846 |
| 80 | Ga0157372_10017379 | 3300013307 | Bacteria | 7720 |
| 81 | Ga0157372_10034019 | 3300013307 | Bacteria | 5599 |
| 82 | Ga0157372_11297528 | 3300013307 | Bacteria | 840 |
| 83 | Ga0182008_10000119 | 3300014497 | Bacteria | 59427 |
| 84 | Ga0182006_1000067 | 3300015261 | Bacteria | 147932 |
| 85 | Ga0182007_10000123 | 3300015262 | Bacteria | 53953 |
| 86 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 87 | Ga0163161_10020619 | 3300017792 | Bacteria | 4628 |
| 88 | Ga0163161_10550756 | 3300017792 | Bacteria | 945 |
| 89 | Ga0206352_10334922 | 3300020078 | Bacteria | 1820 |
| 90 | Ga0206353_10552251 | 3300020082 | Bacteria | 2105 |
| 91 | Ga0213872_10001107 | 3300021361 | Bacteria | 18438 |
| 92 | Ga0213872_10006231 | 3300021361 | Bacteria | 6024 |
| 93 | Ga0213872_10088999 | 3300021361 | Bacteria | 1383 |
| 94 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 95 | Ga0209784_100686 | 3300025224 | Bacteria | 9430 |
| 96 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 97 | Ga0209566_100330 | 3300025225 | Bacteria | 42404 |
| 98 | Ga0209566_102470 | 3300025225 | Bacteria | 3401 |
| 99 | Ga0209674_100094 | 3300025226 | Bacteria | 169506 |
| 100 | Ga0209674_104116 | 3300025226 | Bacteria | 2451 |
| 101 | Ga0209672_100096 | 3300025228 | Bacteria | 112947 |
| 102 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 103 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 104 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 105 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 106 | Ga0209026_1011832 | 3300025250 | Bacteria | 1547 |
| 107 | Ga0209677_100071 | 3300025253 | Bacteria | 139425 |
| 108 | Ga0209148_1000118 | 3300025254 | Bacteria | 188330 |
| 109 | Ga0209759_1004997 | 3300025256 | Bacteria | 4776 |
| 110 | Ga0209759_1012625 | 3300025256 | Bacteria | 2328 |
| 111 | Ga0209565_1000084 | 3300025263 | Bacteria | 153894 |
| 112 | Ga0209565_1010070 | 3300025263 | Bacteria | 2360 |
| 113 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 114 | Ga0209673_1034247 | 3300025273 | Bacteria | 1537 |
| 115 | Ga0209130_1006165 | 3300025284 | Bacteria | 3954 |
| 116 | Ga0209675_1000464 | 3300025291 | Bacteria | 31142 |
| 117 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 118 | Ga0209025_1000214 | 3300025294 | Bacteria | 138780 |
| 119 | Ga0209025_1001025 | 3300025294 | Bacteria | 41120 |
| 120 | Ga0209025_1007952 | 3300025294 | Bacteria | 7760 |
| 121 | Ga0209025_1032342 | 3300025294 | Bacteria | 2448 |
| 122 | Ga0209564_1022535 | 3300025295 | Bacteria | 2222 |
| 123 | Ga0209564_1025321 | 3300025295 | Bacteria | 2000 |
| 124 | Ga0209564_1026027 | 3300025295 | Bacteria | 1947 |
| 125 | Ga0209758_1006507 | 3300025297 | Bacteria | 8345 |
| 126 | Ga0209758_1023388 | 3300025297 | Bacteria | 2796 |
| 127 | Ga0209050_1009066 | 3300025298 | Bacteria | 5170 |
| 128 | Ga0209256_1000468 | 3300025299 | Bacteria | 60770 |
| 129 | Ga0209256_1001006 | 3300025299 | Bacteria | 33408 |
| 130 | Ga0207426_1004524 | 3300025302 | Bacteria | 6728 |
| 131 | Ga0207426_1008470 | 3300025302 | Bacteria | 4148 |
| 132 | Ga0207426_1016632 | 3300025302 | Bacteria | 2634 |
| 133 | Ga0209051_1002325 | 3300025303 | Bacteria | 13807 |
| 134 | Ga0209051_1012366 | 3300025303 | Bacteria | 4135 |
| 135 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 136 | Ga0207655_1000030 | 3300025728 | Bacteria | 413221 |
| 137 | Ga0207655_1001093 | 3300025728 | Bacteria | 26680 |
| 138 | Ga0207655_1001907 | 3300025728 | Bacteria | 17900 |
| 139 | Ga0207713_1032021 | 3300025735 | Bacteria | 2315 |
| 140 | Ga0207699_10021514 | 3300025906 | Bacteria | 3478 |
| 141 | Ga0207695_10003065 | 3300025913 | Bacteria | 23956 |
| 142 | Ga0207695_10483383 | 3300025913 | Bacteria | 1120 |
| 143 | Ga0207660_10402059 | 3300025917 | Bacteria | 1103 |
| 144 | Ga0207690_10001107 | 3300025932 | Bacteria | 17169 |
| 145 | Ga0207709_10744361 | 3300025935 | Bacteria | 787 |
| 146 | Ga0207704_10345353 | 3300025938 | Bacteria | 1157 |
| 147 | Ga0207661_10000747 | 3300025944 | Bacteria | 21096 |
| 148 | Ga0207679_10000240 | 3300025945 | Bacteria | 41798 |
| 149 | Ga0207679_10014167 | 3300025945 | Bacteria | 5236 |
| 150 | Ga0207712_10004502 | 3300025961 | Bacteria | 8805 |
| 151 | Ga0207640_10000049 | 3300025981 | Bacteria | 97025 |
| 152 | Ga0207678_10000353 | 3300026067 | Bacteria | 41741 |
| 153 | Ga0207702_10000550 | 3300026078 | Bacteria | 41779 |
| 154 | Ga0207702_10715809 | 3300026078 | Bacteria | 987 |
| 155 | Ga0207641_10098511 | 3300026088 | Bacteria | 2571 |
| 156 | Ga0207674_10283821 | 3300026116 | Bacteria | 1604 |
| 157 | Ga0209371_1000036 | 3300027312 | Bacteria | 367250 |
| 158 | Ga0209371_1002657 | 3300027312 | Bacteria | 9739 |
| 159 | Ga0209371_1011550 | 3300027312 | Bacteria | 2616 |
| 160 | Ga0209282_1001593 | 3300027666 | Bacteria | 12556 |
| 161 | Ga0268266_11082022 | 3300028379 | Bacteria | 776 |
| 162 | Ga0307517_10002842 | 3300028786 | Bacteria | 27511 |
| 163 | Ga0307515_10000497 | 3300028794 | Bacteria | 94190 |
| 164 | Ga0307515_10054430 | 3300028794 | Bacteria | 5875 |
| 165 | Ga0307515_10088171 | 3300028794 | Bacteria | 3926 |
| 166 | Ga0307515_10234736 | 3300028794 | Bacteria | 1618 |
| 167 | Ga0265338_10285782 | 3300028800 | Bacteria | 1204 |
| 168 | Ga0268256_1000040 | 3300030500 | Bacteria | 348002 |
| 169 | Ga0268256_1002353 | 3300030500 | Bacteria | 9739 |
| 170 | Ga0307511_10000238 | 3300030521 | Bacteria | 56455 |
| 171 | Ga0307512_10015539 | 3300030522 | Bacteria | 7051 |
| 172 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 173 | Ga0265325_10057382 | 3300031241 | Bacteria | 1985 |
| 174 | Ga0265327_10122603 | 3300031251 | Unclassified | 1230 |
| 175 | Ga0265316_10290426 | 3300031344 | Bacteria | 1193 |
| 176 | Ga0307513_10069290 | 3300031456 | Bacteria | 3691 |
| 177 | Ga0307509_10013379 | 3300031507 | Bacteria | 9719 |
| 178 | Ga0307509_10020287 | 3300031507 | Bacteria | 7544 |
| 179 | Ga0307509_10033994 | 3300031507 | Bacteria | 5605 |
| 180 | Ga0307408_100000114 | 3300031548 | Bacteria | 89451 |
| 181 | Ga0307508_10016710 | 3300031616 | Bacteria | 6676 |
| 182 | Ga0307514_10006271 | 3300031649 | Bacteria | 10408 |
| 183 | Ga0307514_10079711 | 3300031649 | Bacteria | 2426 |
| 184 | Ga0307514_10114363 | 3300031649 | Bacteria | 1902 |
| 185 | Ga0307514_10154087 | 3300031649 | Bacteria | 1536 |
| 186 | Ga0307516_10003058 | 3300031730 | Bacteria | 21831 |
| 187 | Ga0307516_10018858 | 3300031730 | Bacteria | 7161 |
| 188 | Ga0307518_10114000 | 3300031838 | Bacteria | 1922 |
| 189 | Ga0307410_10322209 | 3300031852 | Bacteria | 1227 |
| 190 | Ga0307410_10364955 | 3300031852 | Bacteria | 1158 |
| 191 | Ga0307406_10173533 | 3300031901 | Bacteria | 1563 |
| 192 | Ga0307414_10004465 | 3300032004 | Bacteria | 7598 |
| 193 | Ga0307414_10209347 | 3300032004 | Bacteria | 1592 |
| 194 | Ga0307411_10000823 | 3300032005 | Bacteria | 11600 |
| 195 | Ga0307507_10117085 | 3300033179 | Bacteria | 2149 |
| 196 | Ga0307510_10004320 | 3300033180 | Bacteria | 16724 |
| 197 | Ga0307510_10007211 | 3300033180 | Bacteria | 13244 |
| 198 | Ga0307510_10015697 | 3300033180 | Bacteria | 8958 |
| 199 | Ga0373948_0010565 | 3300034817 | Bacteria | 1615 |
| 200 | Ga0373940_0008308 | 3300035088 | Bacteria | 2376 |
| 201 | Ga0373939_0000029 | 3300035114 | Bacteria | 52306 |
| 202 | Ga0373960_0002621 | 3300035121 | Bacteria | 4068 |
| 203 | Ga0373931_0008333 | 3300035691 | Bacteria | 4910 |
| 204 | Ga0395900_0066377 | 3300037418 | Bacteria | 3707 |
| 205 | Ga0395900_0079576 | 3300037418 | Bacteria | 3368 |
| 206 | Ga0395900_0097583 | 3300037418 | Bacteria | 3019 |
| 207 | Ga0395900_0388450 | 3300037418 | Bacteria | 1362 |
| 208 | Ga0395898_0028535 | 3300037466 | Bacteria | 5591 |
| 209 | Ga0395905_0001795 | 3300037471 | Bacteria | 24890 |
| 210 | Ga0395905_0087003 | 3300037471 | Bacteria | 2930 |
| 211 | Ga0395901_0225283 | 3300038443 | Bacteria | 1959 |
| 212 | Ga0395901_0305528 | 3300038443 | Bacteria | 1649 |
| 213 | Ga0436361_0007228 | 3300039447 | Bacteria | 1845 |
| 214 | Ga0436361_0028828 | 3300039447 | Bacteria | 968 |
| 215 | Ga0436361_0505573 | 3300039447 | Bacteria | 1738 |
| 216 | Ga0436361_0662050 | 3300039447 | Unclassified | 3482 |
| 217 | Ga0436361_0802016 | 3300039447 | Bacteria | 24229 |
| 218 | Ga0436361_0921973 | 3300039447 | Bacteria | 1083 |
| 219 | Ga0436361_0922237 | 3300039447 | Bacteria | 22454 |
| 220 | Ga0439436_0003137 | 3300041404 | Bacteria | 5010 |
| 221 | Ga0439439_0001872 | 3300041406 | Bacteria | 4342 |
| 222 | Ga0439439_0004865 | 3300041406 | Bacteria | 3044 |
| 223 | Ga0451837_1229693 | 3300041494 | Bacteria | 1228 |
| 224 | Ga0451843_1180629 | 3300041509 | Bacteria | 910 |
| 225 | Ga0451853_0516285 | 3300041512 | Bacteria | 1075 |
| 226 | Ga0451853_0887708 | 3300041512 | Bacteria | 1145 |
| 227 | Ga0439433_0001405 | 3300041999 | Bacteria | 4954 |
| 228 | Ga0439449_0014625 | 3300042007 | Bacteria | 2949 |
| 229 | Ga0439449_0037525 | 3300042007 | Bacteria | 1802 |
| 230 | Ga0439455_0000348 | 3300042012 | Bacteria | 5982 |
| 231 | Ga0439457_001796 | 3300042014 | Bacteria | 6338 |
| 232 | Ga0439457_018010 | 3300042014 | Bacteria | 1567 |
| 233 | Ga0450917_000376 | 3300042120 | Bacteria | 3350 |
| 234 | Ga0450888_000028 | 3300042126 | Bacteria | 10038 |
| 235 | Ga0450890_003595 | 3300042127 | Bacteria | 2056 |
| 236 | Ga0450891_000149 | 3300042129 | Bacteria | 6505 |
| 237 | Ga0450892_000225 | 3300042130 | Bacteria | 6792 |
| 238 | Ga0450894_000045 | 3300042131 | Bacteria | 18255 |
| 239 | Ga0450896_009320 | 3300042133 | Bacteria | 1366 |
| 240 | Ga0450899_000042 | 3300042135 | Bacteria | 9738 |
| 241 | Ga0450900_012816 | 3300042136 | Bacteria | 1103 |
| 242 | Ga0450903_000542 | 3300042138 | Bacteria | 7873 |
| 243 | Ga0450903_010568 | 3300042138 | Bacteria | 1492 |
| 244 | Ga0450906_003844 | 3300042145 | Bacteria | 3194 |
| 245 | Ga0439458_0001470 | 3300042157 | Bacteria | 5937 |
| 246 | Ga0439459_0054317 | 3300042438 | Bacteria | 889 |
| 247 | Ga0450893_0001575 | 3300042532 | Bacteria | 3500 |
| 248 | Ga0451577_0149432 | 3300042876 | Bacteria | 2101 |
| 249 | Ga0451577_0288609 | 3300042876 | Bacteria | 1487 |
| 250 | Ga0451577_0679423 | 3300042876 | Bacteria | 933 |
| 251 | Ga0466969_0026071 | 3300044656 | Bacteria | 3000 |
| 252 | Ga0466969_0074981 | 3300044656 | Bacteria | 1622 |
| 253 | Ga0466972_0080702 | 3300044658 | Bacteria | 1549 |
| 254 | Ga0466977_0008418 | 3300044666 | Bacteria | 5721 |
| 255 | Ga0453683_0064929 | 3300044673 | Bacteria | 2282 |
| 256 | Ga0466965_0137220 | 3300044683 | Bacteria | 1271 |
| 257 | Ga0466966_0039685 | 3300044684 | Bacteria | 3032 |
| 258 | Ga0466966_0173147 | 3300044684 | Bacteria | 1311 |
| 259 | Ga0466961_0000765 | 3300044693 | Bacteria | 20117 |
| 260 | Ga0466961_0014177 | 3300044693 | Bacteria | 5115 |
| 261 | Ga0466961_0145682 | 3300044693 | Bacteria | 1481 |
| 262 | Ga0466961_0206610 | 3300044693 | Bacteria | 1213 |
| 263 | Ga0466961_0320073 | 3300044693 | Bacteria | 946 |
| 264 | Ga0466963_0068156 | 3300044694 | Bacteria | 2389 |
| 265 | Ga0466963_0363597 | 3300044694 | Bacteria | 1019 |
| 266 | Ga0466964_0100956 | 3300044706 | Bacteria | 1272 |
| 267 | Ga0453684_0000657 | 3300044712 | Bacteria | 124222 |
| 268 | Ga0453684_0000826 | 3300044712 | Bacteria | 104663 |
| 269 | Ga0453684_0027032 | 3300044712 | Bacteria | 8252 |
| 270 | Ga0453684_0916520 | 3300044712 | Bacteria | 937 |
| 271 | Ga0466971_0019939 | 3300044719 | Bacteria | 2980 |
| 272 | Ga0466971_0226851 | 3300044719 | Bacteria | 886 |
| 273 | Ga0466970_0006415 | 3300044765 | Bacteria | 5883 |
| 274 | Ga0466970_0008543 | 3300044765 | Bacteria | 5157 |
| 275 | Ga0466970_0034858 | 3300044765 | Bacteria | 2665 |
| 276 | Ga0466970_0165540 | 3300044765 | Bacteria | 1224 |
| 277 | Ga0466957_0382457 | 3300044842 | Bacteria | 960 |
| 278 | Ga0466959_0004532 | 3300045049 | Bacteria | 9319 |
| 279 | Ga0466959_0122595 | 3300045049 | Bacteria | 1846 |
| 280 | Ga0451576_0003274 | 3300045051 | Bacteria | 22482 |
| 281 | Ga0451576_0015862 | 3300045051 | Bacteria | 8334 |
| 282 | Ga0451576_0280189 | 3300045051 | Bacteria | 1743 |
| 283 | Ga0451576_0560495 | 3300045051 | Bacteria | 1200 |
| 284 | Ga0466958_0067631 | 3300045836 | Bacteria | 2183 |
| 285 | Ga0466958_0491299 | 3300045836 | Bacteria | 796 |
| 286 | Ga0466967_0016519 | 3300045976 | Bacteria | 5825 |
| 287 | Ga0466967_0057144 | 3300045976 | Bacteria | 3443 |
| 288 | Ga0466967_0903863 | 3300045976 | Bacteria | 878 |
| 289 | Ga0495592_0037407 | 3300046454 | Bacteria | 3654 |
| 290 | Ga0495592_0185898 | 3300046454 | Bacteria | 1411 |
| 291 | Ga0495603_0007330 | 3300046455 | Bacteria | 6632 |
| 292 | Ga0495603_0007840 | 3300046455 | Bacteria | 6438 |
| 293 | Ga0495603_0033176 | 3300046455 | Bacteria | 3106 |
| 294 | Ga0495603_0069558 | 3300046455 | Bacteria | 2070 |
| 295 | Ga0495590_0123847 | 3300046457 | Bacteria | 927 |
| 296 | Ga0495629_0007540 | 3300046459 | Bacteria | 8020 |
| 297 | Ga0495629_0008794 | 3300046459 | Bacteria | 7425 |
| 298 | Ga0495629_0030418 | 3300046459 | Bacteria | 3827 |
| 299 | Ga0495629_0134359 | 3300046459 | Bacteria | 1722 |
| 300 | Ga0495629_0270034 | 3300046459 | Bacteria | 1168 |
| 301 | Ga0495638_0051398 | 3300046460 | Bacteria | 2570 |
| 302 | Ga0495651_0033152 | 3300046462 | Bacteria | 4028 |
| 303 | Ga0495651_0177013 | 3300046462 | Bacteria | 1513 |
| 304 | Ga0495653_0070603 | 3300046463 | Bacteria | 2613 |
| 305 | Ga0495650_0000056 | 3300046471 | Bacteria | 307565 |
| 306 | Ga0495650_0002634 | 3300046471 | Bacteria | 14043 |
| 307 | Ga0495580_0055666 | 3300046472 | Bacteria | 2786 |
| 308 | Ga0495605_0033687 | 3300046474 | Bacteria | 2598 |
| 309 | Ga0495605_0095038 | 3300046474 | Bacteria | 1376 |
| 310 | Ga0495662_0001795 | 3300046476 | Bacteria | 10744 |
| 311 | Ga0495662_0004825 | 3300046476 | Bacteria | 6758 |
| 312 | Ga0495662_0009839 | 3300046476 | Bacteria | 4697 |
| 313 | Ga0495662_0010977 | 3300046476 | Bacteria | 4430 |
| 314 | Ga0495662_0028001 | 3300046476 | Bacteria | 2721 |
| 315 | Ga0495584_0122503 | 3300046491 | Bacteria | 1317 |
| 316 | Ga0495585_0164829 | 3300046492 | Bacteria | 1148 |
| 317 | Ga0495594_0009975 | 3300046499 | Bacteria | 4918 |
| 318 | Ga0495594_0011844 | 3300046499 | Bacteria | 4537 |
| 319 | Ga0495594_0030329 | 3300046499 | Bacteria | 2925 |
| 320 | Ga0495596_0023925 | 3300046500 | Bacteria | 2476 |
| 321 | Ga0495607_0089016 | 3300046501 | Bacteria | 1676 |
| 322 | Ga0495606_0001978 | 3300046507 | Bacteria | 25275 |
| 323 | Ga0495608_0075832 | 3300046511 | Bacteria | 2191 |
| 324 | Ga0495610_0039594 | 3300046512 | Bacteria | 2382 |
| 325 | Ga0495616_0042417 | 3300046513 | Bacteria | 2316 |
| 326 | Ga0495618_0212259 | 3300046514 | Bacteria | 1223 |
| 327 | Ga0495628_0065534 | 3300046516 | Bacteria | 2840 |
| 328 | Ga0495630_0118545 | 3300046517 | Bacteria | 2007 |
| 329 | Ga0495630_0240170 | 3300046517 | Bacteria | 1384 |
| 330 | Ga0495643_0078160 | 3300046522 | Bacteria | 1728 |
| 331 | Ga0495648_0231871 | 3300046524 | Bacteria | 903 |
| 332 | Ga0495666_0001499 | 3300046526 | Bacteria | 11413 |
| 333 | Ga0495652_0058218 | 3300046529 | Bacteria | 3273 |
| 334 | Ga0495665_0012858 | 3300046531 | Bacteria | 4530 |
| 335 | Ga0495586_0217432 | 3300046535 | Bacteria | 1085 |
| 336 | Ga0495587_0001425 | 3300046536 | Bacteria | 15904 |
| 337 | Ga0495609_0038915 | 3300046538 | Bacteria | 2142 |
| 338 | Ga0495645_0009259 | 3300046543 | Bacteria | 6886 |
| 339 | Ga0495645_0044479 | 3300046543 | Bacteria | 3238 |
| 340 | Ga0495645_0147370 | 3300046543 | Bacteria | 1638 |
| 341 | Ga0495633_0001151 | 3300046558 | Bacteria | 21225 |
| 342 | Ga0495667_0023067 | 3300046559 | Bacteria | 4192 |
| 343 | Ga0495656_0142997 | 3300046615 | Bacteria | 1149 |
| 344 | Ga0495668_0000103 | 3300046616 | Bacteria | 135853 |
| 345 | Ga0495634_0002605 | 3300046642 | Bacteria | 14837 |
| 346 | Ga0495634_0137943 | 3300046642 | Bacteria | 1550 |
| 347 | Ga0495625_0000643 | 3300046660 | Bacteria | 50299 |
| 348 | Ga0495625_0013459 | 3300046660 | Bacteria | 6574 |
| 349 | Ga0495625_0383906 | 3300046660 | Bacteria | 881 |
| 350 | Ga0495635_0005300 | 3300046663 | Bacteria | 8973 |
| 351 | Ga0495661_0051196 | 3300046665 | Bacteria | 2495 |
| 352 | Ga0495661_0094528 | 3300046665 | Bacteria | 1694 |
| 353 | Ga0495588_0027301 | 3300046674 | Bacteria | 2853 |
| 354 | Ga0495588_0030163 | 3300046674 | Bacteria | 2724 |
| 355 | Ga0495588_0205182 | 3300046674 | Bacteria | 1041 |
| 356 | Ga0495657_0004044 | 3300046675 | Bacteria | 11759 |
| 357 | Ga0495657_0061541 | 3300046675 | Bacteria | 2482 |
| 358 | Ga0495623_0099321 | 3300046679 | Bacteria | 1775 |
| 359 | Ga0495623_0195779 | 3300046679 | Bacteria | 1165 |
| 360 | Ga0495646_0011392 | 3300046680 | Bacteria | 5646 |
| 361 | Ga0495646_0014474 | 3300046680 | Bacteria | 5016 |
| 362 | Ga0495658_0020216 | 3300046683 | Bacteria | 3491 |
| 363 | Ga0495669_0265186 | 3300046684 | Bacteria | 825 |
| 364 | Ga0495613_0024695 | 3300046689 | Bacteria | 4477 |
| 365 | Ga0495613_0085682 | 3300046689 | Bacteria | 2285 |
| 366 | Ga0495670_0017680 | 3300046691 | Bacteria | 3511 |
| 367 | Ga0495671_0040339 | 3300046692 | Bacteria | 2354 |
| 368 | Ga0495671_0130589 | 3300046692 | Bacteria | 1225 |
| 369 | Ga0495671_0351320 | 3300046692 | Bacteria | 707 |
| 370 | Ga0495649_0079256 | 3300046694 | Bacteria | 1757 |
| 371 | Ga0495589_0011121 | 3300046794 | Bacteria | 4670 |
| 372 | Ga0495589_0120458 | 3300046794 | Bacteria | 1263 |
| 373 | Ga0495589_0168587 | 3300046794 | Bacteria | 1041 |
| 374 | Ga0495600_0021500 | 3300046809 | Bacteria | 4132 |
| 375 | Ga0495600_0307741 | 3300046809 | Bacteria | 998 |
| 376 | Ga0495581_0005898 | 3300047315 | Bacteria | 7105 |
| 377 | Ga0495581_0036491 | 3300047315 | Bacteria | 2844 |
| 378 | Ga0495604_0000264 | 3300047317 | Bacteria | 46714 |
| 379 | Ga0495604_0000590 | 3300047317 | Bacteria | 31463 |
| 380 | Ga0495604_0020111 | 3300047317 | Bacteria | 5335 |
| 381 | Ga0495636_0004733 | 3300047318 | Bacteria | 5340 |
| 382 | Ga0495636_0011296 | 3300047318 | Bacteria | 3533 |
| 383 | Ga0495636_0021870 | 3300047318 | Bacteria | 2583 |
| 384 | Ga0495674_0602085 | 3300047319 | Bacteria | 870 |
| 385 | Ga0495676_0013764 | 3300047321 | Bacteria | 7254 |
| 386 | Ga0495676_0036088 | 3300047321 | Bacteria | 4131 |
| 387 | Ga0495683_0032650 | 3300047323 | Bacteria | 2651 |
| 388 | Ga0495683_0034182 | 3300047323 | Bacteria | 2586 |
| 389 | Ga0495683_0101669 | 3300047323 | Bacteria | 1381 |
| 390 | Ga0495687_002653 | 3300047443 | Bacteria | 13957 |
| 391 | Ga0495687_036832 | 3300047443 | Bacteria | 2184 |
| 392 | Ga0495687_173310 | 3300047443 | Bacteria | 712 |
| 393 | Ga0495675_0009963 | 3300047444 | Bacteria | 5926 |
| 394 | Ga0495675_0278198 | 3300047444 | Bacteria | 998 |
| 395 | Ga0495685_002027 | 3300047447 | Bacteria | 6294 |
| 396 | Ga0495685_003406 | 3300047447 | Bacteria | 5076 |
| 397 | Ga0495685_005251 | 3300047447 | Bacteria | 4218 |
| 398 | Ga0495685_010802 | 3300047447 | Bacteria | 3068 |
| 399 | Ga0495685_101466 | 3300047447 | Bacteria | 950 |
| 400 | Ga0495681_0000442 | 3300047470 | Bacteria | 31718 |
| 401 | Ga0495681_0025275 | 3300047470 | Bacteria | 3109 |
| 402 | Ga0495684_0058636 | 3300047471 | Bacteria | 2932 |
| 403 | Ga0495684_0071566 | 3300047471 | Bacteria | 2634 |
| 404 | Ga0495686_0057500 | 3300047472 | Bacteria | 2427 |
| 405 | Ga0495686_0073026 | 3300047472 | Bacteria | 2108 |
| 406 | Ga0495593_0035696 | 3300047673 | Bacteria | 2697 |
| 407 | Ga0495602_0086611 | 3300048088 | Bacteria | 2614 |
| 408 | Ga0495602_0089577 | 3300048088 | Bacteria | 2558 |
| 409 | Ga0495614_0003037 | 3300048089 | Bacteria | 7478 |
| 410 | Ga0495614_0020431 | 3300048089 | Bacteria | 2863 |
| 411 | Ga0495614_0080362 | 3300048089 | Bacteria | 1412 |
| 412 | Ga0495626_0000197 | 3300048091 | Bacteria | 73484 |
| 413 | Ga0496102_0167677 | 3300048905 | Bacteria | 2067 |
| 414 | Ga0496104_0393896 | 3300048907 | Bacteria | 1297 |
| 415 | Ga0496104_0581793 | 3300048907 | Bacteria | 1030 |
| 416 | Ga0496109_0025467 | 3300048912 | Bacteria | 5273 |
| 417 | Ga0496111_0371751 | 3300048914 | Bacteria | 1058 |
| 418 | Ga0496116_0002105 | 3300048919 | Bacteria | 21249 |
| 419 | Ga0496116_0075488 | 3300048919 | Bacteria | 2115 |
| 420 | Ga0496116_0080291 | 3300048919 | Bacteria | 2026 |
| 421 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 422 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 423 | Ga0496119_0003104 | 3300048922 | Bacteria | 17531 |
| 424 | Ga0496120_0000028 | 3300048923 | Bacteria | 230249 |
| 425 | Ga0496121_0006753 | 3300048924 | Bacteria | 14081 |
| 426 | Ga0496121_0013269 | 3300048924 | Bacteria | 8872 |
| 427 | Ga0496121_0193629 | 3300048924 | Bacteria | 1455 |
| 428 | Ga0496122_0001676 | 3300048925 | Bacteria | 34352 |
| 429 | Ga0496122_0085638 | 3300048925 | Bacteria | 2173 |
| 430 | Ga0496123_0002807 | 3300048926 | Bacteria | 20674 |
| 431 | Ga0496123_0067793 | 3300048926 | Bacteria | 2251 |
| 432 | Ga0496124_0001246 | 3300048927 | Bacteria | 39090 |
| 433 | Ga0496124_0058684 | 3300048927 | Bacteria | 3235 |
| 434 | Ga0496125_0214382 | 3300048928 | Bacteria | 1247 |
| 435 | Ga0496125_0305834 | 3300048928 | Bacteria | 971 |
| 436 | Ga0496126_0045207 | 3300048929 | Bacteria | 4049 |
| 437 | Ga0501309_007469 | 3300049129 | Bacteria | 1356 |
| 438 | Ga0501310_003134 | 3300049130 | Bacteria | 1607 |
| 439 | Ga0495678_005338 | 3300049459 | Bacteria | 7126 |
| 440 | Ga0495678_018990 | 3300049459 | Bacteria | 3077 |
| 441 | Ga0495682_0003131 | 3300049460 | Bacteria | 7477 |
| 442 | Ga0501294_002385 | 3300049517 | Bacteria | 1788 |
| 443 | Ga0501300_003939 | 3300049523 | Bacteria | 2209 |
| 444 | Ga0501031_0007119 | 3300049568 | Bacteria | 7300 |
| 445 | Ga0501032_0012805 | 3300049569 | Bacteria | 5981 |
| 446 | Ga0501032_0208143 | 3300049569 | Bacteria | 1276 |
| 447 | Ga0501033_0002135 | 3300049570 | Bacteria | 17104 |
| 448 | Ga0501033_0141413 | 3300049570 | Bacteria | 1739 |
| 449 | Ga0501033_0208126 | 3300049570 | Bacteria | 1395 |
| 450 | Ga0501033_0403142 | 3300049570 | Bacteria | 954 |
| 451 | Ga0501034_0001049 | 3300049571 | Bacteria | 39330 |
| 452 | Ga0501034_0147089 | 3300049571 | Bacteria | 2333 |
| 453 | Ga0501034_0147508 | 3300049571 | Bacteria | 2329 |
| 454 | Ga0501034_0983704 | 3300049571 | Bacteria | 728 |
| 455 | Ga0501036_0000576 | 3300049572 | Bacteria | 26456 |
| 456 | Ga0501036_0021103 | 3300049572 | Bacteria | 5471 |
| 457 | Ga0501036_0393124 | 3300049572 | Bacteria | 1157 |
| 458 | Ga0501037_0009522 | 3300049573 | Bacteria | 7129 |
| 459 | Ga0501037_0139961 | 3300049573 | Bacteria | 1732 |
| 460 | Ga0501037_0268865 | 3300049573 | Bacteria | 1190 |
| 461 | Ga0501038_0006067 | 3300049574 | Bacteria | 11179 |
| 462 | Ga0501038_0195117 | 3300049574 | Bacteria | 1628 |
| 463 | Ga0501039_0093817 | 3300049575 | Bacteria | 2339 |
| 464 | Ga0501040_0829734 | 3300049576 | Bacteria | 669 |
| 465 | Ga0501043_0003457 | 3300049579 | Bacteria | 12972 |
| 466 | Ga0501043_0570764 | 3300049579 | Bacteria | 838 |
| 467 | Ga0501046_0015957 | 3300049580 | Bacteria | 6300 |
| 468 | Ga0501047_0011643 | 3300049581 | Bacteria | 8318 |
| 469 | Ga0501071_0236477 | 3300049587 | Bacteria | 1377 |
| 470 | Ga0501075_0633400 | 3300049591 | Bacteria | 815 |
| 471 | Ga0501202_051415 | 3300049652 | Bacteria | 914 |
| 472 | Ga0501217_083728 | 3300049661 | Bacteria | 886 |
| 473 | Ga0501235_009196 | 3300049669 | Bacteria | 2159 |
| 474 | Ga0501258_011087 | 3300049687 | Bacteria | 962 |
| 475 | Ga0501221_000105 | 3300049704 | Bacteria | 10203 |
| 476 | Ga0501262_007915 | 3300049759 | Bacteria | 1294 |
| 477 | Ga0501265_040925 | 3300049762 | Bacteria | 700 |
| 478 | Ga0501267_003397 | 3300049764 | Bacteria | 1449 |
| 479 | Ga0501272_000243 | 3300049769 | Bacteria | 4546 |
| 480 | Ga0501283_026424 | 3300049779 | Bacteria | 955 |
| 481 | Ga0501035_0007650 | 3300049822 | Bacteria | 10093 |
| 482 | Ga0501035_0050113 | 3300049822 | Bacteria | 3743 |
| 483 | Ga0501035_0415271 | 3300049822 | Bacteria | 1118 |
| 484 | Ga0501044_0002016 | 3300049823 | Bacteria | 23415 |
| 485 | Ga0501044_0008136 | 3300049823 | Bacteria | 11508 |
| 486 | Ga0501045_0097017 | 3300049824 | Bacteria | 2181 |
| 487 | nmdc:mga00v17_294249_c1 | 3300050491 | Bacteria | 1054 |
| 488 | nmdc:mga0k408_1230_c1 | 3300050493 | Bacteria | 14028 |
| 489 | nmdc:mga0k408_4433_c1 | 3300050493 | Bacteria | 7449 |
| 490 | nmdc:mga07m45_82083_c1 | 3300050496 | Bacteria | 1841 |
| 491 | nmdc:mga0qj67_126676_c1 | 3300050509 | Bacteria | 2066 |
| 492 | nmdc:mga06r32_131566_c1 | 3300050510 | Bacteria | 2474 |
| 493 | Ga0495619_0098691 | 3300053085 | Bacteria | 1986 |
| 494 | Ga0500640_061984 | 3300053095 | Bacteria | 1619 |
| 495 | Ga0500560_059194 | 3300053107 | Bacteria | 1245 |
| 496 | Ga0500614_010439 | 3300053123 | Bacteria | 1995 |
| 497 | Ga0500559_0190818 | 3300053136 | Bacteria | 966 |
| 498 | Ga0500573_0146753 | 3300053140 | Bacteria | 1295 |
| 499 | Ga0500586_119098 | 3300053145 | Bacteria | 920 |
| 500 | Ga0500600_0086445 | 3300053149 | Bacteria | 1683 |
| 501 | Ga0501082_0428053 | 3300060353 | Bacteria | 1156 |
| 502 | Ga0466962_0025883 | 3300061719 | Bacteria | 2816 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0139961 | Ga0501037_0139961_12_530 | 172 |
| 2 | 3300049576 | Ga0501040_0829734 | Ga0501040_0829734_14_577 | 176 |
| 3 | 3300046455 | Ga0495603_0069558 | Ga0495603_0069558_35_610 | 183 |
| 4 | 3300049572 | Ga0501036_0021103 | Ga0501036_0021103_3025_3684 | 184 |
| 5 | 3300037418 | Ga0395900_0388450 | Ga0395900_0388450_261_896 | 186 |
| 6 | 3300038443 | Ga0395901_0225283 | Ga0395901_0225283_1189_1824 | 186 |
| 7 | 3300044712 | Ga0453684_0916520 | Ga0453684_0916520_31_669 | 187 |
| 8 | 3300045051 | Ga0451576_0280189 | Ga0451576_0280189_258_896 | 187 |
| 9 | 3300047319 | Ga0495674_0602085 | Ga0495674_0602085_250_834 | 187 |
| 10 | 3300009148 | Ga0105243_10288804 | Ga0105243_102888042 | 188 |
| 11 | 3300025938 | Ga0207704_10345353 | Ga0207704_103453532 | 188 |
| 12 | 3300031548 | Ga0307408_100000114 | Ga0307408_10000011453 | 188 |
| 13 | 3300044765 | Ga0466970_0008543 | Ga0466970_0008543_3850_4536 | 189 |
| 14 | 3300003316 | rootH1_10037411 | rootH1_100374111 | 190 |
| 15 | 3300003794 | Ga0055531_10000011 | Ga0055531_1000001195 | 190 |
| 16 | 3300005337 | Ga0070682_100213578 | Ga0070682_1002135782 | 190 |
| 17 | 3300005614 | Ga0068856_100813534 | Ga0068856_1008135342 | 190 |
| 18 | 3300006353 | Ga0075370_10344754 | Ga0075370_103447542 | 190 |
| 19 | 3300025298 | Ga0209050_1009066 | Ga0209050_10090662 | 190 |
| 20 | 3300025303 | Ga0209051_1002325 | Ga0209051_100232513 | 190 |
| 21 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017267 | 190 |
| 22 | 3300026078 | Ga0207702_10715809 | Ga0207702_107158092 | 190 |
| 23 | 3300034817 | Ga0373948_0010565 | Ga0373948_0010565_585_1223 | 190 |
| 24 | 3300035088 | Ga0373940_0008308 | Ga0373940_0008308_1570_2208 | 190 |
| 25 | 3300035114 | Ga0373939_0000029 | Ga0373939_0000029_3754_4392 | 190 |
| 26 | 3300035121 | Ga0373960_0002621 | Ga0373960_0002621_1231_1869 | 190 |
| 27 | 3300035691 | Ga0373931_0008333 | Ga0373931_0008333_1159_1797 | 190 |
| 28 | 3300037471 | Ga0395905_0001795 | Ga0395905_0001795_10947_11585 | 190 |
| 29 | 3300045051 | Ga0451576_0560495 | Ga0451576_0560495_336_974 | 190 |
| 30 | 3300005434 | Ga0070709_10025818 | Ga0070709_100258181 | 191 |
| 31 | 3300006353 | Ga0075370_10077364 | Ga0075370_100773642 | 191 |
| 32 | 3300025906 | Ga0207699_10021514 | Ga0207699_100215144 | 191 |
| 33 | 3300028794 | Ga0307515_10088171 | Ga0307515_100881712 | 191 |
| 34 | 3300032004 | Ga0307414_10004465 | Ga0307414_100044656 | 191 |
| 35 | 3300032005 | Ga0307411_10000823 | Ga0307411_100008232 | 191 |
| 36 | 3300042120 | Ga0450917_000376 | Ga0450917_000376_2276_2917 | 191 |
| 37 | 3300042126 | Ga0450888_000028 | Ga0450888_000028_8080_8721 | 191 |
| 38 | 3300042127 | Ga0450890_003595 | Ga0450890_003595_380_1021 | 191 |
| 39 | 3300042129 | Ga0450891_000149 | Ga0450891_000149_4721_5362 | 191 |
| 40 | 3300042130 | Ga0450892_000225 | Ga0450892_000225_747_1388 | 191 |
| 41 | 3300042138 | Ga0450903_010568 | Ga0450903_010568_406_1047 | 191 |
| 42 | 3300042438 | Ga0439459_0054317 | Ga0439459_0054317_26_670 | 191 |
| 43 | 3300042532 | Ga0450893_0001575 | Ga0450893_0001575_1003_1644 | 191 |
| 44 | 3300046462 | Ga0495651_0177013 | Ga0495651_0177013_276_914 | 191 |
| 45 | 3300049517 | Ga0501294_002385 | Ga0501294_002385_511_1152 | 191 |
| 46 | 3300049523 | Ga0501300_003939 | Ga0501300_003939_761_1402 | 191 |
| 47 | 3300049652 | Ga0501202_051415 | Ga0501202_051415_160_801 | 191 |
| 48 | 3300049661 | Ga0501217_083728 | Ga0501217_083728_79_720 | 191 |
| 49 | 3300049669 | Ga0501235_009196 | Ga0501235_009196_1054_1695 | 191 |
| 50 | 3300049687 | Ga0501258_011087 | Ga0501258_011087_206_847 | 191 |
| 51 | 3300049704 | Ga0501221_000105 | Ga0501221_000105_9268_9909 | 191 |
| 52 | 3300049759 | Ga0501262_007915 | Ga0501262_007915_459_1100 | 191 |
| 53 | 3300049762 | Ga0501265_040925 | Ga0501265_040925_10_651 | 191 |
| 54 | 3300049764 | Ga0501267_003397 | Ga0501267_003397_307_948 | 191 |
| 55 | 3300049779 | Ga0501283_026424 | Ga0501283_026424_281_922 | 191 |
| 56 | 3300050496 | nmdc:mga07m45_82083_c1 | nmdc:mga07m45_82083_c1_110_751 | 191 |
| 57 | 3300006847 | Ga0075431_100077526 | Ga0075431_1000775263 | 192 |
| 58 | 3300041509 | Ga0451843_1180629 | Ga0451843_1180629_176_823 | 192 |
| 59 | 3300041512 | Ga0451853_0887708 | Ga0451853_0887708_236_883 | 192 |
| 60 | 3300049129 | Ga0501309_007469 | Ga0501309_007469_498_1139 | 192 |
| 61 | 3300049130 | Ga0501310_003134 | Ga0501310_003134_457_1098 | 192 |
| 62 | 3300049769 | Ga0501272_000243 | Ga0501272_000243_2750_3391 | 192 |
| 63 | 3300050510 | nmdc:mga06r32_131566_c1 | nmdc:mga06r32_131566_c1_72_695 | 192 |
| 64 | 3300031456 | Ga0307513_10069290 | Ga0307513_100692903 | 193 |
| 65 | 3300049823 | Ga0501044_0008136 | Ga0501044_0008136_2707_3360 | 193 |
| 66 | 3300030522 | Ga0307512_10015539 | Ga0307512_100155396 | 194 |
| 67 | 3300031649 | Ga0307514_10114363 | Ga0307514_101143632 | 194 |
| 68 | 3300041404 | Ga0439436_0003137 | Ga0439436_0003137_498_1151 | 195 |
| 69 | 3300041406 | Ga0439439_0004865 | Ga0439439_0004865_132_785 | 195 |
| 70 | 3300041999 | Ga0439433_0001405 | Ga0439433_0001405_1952_2605 | 195 |
| 71 | 3300042007 | Ga0439449_0014625 | Ga0439449_0014625_39_692 | 195 |
| 72 | 3300042014 | Ga0439457_018010 | Ga0439457_018010_371_1024 | 195 |
| 73 | 3300046507 | Ga0495606_0001978 | Ga0495606_0001978_20088_20744 | 195 |
| 74 | 3300046616 | Ga0495668_0000103 | Ga0495668_0000103_54163_54819 | 195 |
| 75 | 3300046660 | Ga0495625_0000643 | Ga0495625_0000643_2919_3575 | 195 |
| 76 | 3300047323 | Ga0495683_0101669 | Ga0495683_0101669_34_690 | 195 |
| 77 | 3300048091 | Ga0495626_0000197 | Ga0495626_0000197_33205_33861 | 195 |
| 78 | 3300005336 | Ga0070680_100082043 | Ga0070680_1000820434 | 196 |
| 79 | 3300025917 | Ga0207660_10402059 | Ga0207660_104020592 | 196 |
| 80 | 3300031507 | Ga0307509_10033994 | Ga0307509_100339944 | 196 |
| 81 | 3300033179 | Ga0307507_10117085 | Ga0307507_101170852 | 196 |
| 82 | 3300033180 | Ga0307510_10007211 | Ga0307510_1000721112 | 196 |
| 83 | 3300046454 | Ga0495592_0037407 | Ga0495592_0037407_2763_3419 | 196 |
| 84 | 3300046459 | Ga0495629_0030418 | Ga0495629_0030418_381_1037 | 196 |
| 85 | 3300046476 | Ga0495662_0004825 | Ga0495662_0004825_4796_5452 | 196 |
| 86 | 3300046514 | Ga0495618_0212259 | Ga0495618_0212259_482_1138 | 196 |
| 87 | 3300046517 | Ga0495630_0240170 | Ga0495630_0240170_547_1203 | 196 |
| 88 | 3300046529 | Ga0495652_0058218 | Ga0495652_0058218_1222_1878 | 196 |
| 89 | 3300046535 | Ga0495586_0217432 | Ga0495586_0217432_301_957 | 196 |
| 90 | 3300046536 | Ga0495587_0001425 | Ga0495587_0001425_6251_6907 | 196 |
| 91 | 3300046543 | Ga0495645_0147370 | Ga0495645_0147370_196_852 | 196 |
| 92 | 3300046642 | Ga0495634_0002605 | Ga0495634_0002605_7772_8428 | 196 |
| 93 | 3300046663 | Ga0495635_0005300 | Ga0495635_0005300_6649_7305 | 196 |
| 94 | 3300046675 | Ga0495657_0004044 | Ga0495657_0004044_4832_5488 | 196 |
| 95 | 3300046679 | Ga0495623_0195779 | Ga0495623_0195779_379_1035 | 196 |
| 96 | 3300046680 | Ga0495646_0014474 | Ga0495646_0014474_1444_2100 | 196 |
| 97 | 3300046809 | Ga0495600_0021500 | Ga0495600_0021500_3033_3689 | 196 |
| 98 | 3300047315 | Ga0495581_0005898 | Ga0495581_0005898_2273_2929 | 196 |
| 99 | 3300047317 | Ga0495604_0000264 | Ga0495604_0000264_38564_39220 | 196 |
| 100 | 3300047321 | Ga0495676_0013764 | Ga0495676_0013764_5131_5787 | 196 |
| 101 | 3300047471 | Ga0495684_0058636 | Ga0495684_0058636_2101_2757 | 196 |
| 102 | 3300047472 | Ga0495686_0057500 | Ga0495686_0057500_1026_1676 | 196 |
| 103 | 3300047673 | Ga0495593_0035696 | Ga0495593_0035696_44_700 | 196 |
| 104 | 3300048088 | Ga0495602_0089577 | Ga0495602_0089577_433_1089 | 196 |
| 105 | 3300048089 | Ga0495614_0003037 | Ga0495614_0003037_2319_2975 | 196 |
| 106 | 3300053095 | Ga0500640_061984 | Ga0500640_061984_787_1443 | 196 |
| 107 | 3300053123 | Ga0500614_010439 | Ga0500614_010439_1119_1775 | 196 |
| 108 | 3300053136 | Ga0500559_0190818 | Ga0500559_0190818_97_753 | 196 |
| 109 | 3300053140 | Ga0500573_0146753 | Ga0500573_0146753_446_1102 | 196 |
| 110 | 3300053145 | Ga0500586_119098 | Ga0500586_119098_111_767 | 196 |
| 111 | 3300028786 | Ga0307517_10002842 | Ga0307517_1000284210 | 197 |
| 112 | 3300028794 | Ga0307515_10000497 | Ga0307515_1000049773 | 197 |
| 113 | 3300030521 | Ga0307511_10000238 | Ga0307511_1000023826 | 197 |
| 114 | 3300031507 | Ga0307509_10020287 | Ga0307509_100202873 | 197 |
| 115 | 3300031649 | Ga0307514_10079711 | Ga0307514_100797112 | 197 |
| 116 | 3300031649 | Ga0307514_10154087 | Ga0307514_101540872 | 197 |
| 117 | 3300031730 | Ga0307516_10018858 | Ga0307516_100188584 | 197 |
| 118 | 3300031838 | Ga0307518_10114000 | Ga0307518_101140002 | 197 |
| 119 | 3300033180 | Ga0307510_10015697 | Ga0307510_100156974 | 197 |
| 120 | 3300046459 | Ga0495629_0008794 | Ga0495629_0008794_5374_6033 | 197 |
| 121 | 3300046460 | Ga0495638_0051398 | Ga0495638_0051398_1159_1815 | 197 |
| 122 | 3300046499 | Ga0495594_0011844 | Ga0495594_0011844_1099_1755 | 197 |
| 123 | 3300046660 | Ga0495625_0013459 | Ga0495625_0013459_4309_4968 | 197 |
| 124 | 3300046674 | Ga0495588_0030163 | Ga0495588_0030163_689_1348 | 197 |
| 125 | 3300046683 | Ga0495658_0020216 | Ga0495658_0020216_2783_3442 | 197 |
| 126 | 3300046692 | Ga0495671_0130589 | Ga0495671_0130589_368_1024 | 197 |
| 127 | 3300047443 | Ga0495687_002653 | Ga0495687_002653_10054_10710 | 197 |
| 128 | 3300047470 | Ga0495681_0000442 | Ga0495681_0000442_10188_10847 | 197 |
| 129 | 3300047472 | Ga0495686_0073026 | Ga0495686_0073026_763_1422 | 197 |
| 130 | 3300048089 | Ga0495614_0020431 | Ga0495614_0020431_919_1578 | 197 |
| 131 | 3300053107 | Ga0500560_059194 | Ga0500560_059194_286_945 | 197 |
| 132 | 3300028794 | Ga0307515_10054430 | Ga0307515_100544303 | 198 |
| 133 | 3300044684 | Ga0466966_0173147 | Ga0466966_0173147_601_1254 | 198 |
| 134 | 3300044693 | Ga0466961_0206610 | Ga0466961_0206610_455_1108 | 198 |
| 135 | 3300044694 | Ga0466963_0363597 | Ga0466963_0363597_175_828 | 198 |
| 136 | 3300044765 | Ga0466970_0006415 | Ga0466970_0006415_4734_5387 | 198 |
| 137 | 3300044842 | Ga0466957_0382457 | Ga0466957_0382457_104_757 | 198 |
| 138 | 3300045836 | Ga0466958_0491299 | Ga0466958_0491299_89_742 | 198 |
| 139 | 3300045976 | Ga0466967_0016519 | Ga0466967_0016519_340_993 | 198 |
| 140 | 3300053085 | Ga0495619_0098691 | Ga0495619_0098691_815_1432 | 198 |
| 141 | 3300010375 | Ga0105239_10195606 | Ga0105239_101956062 | 199 |
| 142 | 3300013105 | Ga0157369_10007469 | Ga0157369_100074696 | 199 |
| 143 | 3300009093 | Ga0105240_10454623 | Ga0105240_104546232 | 200 |
| 144 | 3300025728 | Ga0207655_1001093 | Ga0207655_100109317 | 200 |
| 145 | 3300025913 | Ga0207695_10483383 | Ga0207695_104833832 | 200 |
| 146 | 3300031344 | Ga0265316_10290426 | Ga0265316_102904261 | 200 |
| 147 | 3300042136 | Ga0450900_012816 | Ga0450900_012816_269_919 | 200 |
| 148 | 3300044673 | Ga0453683_0064929 | Ga0453683_0064929_866_1513 | 201 |
| 149 | 3300048929 | Ga0496126_0045207 | Ga0496126_0045207_1684_2349 | 201 |
| 150 | 3300013105 | Ga0157369_10596192 | Ga0157369_105961922 | 202 |
| 151 | iso_pu_bacteria | 2935390628 | 2935391863 | 202 |
| 152 | 3300042876 | Ga0451577_0149432 | Ga0451577_0149432_543_1190 | 203 |
| 153 | 3300044712 | Ga0453684_0000826 | Ga0453684_0000826_58280_58927 | 203 |
| 154 | 3300045051 | Ga0451576_0015862 | Ga0451576_0015862_6061_6708 | 203 |
| 155 | 3300049459 | Ga0495678_005338 | Ga0495678_005338_342_1019 | 203 |
| 156 | 3300045836 | Ga0466958_0067631 | Ga0466958_0067631_71_859 | 204 |
| 157 | 3300005329 | Ga0070683_100003993 | Ga0070683_1000039938 | 205 |
| 158 | 3300005535 | Ga0070684_100004378 | Ga0070684_1000043782 | 205 |
| 159 | 3300005577 | Ga0068857_100323692 | Ga0068857_1003236922 | 205 |
| 160 | 3300025944 | Ga0207661_10000747 | Ga0207661_1000074716 | 205 |
| 161 | 3300025945 | Ga0207679_10014167 | Ga0207679_100141672 | 205 |
| 162 | 3300026116 | Ga0207674_10283821 | Ga0207674_102838212 | 205 |
| 163 | 3300028794 | Ga0307515_10234736 | Ga0307515_102347362 | 205 |
| 164 | iso_pu_bacteria | 2643221544 | 2643745898 | 205 |
| 165 | iso_pu_bacteria | 2643221585 | 2643935239 | 205 |
| 166 | iso_pu_bacteria | 2643221604 | 2644035148 | 205 |
| 167 | iso_pu_bacteria | 2643221617 | 2644101297 | 205 |
| 168 | iso_pu_bacteria | 2643221620 | 2644119297 | 205 |
| 169 | iso_pu_bacteria | 2643221639 | 2644221903 | 205 |
| 170 | iso_pu_bacteria | 2643221646 | 2644257301 | 205 |
| 171 | iso_pu_bacteria | 2643221656 | 2644314863 | 205 |
| 172 | iso_pu_bacteria | 2738541305 | 2738868926 | 205 |
| 173 | iso_pu_bacteria | 2738541337 | 2739055118 | 205 |
| 174 | iso_pu_bacteria | 2808606359 | 2808848785 | 205 |
| 175 | iso_pu_bacteria | 2808606375 | 2808913109 | 205 |
| 176 | iso_pu_bacteria | 2808606982 | 2811844909 | 205 |
| 177 | iso_pu_bacteria | 2811994874 | 2812330378 | 205 |
| 178 | iso_pu_bacteria | 2861520306 | 2861521800 | 205 |
| 179 | iso_pu_bacteria | 2887478801 | 2887481910 | 205 |
| 180 | iso_pu_bacteria | 2919468124 | 2919469159 | 205 |
| 181 | iso_pu_bacteria | 8001781756 | 8001781803 | 205 |
| 182 | iso_pu_bacteria | 8001781756 | 8001788840 | 205 |
| 183 | iso_pu_bacteria | 8008574985 | 8008577617 | 205 |
| 184 | iso_pu_bacteria | 2547132103 | 2547374326 | 206 |
| 185 | iso_pu_bacteria | 2582581313 | 2585306160 | 206 |
| 186 | iso_pu_bacteria | 2643221587 | 2643941826 | 206 |
| 187 | iso_pu_bacteria | 2643221677 | 2644428909 | 206 |
| 188 | iso_pu_bacteria | 2784746768 | 2785370991 | 206 |
| 189 | iso_pu_bacteria | 2786546132 | 2786672188 | 206 |
| 190 | iso_pu_bacteria | 2843690924 | 2843694812 | 206 |
| 191 | iso_pu_bacteria | 2846033681 | 2846033718 | 206 |
| 192 | iso_pu_bacteria | 2846037992 | 2846040261 | 206 |
| 193 | iso_pu_bacteria | 2852635781 | 2852640180 | 206 |
| 194 | iso_pu_bacteria | 2862281513 | 2862287207 | 206 |
| 195 | iso_pu_bacteria | 2862507626 | 2862512057 | 206 |
| 196 | iso_pu_bacteria | 2862574272 | 2862577981 | 206 |
| 197 | iso_pu_bacteria | 2867428634 | 2867435204 | 206 |
| 198 | iso_pu_bacteria | 2873151551 | 2873154539 | 206 |
| 199 | iso_pu_bacteria | 2877676314 | 2877679586 | 206 |
| 200 | iso_pu_bacteria | 2884693830 | 2884695862 | 206 |
| 201 | iso_pu_bacteria | 2895442618 | 2895445424 | 206 |
| 202 | iso_pu_bacteria | 2939602548 | 2939605330 | 206 |
| 203 | iso_pu_bacteria | 2946064051 | 2946069359 | 206 |
| 204 | iso_pu_bacteria | 2954380949 | 2954384499 | 206 |
| 205 | iso_pu_bacteria | 2954673503 | 2954678465 | 206 |
| 206 | iso_pu_bacteria | 2954682443 | 2954685690 | 206 |
| 207 | iso_pu_bacteria | 2954691527 | 2954695356 | 206 |
| 208 | iso_pu_bacteria | 2954701450 | 2954710547 | 206 |
| 209 | iso_pu_bacteria | 2954711539 | 2954714792 | 206 |
| 210 | iso_pu_bacteria | 2954721474 | 2954724737 | 206 |
| 211 | iso_pu_bacteria | 2954740390 | 2954743661 | 206 |
| 212 | iso_pu_bacteria | 2954759201 | 2954762614 | 206 |
| 213 | iso_pu_bacteria | 2998344455 | 2998345725 | 206 |
| 214 | iso_pu_bacteria | 3006393351 | 3006399110 | 206 |
| 215 | 3300044693 | Ga0466961_0145682 | Ga0466961_0145682_531_1274 | 207 |
| 216 | 3300044694 | Ga0466963_0068156 | Ga0466963_0068156_144_887 | 207 |
| 217 | 3300044719 | Ga0466971_0226851 | Ga0466971_0226851_110_853 | 207 |
| 218 | iso_pu_bacteria | 2643221601 | 2644014864 | 207 |
| 219 | iso_pu_bacteria | 2643221631 | 2644176299 | 207 |
| 220 | iso_pu_bacteria | 2784746763 | 2785341676 | 207 |
| 221 | iso_pu_bacteria | 2862290372 | 2862293396 | 207 |
| 222 | iso_pu_bacteria | 2862382967 | 2862384082 | 207 |
| 223 | iso_pu_bacteria | 2863404153 | 2863411356 | 207 |
| 224 | iso_pu_bacteria | 8008558824 | 8008566756 | 207 |
| 225 | 3300013307 | Ga0157372_11297528 | Ga0157372_112975282 | 208 |
| 226 | 3300015261 | Ga0182006_1000067 | Ga0182006_100006796 | 208 |
| 227 | 3300015262 | Ga0182007_10000123 | Ga0182007_1000012346 | 208 |
| 228 | 3300015265 | Ga0182005_1000002 | Ga0182005_100000237 | 208 |
| 229 | 3300021361 | Ga0213872_10001107 | Ga0213872_100011074 | 208 |
| 230 | 3300031507 | Ga0307509_10013379 | Ga0307509_1001337910 | 208 |
| 231 | 3300031616 | Ga0307508_10016710 | Ga0307508_100167103 | 208 |
| 232 | 3300031901 | Ga0307406_10173533 | Ga0307406_101735332 | 208 |
| 233 | 3300039447 | Ga0436361_0007228 | Ga0436361_0007228_1073_1711 | 208 |
| 234 | 3300039447 | Ga0436361_0802016 | Ga0436361_0802016_19142_19780 | 208 |
| 235 | 3300042131 | Ga0450894_000045 | Ga0450894_000045_526_1170 | 208 |
| 236 | 3300042133 | Ga0450896_009320 | Ga0450896_009320_430_1074 | 208 |
| 237 | 3300042135 | Ga0450899_000042 | Ga0450899_000042_2060_2704 | 208 |
| 238 | 3300042145 | Ga0450906_003844 | Ga0450906_003844_665_1309 | 208 |
| 239 | 3300044719 | Ga0466971_0019939 | Ga0466971_0019939_406_1194 | 208 |
| 240 | 3300045049 | Ga0466959_0004532 | Ga0466959_0004532_2584_3372 | 208 |
| 241 | 3300048914 | Ga0496111_0371751 | Ga0496111_0371751_220_894 | 208 |
| 242 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_899862_900536 | 208 |
| 243 | 3300048921 | Ga0496118_0000002 | Ga0496118_0000002_899862_900536 | 208 |
| 244 | 3300048924 | Ga0496121_0013269 | Ga0496121_0013269_7797_8471 | 208 |
| 245 | 3300048927 | Ga0496124_0058684 | Ga0496124_0058684_2280_2954 | 208 |
| 246 | iso_pu_bacteria | 2643221641 | 2644231776 | 208 |
| 247 | iso_pu_bacteria | 2739367898 | 2740165394 | 208 |
| 248 | iso_pu_bacteria | 2895427314 | 2895438934 | 208 |
| 249 | iso_pu_bacteria | 2995463766 | 2995471378 | 208 |
| 250 | iso_pu_bacteria | 8055172936 | 8055173736 | 208 |
| 251 | iso_pu_bacteria | 8057568493 | 8057572345 | 208 |
| 252 | 3300006178 | Ga0075367_10390260 | Ga0075367_103902601 | 209 |
| 253 | 3300006195 | Ga0075366_10060088 | Ga0075366_100600882 | 209 |
| 254 | 3300009094 | Ga0111539_11030966 | Ga0111539_110309661 | 209 |
| 255 | 3300025935 | Ga0207709_10744361 | Ga0207709_107443611 | 209 |
| 256 | 3300037418 | Ga0395900_0066377 | Ga0395900_0066377_2636_3292 | 209 |
| 257 | 3300038443 | Ga0395901_0305528 | Ga0395901_0305528_634_1290 | 209 |
| 258 | 3300044658 | Ga0466972_0080702 | Ga0466972_0080702_620_1270 | 209 |
| 259 | 3300044683 | Ga0466965_0137220 | Ga0466965_0137220_563_1216 | 209 |
| 260 | 3300044765 | Ga0466970_0034858 | Ga0466970_0034858_1928_2581 | 209 |
| 261 | 3300045976 | Ga0466967_0057144 | Ga0466967_0057144_2654_3307 | 209 |
| 262 | 3300045976 | Ga0466967_0903863 | Ga0466967_0903863_197_850 | 209 |
| 263 | 3300046543 | Ga0495645_0009259 | Ga0495645_0009259_5479_6171 | 209 |
| 264 | 3300046558 | Ga0495633_0001151 | Ga0495633_0001151_1182_1856 | 209 |
| 265 | 3300049570 | Ga0501033_0208126 | Ga0501033_0208126_699_1349 | 209 |
| 266 | 3300049822 | Ga0501035_0050113 | Ga0501035_0050113_3012_3662 | 209 |
| 267 | 3300050493 | nmdc:mga0k408_4433_c1 | nmdc:mga0k408_4433_c1_3319_3966 | 209 |
| 268 | 3300061719 | Ga0466962_0025883 | Ga0466962_0025883_1609_2259 | 209 |
| 269 | iso_pu_bacteria | 2547132512 | 2548849143 | 209 |
| 270 | iso_pu_bacteria | 2643221665 | 2644361719 | 209 |
| 271 | iso_pu_bacteria | 2744054655 | 2745160028 | 209 |
| 272 | iso_pu_bacteria | 2744054655 | 2745161652 | 209 |
| 273 | iso_pu_bacteria | 2875391855 | 2875396200 | 209 |
| 274 | iso_pu_bacteria | 2918501144 | 2918505989 | 209 |
| 275 | iso_pu_bacteria | 2919688452 | 2919692129 | 209 |
| 276 | iso_pu_bacteria | 2928515477 | 2928517107 | 209 |
| 277 | 3300003316 | rootH1_10007098 | rootH1_100070982 | 210 |
| 278 | 3300003323 | rootH1_10054269 | rootH1_100542691 | 210 |
| 279 | 3300003856 | Ga0058692_1000025 | Ga0058692_1000025219 | 210 |
| 280 | 3300003856 | Ga0058692_1001325 | Ga0058692_100132511 | 210 |
| 281 | 3300006048 | Ga0075363_100152709 | Ga0075363_1001527092 | 210 |
| 282 | 3300009011 | Ga0105251_10035794 | Ga0105251_100357942 | 210 |
| 283 | 3300009011 | Ga0105251_10145367 | Ga0105251_101453671 | 210 |
| 284 | 3300009098 | Ga0105245_10100173 | Ga0105245_101001733 | 210 |
| 285 | 3300011119 | Ga0105246_10245508 | Ga0105246_102455081 | 210 |
| 286 | 3300017792 | Ga0163161_10550756 | Ga0163161_105507562 | 210 |
| 287 | 3300021361 | Ga0213872_10006231 | Ga0213872_100062314 | 210 |
| 288 | 3300025297 | Ga0209758_1006507 | Ga0209758_10065072 | 210 |
| 289 | 3300025728 | Ga0207655_1000030 | Ga0207655_100003094 | 210 |
| 290 | 3300027312 | Ga0209371_1000036 | Ga0209371_1000036214 | 210 |
| 291 | 3300027312 | Ga0209371_1002657 | Ga0209371_10026573 | 210 |
| 292 | 3300027312 | Ga0209371_1011550 | Ga0209371_10115502 | 210 |
| 293 | 3300030500 | Ga0268256_1000040 | Ga0268256_1000040105 | 210 |
| 294 | 3300030500 | Ga0268256_1002353 | Ga0268256_10023538 | 210 |
| 295 | 3300031649 | Ga0307514_10006271 | Ga0307514_100062715 | 210 |
| 296 | 3300031730 | Ga0307516_10003058 | Ga0307516_1000305825 | 210 |
| 297 | 3300031852 | Ga0307410_10322209 | Ga0307410_103222092 | 210 |
| 298 | 3300033180 | Ga0307510_10004320 | Ga0307510_100043205 | 210 |
| 299 | 3300037418 | Ga0395900_0079576 | Ga0395900_0079576_2428_3081 | 210 |
| 300 | 3300037466 | Ga0395898_0028535 | Ga0395898_0028535_3466_4119 | 210 |
| 301 | 3300037471 | Ga0395905_0087003 | Ga0395905_0087003_1137_1790 | 210 |
| 302 | 3300039447 | Ga0436361_0921973 | Ga0436361_0921973_351_1001 | 210 |
| 303 | 3300039447 | Ga0436361_0922237 | Ga0436361_0922237_19170_19820 | 210 |
| 304 | 3300042012 | Ga0439455_0000348 | Ga0439455_0000348_1943_2593 | 210 |
| 305 | 3300042138 | Ga0450903_000542 | Ga0450903_000542_6749_7399 | 210 |
| 306 | 3300042157 | Ga0439458_0001470 | Ga0439458_0001470_454_1104 | 210 |
| 307 | 3300044656 | Ga0466969_0074981 | Ga0466969_0074981_400_1185 | 210 |
| 308 | 3300046455 | Ga0495603_0007330 | Ga0495603_0007330_4041_4691 | 210 |
| 309 | 3300046455 | Ga0495603_0007840 | Ga0495603_0007840_5299_5949 | 210 |
| 310 | 3300046455 | Ga0495603_0033176 | Ga0495603_0033176_1593_2249 | 210 |
| 311 | 3300046459 | Ga0495629_0007540 | Ga0495629_0007540_717_1367 | 210 |
| 312 | 3300046459 | Ga0495629_0134359 | Ga0495629_0134359_50_700 | 210 |
| 313 | 3300046459 | Ga0495629_0270034 | Ga0495629_0270034_237_887 | 210 |
| 314 | 3300046474 | Ga0495605_0095038 | Ga0495605_0095038_431_1087 | 210 |
| 315 | 3300046476 | Ga0495662_0009839 | Ga0495662_0009839_1002_1652 | 210 |
| 316 | 3300046476 | Ga0495662_0010977 | Ga0495662_0010977_2817_3467 | 210 |
| 317 | 3300046492 | Ga0495585_0164829 | Ga0495585_0164829_261_917 | 210 |
| 318 | 3300046499 | Ga0495594_0009975 | Ga0495594_0009975_3169_3819 | 210 |
| 319 | 3300046499 | Ga0495594_0030329 | Ga0495594_0030329_1138_1794 | 210 |
| 320 | 3300046660 | Ga0495625_0383906 | Ga0495625_0383906_68_724 | 210 |
| 321 | 3300046665 | Ga0495661_0051196 | Ga0495661_0051196_1639_2295 | 210 |
| 322 | 3300046674 | Ga0495588_0027301 | Ga0495588_0027301_2143_2793 | 210 |
| 323 | 3300046689 | Ga0495613_0085682 | Ga0495613_0085682_1136_1786 | 210 |
| 324 | 3300046691 | Ga0495670_0017680 | Ga0495670_0017680_643_1299 | 210 |
| 325 | 3300046794 | Ga0495589_0011121 | Ga0495589_0011121_1142_1798 | 210 |
| 326 | 3300046794 | Ga0495589_0120458 | Ga0495589_0120458_375_1031 | 210 |
| 327 | 3300047315 | Ga0495581_0036491 | Ga0495581_0036491_332_982 | 210 |
| 328 | 3300047318 | Ga0495636_0004733 | Ga0495636_0004733_4490_5140 | 210 |
| 329 | 3300047318 | Ga0495636_0011296 | Ga0495636_0011296_1101_1751 | 210 |
| 330 | 3300047318 | Ga0495636_0021870 | Ga0495636_0021870_1906_2556 | 210 |
| 331 | 3300047321 | Ga0495676_0036088 | Ga0495676_0036088_2618_3274 | 210 |
| 332 | 3300047323 | Ga0495683_0034182 | Ga0495683_0034182_843_1499 | 210 |
| 333 | 3300047443 | Ga0495687_036832 | Ga0495687_036832_283_933 | 210 |
| 334 | 3300047443 | Ga0495687_173310 | Ga0495687_173310_23_679 | 210 |
| 335 | 3300047447 | Ga0495685_002027 | Ga0495685_002027_2873_3529 | 210 |
| 336 | 3300047447 | Ga0495685_003406 | Ga0495685_003406_2679_3329 | 210 |
| 337 | 3300047447 | Ga0495685_005251 | Ga0495685_005251_3225_3875 | 210 |
| 338 | 3300047447 | Ga0495685_010802 | Ga0495685_010802_14_664 | 210 |
| 339 | 3300047470 | Ga0495681_0025275 | Ga0495681_0025275_1191_1841 | 210 |
| 340 | 3300048089 | Ga0495614_0080362 | Ga0495614_0080362_491_1141 | 210 |
| 341 | 3300048907 | Ga0496104_0581793 | Ga0496104_0581793_365_1015 | 210 |
| 342 | 3300048912 | Ga0496109_0025467 | Ga0496109_0025467_788_1438 | 210 |
| 343 | 3300049570 | Ga0501033_0141413 | Ga0501033_0141413_110_769 | 210 |
| 344 | 3300049571 | Ga0501034_0147089 | Ga0501034_0147089_205_864 | 210 |
| 345 | iso_pu_bacteria | 2616644941 | 2616903068 | 210 |
| 346 | iso_pu_bacteria | 2891554331 | 2891558662 | 210 |
| 347 | iso_pu_bacteria | 8033232454 | 8033234578 | 210 |
| 348 | iso_pu_bacteria | 8048406513 | 8048412228 | 210 |
| 349 | 3300020082 | Ga0206353_10552251 | Ga0206353_105522513 | 211 |
| 350 | 3300026088 | Ga0207641_10098511 | Ga0207641_100985111 | 211 |
| 351 | 3300041406 | Ga0439439_0001872 | Ga0439439_0001872_998_1651 | 211 |
| 352 | 3300042007 | Ga0439449_0037525 | Ga0439449_0037525_1072_1722 | 211 |
| 353 | 3300042014 | Ga0439457_001796 | Ga0439457_001796_268_921 | 211 |
| 354 | 3300042876 | Ga0451577_0679423 | Ga0451577_0679423_46_693 | 211 |
| 355 | 3300044693 | Ga0466961_0014177 | Ga0466961_0014177_1271_1936 | 211 |
| 356 | 3300044765 | Ga0466970_0165540 | Ga0466970_0165540_183_845 | 211 |
| 357 | 3300046476 | Ga0495662_0028001 | Ga0495662_0028001_1725_2384 | 211 |
| 358 | 3300046674 | Ga0495588_0205182 | Ga0495588_0205182_206_868 | 211 |
| 359 | 3300046679 | Ga0495623_0099321 | Ga0495623_0099321_191_850 | 211 |
| 360 | 3300047317 | Ga0495604_0020111 | Ga0495604_0020111_2582_3241 | 211 |
| 361 | 3300047444 | Ga0495675_0009963 | Ga0495675_0009963_1756_2415 | 211 |
| 362 | 3300047447 | Ga0495685_101466 | Ga0495685_101466_43_705 | 211 |
| 363 | 3300049568 | Ga0501031_0007119 | Ga0501031_0007119_313_948 | 211 |
| 364 | 3300049569 | Ga0501032_0012805 | Ga0501032_0012805_347_982 | 211 |
| 365 | 3300049570 | Ga0501033_0002135 | Ga0501033_0002135_9864_10499 | 211 |
| 366 | 3300049571 | Ga0501034_0147508 | Ga0501034_0147508_1500_2135 | 211 |
| 367 | 3300049571 | Ga0501034_0983704 | Ga0501034_0983704_52_687 | 211 |
| 368 | 3300049572 | Ga0501036_0000576 | Ga0501036_0000576_24866_25501 | 211 |
| 369 | 3300049573 | Ga0501037_0009522 | Ga0501037_0009522_3727_4362 | 211 |
| 370 | 3300049574 | Ga0501038_0006067 | Ga0501038_0006067_7165_7800 | 211 |
| 371 | 3300049579 | Ga0501043_0003457 | Ga0501043_0003457_11111_11746 | 211 |
| 372 | 3300049580 | Ga0501046_0015957 | Ga0501046_0015957_5559_6194 | 211 |
| 373 | 3300049581 | Ga0501047_0011643 | Ga0501047_0011643_5256_5891 | 211 |
| 374 | 3300049822 | Ga0501035_0007650 | Ga0501035_0007650_1455_2090 | 211 |
| 375 | 3300049822 | Ga0501035_0415271 | Ga0501035_0415271_416_1051 | 211 |
| 376 | 3300049823 | Ga0501044_0002016 | Ga0501044_0002016_8748_9383 | 211 |
| 377 | 3300053149 | Ga0500600_0086445 | Ga0500600_0086445_959_1609 | 211 |
| 378 | iso_pu_bacteria | 2582581312 | 2585296090 | 211 |
| 379 | 3300003354 | JGI25160J50197_1020461 | JGI25160J50197_10204612 | 212 |
| 380 | 3300005535 | Ga0070684_100256708 | Ga0070684_1002567081 | 212 |
| 381 | 3300006051 | Ga0075364_10043348 | Ga0075364_100433485 | 212 |
| 382 | 3300020078 | Ga0206352_10334922 | Ga0206352_103349221 | 212 |
| 383 | 3300025302 | Ga0207426_1004524 | Ga0207426_10045243 | 212 |
| 384 | 3300025302 | Ga0207426_1008470 | Ga0207426_10084704 | 212 |
| 385 | 3300025302 | Ga0207426_1016632 | Ga0207426_10166321 | 212 |
| 386 | 3300028379 | Ga0268266_11082022 | Ga0268266_110820221 | 212 |
| 387 | 3300031852 | Ga0307410_10364955 | Ga0307410_103649551 | 212 |
| 388 | 3300039447 | Ga0436361_0028828 | Ga0436361_0028828_31_687 | 212 |
| 389 | 3300041494 | Ga0451837_1229693 | Ga0451837_1229693_113_784 | 212 |
| 390 | 3300046454 | Ga0495592_0185898 | Ga0495592_0185898_736_1395 | 212 |
| 391 | 3300046462 | Ga0495651_0033152 | Ga0495651_0033152_29_688 | 212 |
| 392 | 3300046463 | Ga0495653_0070603 | Ga0495653_0070603_864_1523 | 212 |
| 393 | 3300046472 | Ga0495580_0055666 | Ga0495580_0055666_2011_2670 | 212 |
| 394 | 3300046476 | Ga0495662_0001795 | Ga0495662_0001795_5285_5944 | 212 |
| 395 | 3300046511 | Ga0495608_0075832 | Ga0495608_0075832_797_1456 | 212 |
| 396 | 3300046516 | Ga0495628_0065534 | Ga0495628_0065534_235_894 | 212 |
| 397 | 3300046517 | Ga0495630_0118545 | Ga0495630_0118545_1336_1995 | 212 |
| 398 | 3300046526 | Ga0495666_0001499 | Ga0495666_0001499_9675_10334 | 212 |
| 399 | 3300046531 | Ga0495665_0012858 | Ga0495665_0012858_1650_2309 | 212 |
| 400 | 3300046543 | Ga0495645_0044479 | Ga0495645_0044479_17_676 | 212 |
| 401 | 3300046559 | Ga0495667_0023067 | Ga0495667_0023067_3341_4000 | 212 |
| 402 | 3300046642 | Ga0495634_0137943 | Ga0495634_0137943_29_688 | 212 |
| 403 | 3300046675 | Ga0495657_0061541 | Ga0495657_0061541_1268_1927 | 212 |
| 404 | 3300046680 | Ga0495646_0011392 | Ga0495646_0011392_235_894 | 212 |
| 405 | 3300046689 | Ga0495613_0024695 | Ga0495613_0024695_1754_2413 | 212 |
| 406 | 3300046809 | Ga0495600_0307741 | Ga0495600_0307741_311_970 | 212 |
| 407 | 3300047317 | Ga0495604_0000590 | Ga0495604_0000590_8282_8941 | 212 |
| 408 | 3300047444 | Ga0495675_0278198 | Ga0495675_0278198_311_970 | 212 |
| 409 | 3300047471 | Ga0495684_0071566 | Ga0495684_0071566_1947_2606 | 212 |
| 410 | 3300048088 | Ga0495602_0086611 | Ga0495602_0086611_788_1447 | 212 |
| 411 | 3300049569 | Ga0501032_0208143 | Ga0501032_0208143_340_1011 | 212 |
| 412 | 3300049570 | Ga0501033_0403142 | Ga0501033_0403142_234_905 | 212 |
| 413 | 3300049572 | Ga0501036_0393124 | Ga0501036_0393124_446_1117 | 212 |
| 414 | 3300049573 | Ga0501037_0268865 | Ga0501037_0268865_24_695 | 212 |
| 415 | 3300049574 | Ga0501038_0195117 | Ga0501038_0195117_466_1137 | 212 |
| 416 | 3300049575 | Ga0501039_0093817 | Ga0501039_0093817_866_1537 | 212 |
| 417 | 3300049587 | Ga0501071_0236477 | Ga0501071_0236477_549_1220 | 212 |
| 418 | 3300049591 | Ga0501075_0633400 | Ga0501075_0633400_109_780 | 212 |
| 419 | 3300049824 | Ga0501045_0097017 | Ga0501045_0097017_158_829 | 212 |
| 420 | 3300050491 | nmdc:mga00v17_294249_c1 | nmdc:mga00v17_294249_c1_156_827 | 212 |
| 421 | 3300060353 | Ga0501082_0428053 | Ga0501082_0428053_40_711 | 212 |
| 422 | iso_pu_bacteria | 2891633521 | 2891634418 | 212 |
| 423 | 3300006195 | Ga0075366_10002780 | Ga0075366_1000278013 | 213 |
| 424 | 3300009011 | Ga0105251_10018652 | Ga0105251_100186523 | 213 |
| 425 | 3300009036 | Ga0105244_10000076 | Ga0105244_1000007698 | 213 |
| 426 | 3300009147 | Ga0114129_10377697 | Ga0114129_103776972 | 213 |
| 427 | 3300009553 | Ga0105249_10004632 | Ga0105249_100046329 | 213 |
| 428 | 3300013102 | Ga0157371_10006566 | Ga0157371_100065669 | 213 |
| 429 | 3300013307 | Ga0157372_10017379 | Ga0157372_100173794 | 213 |
| 430 | 3300013307 | Ga0157372_10034019 | Ga0157372_100340193 | 213 |
| 431 | 3300021361 | Ga0213872_10088999 | Ga0213872_100889992 | 213 |
| 432 | 3300025728 | Ga0207655_1001907 | Ga0207655_100190713 | 213 |
| 433 | 3300025735 | Ga0207713_1032021 | Ga0207713_10320211 | 213 |
| 434 | 3300025961 | Ga0207712_10004502 | Ga0207712_100045024 | 213 |
| 435 | 3300031238 | Ga0265332_10000013 | Ga0265332_10000013228 | 213 |
| 436 | 3300031241 | Ga0265325_10057382 | Ga0265325_100573823 | 213 |
| 437 | 3300039447 | Ga0436361_0505573 | Ga0436361_0505573_486_1145 | 213 |
| 438 | 3300041512 | Ga0451853_0516285 | Ga0451853_0516285_168_815 | 213 |
| 439 | 3300042876 | Ga0451577_0288609 | Ga0451577_0288609_450_1097 | 213 |
| 440 | 3300044656 | Ga0466969_0026071 | Ga0466969_0026071_1519_2178 | 213 |
| 441 | 3300044684 | Ga0466966_0039685 | Ga0466966_0039685_2054_2713 | 213 |
| 442 | 3300044693 | Ga0466961_0000765 | Ga0466961_0000765_56_715 | 213 |
| 443 | 3300044706 | Ga0466964_0100956 | Ga0466964_0100956_580_1239 | 213 |
| 444 | 3300045049 | Ga0466959_0122595 | Ga0466959_0122595_1042_1701 | 213 |
| 445 | 3300046692 | Ga0495671_0351320 | Ga0495671_0351320_30_683 | 213 |
| 446 | 3300048919 | Ga0496116_0002105 | Ga0496116_0002105_14472_15119 | 213 |
| 447 | 3300048922 | Ga0496119_0003104 | Ga0496119_0003104_6783_7430 | 213 |
| 448 | 3300048923 | Ga0496120_0000028 | Ga0496120_0000028_81384_82031 | 213 |
| 449 | 3300048927 | Ga0496124_0001246 | Ga0496124_0001246_2593_3240 | 213 |
| 450 | 3300050493 | nmdc:mga0k408_1230_c1 | nmdc:mga0k408_1230_c1_6688_7338 | 213 |
| 451 | iso_pu_bacteria | 2891395885 | 2891400959 | 213 |
| 452 | 3300005344 | Ga0070661_100407762 | Ga0070661_1004077622 | 214 |
| 453 | 3300005985 | Ga0081539_10000709 | Ga0081539_1000070911 | 214 |
| 454 | 3300009148 | Ga0105243_11016140 | Ga0105243_110161401 | 214 |
| 455 | 3300050509 | nmdc:mga0qj67_126676_c1 | nmdc:mga0qj67_126676_c1_330_998 | 214 |
| 456 | 3300028800 | Ga0265338_10285782 | Ga0265338_102857822 | 215 |
| 457 | 3300044712 | Ga0453684_0027032 | Ga0453684_0027032_4962_5642 | 215 |
| 458 | 3300045051 | Ga0451576_0003274 | Ga0451576_0003274_14417_15097 | 215 |
| 459 | 3300003578 | Ga0006562J51391_1041146 | Ga0006562J51391_10411461 | 216 |
| 460 | 3300031251 | Ga0265327_10122603 | Ga0265327_101226032 | 216 |
| 461 | 3300037418 | Ga0395900_0097583 | Ga0395900_0097583_751_1440 | 216 |
| 462 | 3300044693 | Ga0466961_0320073 | Ga0466961_0320073_113_796 | 216 |
| 463 | 3300044712 | Ga0453684_0000657 | Ga0453684_0000657_65272_65931 | 216 |
| 464 | iso_pu_bacteria | 2643221678 | 2644438682 | 216 |
| 465 | iso_pu_bacteria | 2811994879 | 2812356504 | 216 |
| 466 | 3300039447 | Ga0436361_0662050 | Ga0436361_0662050_1366_2028 | 217 |
| 467 | 3300046471 | Ga0495650_0000056 | Ga0495650_0000056_91315_91980 | 217 |
| 468 | 3300046471 | Ga0495650_0002634 | Ga0495650_0002634_1202_1867 | 217 |
| 469 | 3300046522 | Ga0495643_0078160 | Ga0495643_0078160_1025_1690 | 217 |
| 470 | iso_pu_bacteria | 2582581314 | 2585316078 | 217 |
| 471 | iso_pu_bacteria | 2600255292 | 2601668145 | 217 |
| 472 | iso_pu_bacteria | 2857547612 | 2857550379 | 217 |
| 473 | iso_pu_bacteria | 2885080285 | 2885081797 | 217 |
| 474 | iso_pu_bacteria | 2932410948 | 2932411851 | 217 |
| 475 | iso_pu_bacteria | 2932416698 | 2932418582 | 217 |
| 476 | 3300044666 | Ga0466977_0008418 | Ga0466977_0008418_415_1083 | 218 |
| 477 | 3300049459 | Ga0495678_018990 | Ga0495678_018990_2343_3011 | 218 |
| 478 | 3300049579 | Ga0501043_0570764 | Ga0501043_0570764_120_788 | 218 |
| 479 | iso_pu_bacteria | 2513237150 | 2513956419 | 218 |
| 480 | iso_pu_bacteria | 2513237165 | 2514041519 | 218 |
| 481 | iso_pu_bacteria | 2834641062 | 2834645023 | 218 |
| 482 | iso_pu_bacteria | 2858688981 | 2858695242 | 218 |
| 483 | iso_pu_bacteria | 644736347 | 644748299 | 218 |
| 484 | iso_pu_bacteria | 8003400568 | 8003401409 | 218 |
| 485 | 3300006846 | Ga0075430_100136085 | Ga0075430_1001360852 | 219 |
| 486 | 3300017792 | Ga0163161_10020619 | Ga0163161_100206192 | 220 |
| 487 | 3300025273 | Ga0209673_1034247 | Ga0209673_10342472 | 220 |
| 488 | 3300032004 | Ga0307414_10209347 | Ga0307414_102093472 | 220 |
| 489 | 3300049571 | Ga0501034_0001049 | Ga0501034_0001049_38294_38965 | 220 |
| 490 | iso_pu_bacteria | 2596583598 | 2597031968 | 220 |
| 491 | iso_pu_bacteria | 2599185178 | 2599444087 | 220 |
| 492 | iso_pu_bacteria | 2885266251 | 2885269881 | 220 |
| 493 | iso_pu_bacteria | 2900577576 | 2900579348 | 220 |
| 494 | iso_pu_bacteria | 2928058823 | 2928062310 | 220 |
| 495 | 3300003187 | JGI25151J46595_10035285 | JGI25151J46595_100352852 | 221 |
| 496 | 3300003215 | JGI25153J46596_10054376 | JGI25153J46596_100543761 | 221 |
| 497 | 3300003771 | Ga0055526_1026693 | Ga0055526_10266932 | 221 |
| 498 | 3300003775 | Ga0055524_1002307 | Ga0055524_10023072 | 221 |
| 499 | 3300014497 | Ga0182008_10000119 | Ga0182008_1000011937 | 221 |
| 500 | 3300025263 | Ga0209565_1000084 | Ga0209565_10000847 | 221 |
| 501 | 3300025294 | Ga0209025_1000214 | Ga0209025_100021476 | 221 |
| 502 | 3300025295 | Ga0209564_1022535 | Ga0209564_10225352 | 221 |
| 503 | 3300025297 | Ga0209758_1023388 | Ga0209758_10233882 | 221 |
| 504 | 3300025299 | Ga0209256_1001006 | Ga0209256_10010065 | 221 |
| 505 | 3300048919 | Ga0496116_0075488 | Ga0496116_0075488_995_1675 | 221 |
| 506 | 3300048924 | Ga0496121_0006753 | Ga0496121_0006753_315_989 | 221 |
| 507 | 3300048925 | Ga0496122_0001676 | Ga0496122_0001676_17082_17756 | 221 |
| 508 | 3300048926 | Ga0496123_0002807 | Ga0496123_0002807_4060_4734 | 221 |
| 509 | 3300048928 | Ga0496125_0305834 | Ga0496125_0305834_32_706 | 221 |
| 510 | 3300049460 | Ga0495682_0003131 | Ga0495682_0003131_5670_6344 | 221 |
| 511 | 3300003187 | JGI25151J46595_10004611 | JGI25151J46595_100046112 | 222 |
| 512 | 3300003187 | JGI25151J46595_10026146 | JGI25151J46595_100261462 | 222 |
| 513 | 3300003775 | Ga0055524_1008846 | Ga0055524_10088464 | 222 |
| 514 | 3300003781 | Ga0055536_1000108 | Ga0055536_100010860 | 222 |
| 515 | 3300003784 | Ga0055534_1010636 | Ga0055534_10106362 | 222 |
| 516 | 3300006948 | Ga0099826_10000029 | Ga0099826_1000002977 | 222 |
| 517 | 3300025263 | Ga0209565_1010070 | Ga0209565_10100702 | 222 |
| 518 | 3300025284 | Ga0209130_1006165 | Ga0209130_10061652 | 222 |
| 519 | 3300025291 | Ga0209675_1000464 | Ga0209675_10004642 | 222 |
| 520 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012184 | 222 |
| 521 | 3300025294 | Ga0209025_1001025 | Ga0209025_100102524 | 222 |
| 522 | 3300025294 | Ga0209025_1007952 | Ga0209025_10079527 | 222 |
| 523 | 3300025294 | Ga0209025_1032342 | Ga0209025_10323422 | 222 |
| 524 | 3300025295 | Ga0209564_1025321 | Ga0209564_10253212 | 222 |
| 525 | 3300025295 | Ga0209564_1026027 | Ga0209564_10260272 | 222 |
| 526 | 3300025299 | Ga0209256_1000468 | Ga0209256_10004687 | 222 |
| 527 | 3300025303 | Ga0209051_1012366 | Ga0209051_10123662 | 222 |
| 528 | 3300027666 | Ga0209282_1001593 | Ga0209282_10015935 | 222 |
| 529 | 3300046457 | Ga0495590_0123847 | Ga0495590_0123847_71_748 | 222 |
| 530 | 3300046474 | Ga0495605_0033687 | Ga0495605_0033687_856_1533 | 222 |
| 531 | 3300046491 | Ga0495584_0122503 | Ga0495584_0122503_529_1206 | 222 |
| 532 | 3300046500 | Ga0495596_0023925 | Ga0495596_0023925_1114_1791 | 222 |
| 533 | 3300046501 | Ga0495607_0089016 | Ga0495607_0089016_239_916 | 222 |
| 534 | 3300046512 | Ga0495610_0039594 | Ga0495610_0039594_818_1495 | 222 |
| 535 | 3300046513 | Ga0495616_0042417 | Ga0495616_0042417_768_1445 | 222 |
| 536 | 3300046524 | Ga0495648_0231871 | Ga0495648_0231871_86_763 | 222 |
| 537 | 3300046538 | Ga0495609_0038915 | Ga0495609_0038915_561_1238 | 222 |
| 538 | 3300046615 | Ga0495656_0142997 | Ga0495656_0142997_210_887 | 222 |
| 539 | 3300046665 | Ga0495661_0094528 | Ga0495661_0094528_395_1072 | 222 |
| 540 | 3300046684 | Ga0495669_0265186 | Ga0495669_0265186_49_726 | 222 |
| 541 | 3300046692 | Ga0495671_0040339 | Ga0495671_0040339_820_1497 | 222 |
| 542 | 3300046694 | Ga0495649_0079256 | Ga0495649_0079256_908_1585 | 222 |
| 543 | 3300046794 | Ga0495589_0168587 | Ga0495589_0168587_230_907 | 222 |
| 544 | 3300048905 | Ga0496102_0167677 | Ga0496102_0167677_708_1385 | 222 |
| 545 | 3300048907 | Ga0496104_0393896 | Ga0496104_0393896_572_1249 | 222 |
| 546 | 3300048919 | Ga0496116_0080291 | Ga0496116_0080291_602_1279 | 222 |
| 547 | 3300048924 | Ga0496121_0193629 | Ga0496121_0193629_231_908 | 222 |
| 548 | 3300048925 | Ga0496122_0085638 | Ga0496122_0085638_898_1575 | 222 |
| 549 | 3300048926 | Ga0496123_0067793 | Ga0496123_0067793_755_1432 | 222 |
| 550 | 3300048928 | Ga0496125_0214382 | Ga0496125_0214382_304_981 | 222 |
| 551 | 3300047323 | Ga0495683_0032650 | Ga0495683_0032650_313_1056 | 223 |
| 552 | 3300001915 | JGI24741J21665_1000679 | JGI24741J21665_10006792 | 224 |
| 553 | 3300001979 | JGI24740J21852_10029859 | JGI24740J21852_100298592 | 224 |
| 554 | 3300001979 | JGI24740J21852_10030041 | JGI24740J21852_100300411 | 224 |
| 555 | 3300002705 | JGI25156J39149_1018101 | JGI25156J39149_10181012 | 224 |
| 556 | 3300002705 | JGI25156J39149_1024588 | JGI25156J39149_10245881 | 224 |
| 557 | 3300002738 | JGI25154J39366_1000136 | JGI25154J39366_100013653 | 224 |
| 558 | 3300003578 | Ga0006562J51391_1026270 | Ga0006562J51391_10262701 | 224 |
| 559 | 3300003752 | Ga0055539_1000061 | Ga0055539_100006168 | 224 |
| 560 | 3300003758 | Ga0055532_1000042 | Ga0055532_100004253 | 224 |
| 561 | 3300003759 | Ga0055525_1000480 | Ga0055525_10004807 | 224 |
| 562 | 3300003759 | Ga0055525_1000616 | Ga0055525_100061615 | 224 |
| 563 | 3300003760 | Ga0055527_1000169 | Ga0055527_100016920 | 224 |
| 564 | 3300003761 | Ga0055535_1000031 | Ga0055535_1000031149 | 224 |
| 565 | 3300003762 | Ga0055542_1001292 | Ga0055542_10012929 | 224 |
| 566 | 3300003763 | Ga0055529_1000075 | Ga0055529_1000075103 | 224 |
| 567 | 3300003841 | Ga0055541_1002919 | Ga0055541_10029191 | 224 |
| 568 | 3300003841 | Ga0055541_1015165 | Ga0055541_10151652 | 224 |
| 569 | 3300005344 | Ga0070661_100002111 | Ga0070661_10000211114 | 224 |
| 570 | 3300005366 | Ga0070659_100028665 | Ga0070659_1000286652 | 224 |
| 571 | 3300005455 | Ga0070663_100000086 | Ga0070663_10000008620 | 224 |
| 572 | 3300005564 | Ga0070664_100000210 | Ga0070664_10000021020 | 224 |
| 573 | 3300005578 | Ga0068854_100000176 | Ga0068854_10000017618 | 224 |
| 574 | 3300005614 | Ga0068856_100000539 | Ga0068856_10000053920 | 224 |
| 575 | 3300005616 | Ga0068852_100293395 | Ga0068852_1002933952 | 224 |
| 576 | 3300013100 | Ga0157373_10129255 | Ga0157373_101292552 | 224 |
| 577 | 3300013307 | Ga0157372_10006060 | Ga0157372_1000606015 | 224 |
| 578 | 3300025224 | Ga0209784_100003 | Ga0209784_1000031332 | 224 |
| 579 | 3300025224 | Ga0209784_100686 | Ga0209784_10068610 | 224 |
| 580 | 3300025225 | Ga0209566_100002 | Ga0209566_1000022286 | 224 |
| 581 | 3300025225 | Ga0209566_100330 | Ga0209566_10033045 | 224 |
| 582 | 3300025225 | Ga0209566_102470 | Ga0209566_1024702 | 224 |
| 583 | 3300025226 | Ga0209674_100094 | Ga0209674_100094103 | 224 |
| 584 | 3300025226 | Ga0209674_104116 | Ga0209674_1041162 | 224 |
| 585 | 3300025228 | Ga0209672_100096 | Ga0209672_10009671 | 224 |
| 586 | 3300025229 | Ga0209147_100002 | Ga0209147_100002989 | 224 |
| 587 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041703 | 224 |
| 588 | 3300025242 | Ga0209258_100002 | Ga0209258_100002989 | 224 |
| 589 | 3300025246 | Ga0209646_1000019 | Ga0209646_1000019255 | 224 |
| 590 | 3300025250 | Ga0209026_1011832 | Ga0209026_10118322 | 224 |
| 591 | 3300025253 | Ga0209677_100071 | Ga0209677_10007173 | 224 |
| 592 | 3300025254 | Ga0209148_1000118 | Ga0209148_100011895 | 224 |
| 593 | 3300025256 | Ga0209759_1004997 | Ga0209759_10049973 | 224 |
| 594 | 3300025256 | Ga0209759_1012625 | Ga0209759_10126252 | 224 |
| 595 | 3300025272 | Ga0209455_1000009 | Ga0209455_1000009870 | 224 |
| 596 | 3300025913 | Ga0207695_10003065 | Ga0207695_100030659 | 224 |
| 597 | 3300025932 | Ga0207690_10001107 | Ga0207690_100011076 | 224 |
| 598 | 3300025945 | Ga0207679_10000240 | Ga0207679_1000024019 | 224 |
| 599 | 3300025981 | Ga0207640_10000049 | Ga0207640_1000004968 | 224 |
| 600 | 3300026067 | Ga0207678_10000353 | Ga0207678_1000035318 | 224 |
| 601 | 3300026078 | Ga0207702_10000550 | Ga0207702_1000055018 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.4553 | 14 | 194 |
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.4135 | 17 | 200 |
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.3772 | 14 | 194 |
| 5f4y-assembly1.cif.gz_A | structure of the sd2 domain of human shroom2 | 0.3354 | 36 | 189 |
| 5f5p-assembly1.cif.gz_A | molecular basis for shroom2 recognition by rock1 | 0.3187 | 32 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10320_1_287_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4592 | 14 | 193 | 1.20.1250.20 |
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4546 | 16 | 191 | 1.20.1250.20 |
| af_Q6P2T9_1_103_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.4519 | 78 | 191 | 1.20.120.350 |
| af_Q9P7Q0_1_262_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4287 | 3 | 193 | 1.20.1250.20 |
| af_Q6P2T9_1_103_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.415 | 78 | 191 | 1.20.120.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6H0CX50-F1-model_v4 | Leucine efflux protein LeuE | 0.9373 | 9 | 221 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A1G7VGT7-F1-model_v4 | Leucine efflux protein | 0.9372 | 8 | 220 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-P38102-F1-model_v4 | Uncharacterized membrane protein PA4757 | 0.9348 | 9 | 224 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A5M3XKK9-F1-model_v4 | Leucine efflux protein | 0.9234 | 8 | 220 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A3N0D5H8-F1-model_v4 | Leucine efflux protein LeuE | 0.9218 | 9 | 220 |
GO:0005886
GO:0015190 GO:0015820 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar