F467954

General Info

Members Datasets Scaffolds Average Seq Length
600 260 1200 259

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100009700|Ga0070706_1000097003
Length 296
Sequence MTQPITHPAAPAPGSCCPGLPRISIVIPAKDEAGRIGRALTRILAAVRSSCEIIVVTDSAADPTWEEVQARAAAEPRLRCLVSEYGPGPANAIRYGIDDARAEVVVVTMADNSDDPRQIDELAALVERGAAVAVASRYSRGGGQIGGPIVKGLLSQLAGRSLHLLARPGTRDATNSFKAYSTSFVREVGIDSRQGFAIGIELTAKARRLRRQVAEIPTIWLDRQDGTSGFRMLAWMPSYLRWYLFCFGRKLTADQLAATATARQIPAQRQPSEWAAWHVIGAEERLVGARDSRGTA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
155 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 3.33
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100009700 3300005467 Bacteria 8948
2 Ga0070683_100002983 3300005329 Bacteria 13573
3 Ga0070683_100013859 3300005329 Bacteria 7040
4 Ga0070670_100144323 3300005331 Bacteria 2059
5 Ga0068869_100015222 3300005334 Bacteria 5155
6 Ga0070680_100286423 3300005336 Bacteria 1396
7 Ga0070682_100096491 3300005337 Bacteria 1944
8 Ga0068868_100003947 3300005338 Bacteria 10356
9 Ga0070660_100024518 3300005339 Bacteria 4475
10 Ga0070660_100168670 3300005339 Bacteria 1767
11 Ga0070691_10062691 3300005341 Bacteria 1791
12 Ga0070692_10125842 3300005345 Bacteria 1435
13 Ga0070675_100001399 3300005354 Bacteria 17695
14 Ga0070709_10013875 3300005434 Bacteria 4543
15 Ga0070709_10019060 3300005434 Bacteria 3959
16 Ga0070714_100004362 3300005435 Bacteria 10655
17 Ga0070714_100006105 3300005435 Bacteria 9256
18 Ga0070714_100013007 3300005435 Bacteria 6656
19 Ga0070714_100085533 3300005435 Bacteria 2754
20 Ga0070714_100189799 3300005435 Bacteria 1874
21 Ga0070714_100355034 3300005435 Bacteria 1377
22 Ga0070714_100380417 3300005435 Bacteria 1331
23 Ga0070714_100412932 3300005435 Bacteria 1278
24 Ga0070714_100452542 3300005435 Bacteria 1220
25 Ga0070714_100634725 3300005435 Bacteria 1027
26 Ga0070713_100031599 3300005436 Bacteria 4219
27 Ga0070713_100033100 3300005436 Bacteria 4137
28 Ga0070713_100051899 3300005436 Bacteria 3394
29 Ga0070713_100055833 3300005436 Bacteria 3283
30 Ga0070713_100301322 3300005436 Bacteria 1475
31 Ga0070713_100440767 3300005436 Bacteria 1222
32 Ga0070713_100450637 3300005436 Bacteria 1208
33 Ga0070710_10001515 3300005437 Bacteria 10958
34 Ga0070710_10010163 3300005437 Bacteria 4617
35 Ga0070710_10016665 3300005437 Bacteria 3744
36 Ga0070710_10130940 3300005437 Bacteria 1529
37 Ga0070710_10198455 3300005437 Bacteria 1265
38 Ga0070710_10202651 3300005437 Bacteria 1254
39 Ga0070711_100005054 3300005439 Bacteria 7854
40 Ga0070711_100008116 3300005439 Bacteria 6416
41 Ga0070711_100201733 3300005439 Bacteria 1535
42 Ga0070711_100262032 3300005439 Bacteria 1360
43 Ga0070711_100315188 3300005439 Bacteria 1248
44 Ga0070708_100002694 3300005445 Bacteria 13762
45 Ga0070708_100010117 3300005445 Bacteria 7632
46 Ga0070708_100019525 3300005445 Bacteria 5697
47 Ga0070708_100044666 3300005445 Bacteria 3898
48 Ga0070708_100068992 3300005445 Bacteria 3179
49 Ga0070708_100208673 3300005445 Bacteria 1830
50 Ga0070708_100356928 3300005445 Bacteria 1377
51 Ga0070708_100471580 3300005445 Bacteria 1184
52 Ga0070678_100441247 3300005456 Bacteria 1138
53 Ga0070681_10000044 3300005458 Bacteria 85697
54 Ga0070681_10013993 3300005458 Bacteria 7985
55 Ga0070706_100018696 3300005467 Bacteria 6389
56 Ga0070706_100063303 3300005467 Bacteria 3418
57 Ga0070706_100331966 3300005467 Bacteria 1418
58 Ga0070706_100726295 3300005467 Bacteria 921
59 Ga0070706_100835894 3300005467 Bacteria 852
60 Ga0070707_100006227 3300005468 Bacteria 11110
61 Ga0070707_100008767 3300005468 Bacteria 9380
62 Ga0070707_100021431 3300005468 Bacteria 6108
63 Ga0070707_100259027 3300005468 Bacteria 1692
64 Ga0070698_100000057 3300005471 Bacteria 79148
65 Ga0070698_100011175 3300005471 Bacteria 9539
66 Ga0070698_100034056 3300005471 Bacteria 5276
67 Ga0070698_100037538 3300005471 Bacteria 4995
68 Ga0070698_100624839 3300005471 Unclassified 1018
69 Ga0070699_100001068 3300005518 Bacteria 25506
70 Ga0070699_100278286 3300005518 Bacteria 1499
71 Ga0070679_100000022 3300005530 Bacteria 123735
72 Ga0070679_100013796 3300005530 Bacteria 7742
73 Ga0070679_100019351 3300005530 Bacteria 6616
74 Ga0070679_100123616 3300005530 Bacteria 2571
75 Ga0070684_100266649 3300005535 Bacteria 1567
76 Ga0070697_100000741 3300005536 Bacteria 24369
77 Ga0068853_100036208 3300005539 Bacteria 4195
78 Ga0070665_100021997 3300005548 Bacteria 6415
79 Ga0068855_100003454 3300005563 Bacteria 19334
80 Ga0070664_100000450 3300005564 Bacteria 31114
81 Ga0070664_100198010 3300005564 Bacteria 1791
82 Ga0070664_100448715 3300005564 Bacteria 1184
83 Ga0068857_100016669 3300005577 Bacteria 6437
84 Ga0068857_100140382 3300005577 Bacteria 2184
85 Ga0068854_100001190 3300005578 Bacteria 15604
86 Ga0068854_100320329 3300005578 Bacteria 1260
87 Ga0068856_100197009 3300005614 Bacteria 2028
88 Ga0068856_100278607 3300005614 Bacteria 1689
89 Ga0068856_100660586 3300005614 Bacteria 1066
90 Ga0068852_100002473 3300005616 Bacteria 12720
91 Ga0068864_100177421 3300005618 Bacteria 1946
92 Ga0068870_10067202 3300005840 Bacteria 1944
93 Ga0068860_100396310 3300005843 Bacteria 1365
94 Ga0068862_100386906 3300005844 Bacteria 1306
95 Ga0081540_1000082 3300005983 Bacteria 101309
96 Ga0081540_1001248 3300005983 Bacteria 22213
97 Ga0081539_10001834 3300005985 Bacteria 33545
98 Ga0081539_10004674 3300005985 Bacteria 14859
99 Ga0081539_10020066 3300005985 Bacteria 4542
100 Ga0070717_10007222 3300006028 Bacteria 8241
101 Ga0070717_10015698 3300006028 Bacteria 5853
102 Ga0070717_10039381 3300006028 Bacteria 3846
103 Ga0070717_10042197 3300006028 Bacteria 3720
104 Ga0070717_10048210 3300006028 Bacteria 3493
105 Ga0070717_10062140 3300006028 Bacteria 3097
106 Ga0070717_10078676 3300006028 Bacteria 2764
107 Ga0075365_10040272 3300006038 Bacteria 3047
108 Ga0075365_10110954 3300006038 Bacteria 1885
109 Ga0075363_100048110 3300006048 Bacteria 2267
110 Ga0075364_10000298 3300006051 Bacteria 24114
111 Ga0070715_10007805 3300006163 Bacteria 3699
112 Ga0070715_10008936 3300006163 Bacteria 3513
113 Ga0070715_10024858 3300006163 Bacteria 2366
114 Ga0070716_100002385 3300006173 Bacteria 8647
115 Ga0070716_100011611 3300006173 Bacteria 4438
116 Ga0070716_100018856 3300006173 Bacteria 3598
117 Ga0070716_100094229 3300006173 Bacteria 1820
118 Ga0070716_100123472 3300006173 Bacteria 1625
119 Ga0070712_100004955 3300006175 Bacteria 8234
120 Ga0070712_100020491 3300006175 Bacteria 4327
121 Ga0070712_100174748 3300006175 Bacteria 1669
122 Ga0070712_100188662 3300006175 Bacteria 1611
123 Ga0070712_100213093 3300006175 Bacteria 1524
124 Ga0070712_100534026 3300006175 Bacteria 987
125 Ga0075367_10021947 3300006178 Bacteria 3574
126 Ga0075367_10073263 3300006178 Bacteria 2063
127 Ga0097621_100069883 3300006237 Bacteria 2899
128 Ga0075430_100001812 3300006846 Bacteria 17488
129 Ga0075430_100008120 3300006846 Bacteria 8872
130 Ga0075430_100400092 3300006846 Bacteria 1133
131 Ga0075431_100001436 3300006847 Bacteria 21935
132 Ga0075431_100058489 3300006847 Bacteria 3979
133 Ga0075434_100200423 3300006871 Bacteria 2016
134 Ga0075434_100363363 3300006871 Bacteria 1468
135 Ga0075429_100000244 3300006880 Bacteria 37496
136 Ga0075429_100051876 3300006880 Bacteria 3568
137 Ga0099795_10179145 3300007788 Bacteria 884
138 Ga0105240_10007061 3300009093 Bacteria 16374
139 Ga0105240_10402027 3300009093 Bacteria 1542
140 Ga0111539_10005195 3300009094 Bacteria 16863
141 Ga0105245_10004765 3300009098 Bacteria 11974
142 Ga0105245_10079091 3300009098 Bacteria 3001
143 Ga0114129_10000723 3300009147 Bacteria 41902
144 Ga0114129_10046266 3300009147 Bacteria 6116
145 Ga0105241_10003881 3300009174 Bacteria 11084
146 Ga0105241_10553920 3300009174 Bacteria 1033
147 Ga0105237_10009613 3300009545 Bacteria 10355
148 Ga0105237_10405936 3300009545 Bacteria 1367
149 Ga0105237_10419209 3300009545 Bacteria 1344
150 Ga0105238_10041172 3300009551 Bacteria 4680
151 Ga0105238_10714937 3300009551 Bacteria 1014
152 Ga0105249_10147207 3300009553 Bacteria 2264
153 Ga0105239_10044471 3300010375 Bacteria 4868
154 Ga0105239_10917062 3300010375 Bacteria 1006
155 Ga0157370_10198113 3300013104 Bacteria 1863
156 Ga0157370_10228017 3300013104 Bacteria 1724
157 Ga0157370_10277515 3300013104 Bacteria 1548
158 Ga0157369_10041167 3300013105 Bacteria 5043
159 Ga0157369_10631564 3300013105 Bacteria 1105
160 Ga0157369_10672213 3300013105 Bacteria 1067
161 Ga0157374_10069527 3300013296 Bacteria 3315
162 Ga0157372_10340327 3300013307 Bacteria 1747
163 Ga0157372_10623328 3300013307 Bacteria 1257
164 Ga0157375_10163852 3300013308 Bacteria 2367
165 Ga0163163_10320805 3300014325 Bacteria 1603
166 Ga0157379_10645467 3300014968 Bacteria 991
167 Ga0197907_10931930 3300020069 Bacteria 2157
168 Ga0197907_11161104 3300020069 Bacteria 3021
169 Ga0206356_11080520 3300020070 Bacteria 5325
170 Ga0206356_11585391 3300020070 Bacteria 1957
171 Ga0206351_10081016 3300020077 Bacteria 1199
172 Ga0206351_10378242 3300020077 Bacteria 2794
173 Ga0206352_11091526 3300020078 Bacteria 2515
174 Ga0206350_11267928 3300020080 Bacteria 2928
175 Ga0206354_11706882 3300020081 Bacteria 4769
176 Ga0206353_10283825 3300020082 Bacteria 2628
177 Ga0206353_10385475 3300020082 Bacteria 4824
178 Ga0213875_10000133 3300021388 Bacteria 82555
179 Ga0213875_10000906 3300021388 Bacteria 21496
180 Ga0213875_10005816 3300021388 Bacteria 6561
181 Ga0213875_10069633 3300021388 Bacteria 1642
182 Ga0224712_10007303 3300022467 Bacteria 3210
183 Ga0224712_10008936 3300022467 Bacteria 2995
184 Ga0207692_10001689 3300025898 Bacteria 8335
185 Ga0207692_10024822 3300025898 Bacteria 2792
186 Ga0207692_10102120 3300025898 Bacteria 1576
187 Ga0207642_10225986 3300025899 Bacteria 1049
188 Ga0207647_10003099 3300025904 Bacteria 12490
189 Ga0207685_10032776 3300025905 Bacteria 1872
190 Ga0207685_10080032 3300025905 Bacteria 1350
191 Ga0207699_10000350 3300025906 Bacteria 24554
192 Ga0207699_10007717 3300025906 Bacteria 5266
193 Ga0207699_10009114 3300025906 Bacteria 4927
194 Ga0207699_10130000 3300025906 Bacteria 1641
195 Ga0207699_10264468 3300025906 Bacteria 1190
196 Ga0207645_10067388 3300025907 Bacteria 2288
197 Ga0207643_10030196 3300025908 Bacteria 3016
198 Ga0207684_10037716 3300025910 Bacteria 4101
199 Ga0207684_10042747 3300025910 Bacteria 3843
200 Ga0207684_10054060 3300025910 Bacteria 3407
201 Ga0207684_10126049 3300025910 Bacteria 2197
202 Ga0207684_10464136 3300025910 Bacteria 1087
203 Ga0207654_10002031 3300025911 Bacteria 10376
204 Ga0207707_10000041 3300025912 Bacteria 130140
205 Ga0207707_10002673 3300025912 Bacteria 15923
206 Ga0207695_10000796 3300025913 Bacteria 59143
207 Ga0207671_10000188 3300025914 Bacteria 95365
208 Ga0207693_10008037 3300025915 Bacteria 8662
209 Ga0207693_10011030 3300025915 Bacteria 7323
210 Ga0207693_10014000 3300025915 Bacteria 6459
211 Ga0207693_10031130 3300025915 Bacteria 4215
212 Ga0207693_10036403 3300025915 Bacteria 3880
213 Ga0207693_10045320 3300025915 Bacteria 3455
214 Ga0207693_10067360 3300025915 Bacteria 2803
215 Ga0207693_10172042 3300025915 Bacteria 1705
216 Ga0207693_10198922 3300025915 Bacteria 1576
217 Ga0207663_10001697 3300025916 Bacteria 10359
218 Ga0207663_10019381 3300025916 Bacteria 3831
219 Ga0207663_10043435 3300025916 Bacteria 2752
220 Ga0207663_10080667 3300025916 Bacteria 2128
221 Ga0207663_10123043 3300025916 Bacteria 1780
222 Ga0207663_10143082 3300025916 Bacteria 1668
223 Ga0207663_10458738 3300025916 Bacteria 984
224 Ga0207660_10000628 3300025917 Bacteria 23750
225 Ga0207657_10035633 3300025919 Bacteria 4461
226 Ga0207657_10035923 3300025919 Bacteria 4439
227 Ga0207652_10000533 3300025921 Bacteria 38625
228 Ga0207652_10029997 3300025921 Bacteria 4552
229 Ga0207652_10073827 3300025921 Bacteria 2968
230 Ga0207646_10010574 3300025922 Bacteria 9002
231 Ga0207646_10013664 3300025922 Bacteria 7754
232 Ga0207646_10024588 3300025922 Bacteria 5517
233 Ga0207646_10036315 3300025922 Bacteria 4448
234 Ga0207646_10301862 3300025922 Bacteria 1447
235 Ga0207694_10000164 3300025924 Bacteria 68118
236 Ga0207650_10101867 3300025925 Bacteria 2212
237 Ga0207659_10072654 3300025926 Bacteria 2516
238 Ga0207687_10038914 3300025927 Bacteria 3253
239 Ga0207687_10290787 3300025927 Bacteria 1313
240 Ga0207700_10000221 3300025928 Bacteria 34121
241 Ga0207700_10002376 3300025928 Bacteria 10823
242 Ga0207700_10002489 3300025928 Bacteria 10560
243 Ga0207700_10072997 3300025928 Bacteria 2648
244 Ga0207700_10085635 3300025928 Bacteria 2474
245 Ga0207700_10099454 3300025928 Bacteria 2316
246 Ga0207700_10178675 3300025928 Bacteria 1776
247 Ga0207700_10241620 3300025928 Bacteria 1539
248 Ga0207664_10000439 3300025929 Bacteria 29728
249 Ga0207664_10008435 3300025929 Bacteria 7187
250 Ga0207664_10026771 3300025929 Bacteria 4362
251 Ga0207664_10028259 3300025929 Bacteria 4260
252 Ga0207664_10039262 3300025929 Bacteria 3675
253 Ga0207664_10148309 3300025929 Bacteria 1991
254 Ga0207664_10291786 3300025929 Bacteria 1433
255 Ga0207664_10329026 3300025929 Bacteria 1349
256 Ga0207664_10462044 3300025929 Bacteria 1134
257 Ga0207690_10049698 3300025932 Bacteria 2797
258 Ga0207665_10001848 3300025939 Bacteria 14253
259 Ga0207665_10002114 3300025939 Bacteria 13436
260 Ga0207665_10005805 3300025939 Bacteria 8212
261 Ga0207665_10057583 3300025939 Bacteria 2626
262 Ga0207665_10145125 3300025939 Bacteria 1696
263 Ga0207665_10311187 3300025939 Bacteria 1180
264 Ga0207689_10005109 3300025942 Bacteria 11801
265 Ga0207661_10124977 3300025944 Bacteria 2196
266 Ga0207661_10500216 3300025944 Bacteria 1110
267 Ga0207679_10006352 3300025945 Bacteria 7469
268 Ga0207679_10148697 3300025945 Bacteria 1903
269 Ga0207667_10012835 3300025949 Bacteria 9627
270 Ga0207712_10314341 3300025961 Bacteria 1290
271 Ga0207640_10328453 3300025981 Bacteria 1221
272 Ga0207677_10339082 3300026023 Bacteria 1255
273 Ga0207677_10425325 3300026023 Unclassified 1132
274 Ga0207639_10042170 3300026041 Bacteria 3419
275 Ga0207678_10020259 3300026067 Bacteria 5837
276 Ga0207678_10022277 3300026067 Bacteria 5551
277 Ga0207678_10027679 3300026067 Bacteria 4948
278 Ga0207678_10376643 3300026067 Bacteria 1227
279 Ga0207702_10023626 3300026078 Bacteria 5100
280 Ga0207702_10167787 3300026078 Bacteria 2010
281 Ga0207702_10593916 3300026078 Bacteria 1086
282 Ga0207641_10054858 3300026088 Bacteria 3384
283 Ga0207674_10005875 3300026116 Bacteria 14549
284 Ga0207674_10158202 3300026116 Bacteria 2221
285 Ga0207675_100061814 3300026118 Bacteria 3497
286 Ga0207683_10049666 3300026121 Bacteria 3673
287 Ga0207698_10003604 3300026142 Bacteria 9346
288 Ga0207428_10014135 3300027907 Bacteria 6950
289 Ga0268266_10037282 3300028379 Bacteria 4143
290 Ga0268266_10194616 3300028379 Bacteria 1852
291 Ga0268265_10316997 3300028380 Bacteria 1410
292 Ga0265337_1000446 3300028556 Bacteria 21976
293 Ga0265326_10004078 3300028558 Bacteria 4716
294 Ga0265319_1000384 3300028563 Bacteria 31990
295 Ga0265334_10000656 3300028573 Bacteria 17383
296 Ga0265323_10001803 3300028653 Bacteria 10167
297 Ga0265322_10002612 3300028654 Bacteria 5536
298 Ga0265336_10002411 3300028666 Bacteria 7729
299 Ga0265336_10007370 3300028666 Bacteria 3912
300 Ga0307515_10000027 3300028794 Bacteria 371624
301 Ga0265338_10000175 3300028800 Bacteria 118915
302 Ga0265338_10016444 3300028800 Bacteria 8050
303 Ga0265324_10002832 3300029957 Bacteria 8545
304 Ga0265763_1002154 3300030763 Bacteria 1487
305 Ga0265763_1004501 3300030763 Bacteria 1144
306 Ga0265760_10010877 3300031090 Bacteria 2599
307 Ga0265332_10017952 3300031238 Bacteria 3118
308 Ga0265320_10004241 3300031240 Bacteria 9420
309 Ga0265325_10007028 3300031241 Bacteria 6785
310 Ga0265340_10010731 3300031247 Bacteria 4893
311 Ga0265316_10083607 3300031344 Bacteria 2445
312 Ga0307513_10042996 3300031456 Bacteria 4968
313 Ga0307513_10049545 3300031456 Bacteria 4549
314 Ga0307509_10037641 3300031507 Bacteria 5288
315 Ga0307509_10047503 3300031507 Bacteria 4617
316 Ga0307509_10069969 3300031507 Bacteria 3666
317 Ga0307408_100059097 3300031548 Bacteria 2790
318 Ga0307408_100344690 3300031548 Bacteria 1262
319 Ga0307508_10193851 3300031616 Bacteria 1633
320 Ga0265314_10054516 3300031711 Bacteria 2767
321 Ga0265342_10004867 3300031712 Bacteria 10397
322 Ga0307516_10000946 3300031730 Bacteria 40041
323 Ga0307405_10037388 3300031731 Bacteria 2917
324 Ga0307406_10074329 3300031901 Bacteria 2237
325 Ga0307406_10193839 3300031901 Bacteria 1490
326 Ga0307407_10245320 3300031903 Bacteria 1224
327 Ga0307409_100333108 3300031995 Bacteria 1425
328 Ga0307416_100068364 3300032002 Bacteria 2935
329 Ga0307415_100102722 3300032126 Bacteria 2101
330 Ga0307507_10000001 3300033179 Bacteria 417520
331 Ga0316214_1000546 3300033545 Bacteria 3908
332 Ga0316212_1000872 3300033547 Bacteria 3933
333 Ga0373926_0003300 3300035083 Bacteria 5185
334 Ga0373934_0124765 3300035086 Bacteria 1048
335 Ga0373940_0017382 3300035088 Bacteria 1793
336 Ga0373944_0000796 3300035089 Bacteria 7698
337 Ga0373944_0002776 3300035089 Bacteria 4478
338 Ga0373923_0084966 3300035111 Bacteria 1377
339 Ga0373923_0187762 3300035111 Bacteria 951
340 Ga0373936_0001461 3300035113 Bacteria 8585
341 Ga0373936_0005054 3300035113 Bacteria 4964
342 Ga0373936_0036874 3300035113 Bacteria 1950
343 Ga0373945_0000495 3300035116 Bacteria 11182
344 Ga0373945_0000624 3300035116 Bacteria 10173
345 Ga0373953_0007390 3300035117 Bacteria 3676
346 Ga0373953_0063959 3300035117 Bacteria 1508
347 Ga0373954_0064258 3300035118 Bacteria 1735
348 Ga0373956_0010856 3300035119 Bacteria 3743
349 Ga0373957_0010915 3300035120 Bacteria 3017
350 Ga0373957_0016551 3300035120 Bacteria 2553
351 Ga0373960_0149509 3300035121 Bacteria 797
352 Ga0373946_0001477 3300035171 Bacteria 8176
353 Ga0373955_0011865 3300035172 Bacteria 4171
354 Ga0373955_0013531 3300035172 Bacteria 3948
355 Ga0373955_0176161 3300035172 Bacteria 1267
356 Ga0373955_0212739 3300035172 Bacteria 1153
357 Ga0373924_0088979 3300035410 Bacteria 1319
358 Ga0373924_0152349 3300035410 Bacteria 1012
359 Ga0373924_0192571 3300035410 Bacteria 898
360 Ga0373935_0004952 3300035692 Bacteria 7833
361 Ga0373935_0111987 3300035692 Bacteria 1812
362 Ga0373935_0323718 3300035692 Bacteria 1094
363 Ga0373927_0020630 3300035695 Bacteria 4320
364 Ga0373927_0055858 3300035695 Bacteria 2552
365 Ga0373933_0014091 3300035724 Bacteria 4439
366 Ga0373933_0022183 3300035724 Bacteria 3613
367 Ga0373933_0036396 3300035724 Bacteria 2880
368 Ga0373933_0057558 3300035724 Bacteria 2336
369 Ga0373933_0092322 3300035724 Bacteria 1869
370 Ga0373947_0025975 3300035725 Bacteria 3417
371 Ga0373947_0112279 3300035725 Bacteria 1723
372 Ga0373937_0019793 3300036401 Bacteria 6028
373 Ga0373937_0053858 3300036401 Bacteria 3690
374 Ga0373937_0132931 3300036401 Bacteria 2325
375 Ga0373937_0349023 3300036401 Bacteria 1401
376 Ga0373937_0739610 3300036401 Bacteria 931
377 Ga0316582_0471041 3300036647 Bacteria 866
378 Ga0373925_0000033 3300037068 Bacteria 144636
379 Ga0373925_0000872 3300037068 Bacteria 27570
380 Ga0373925_0517318 3300037068 Bacteria 980
381 Ga0436364_0335518 3300037853 Bacteria 7387
382 Ga0436364_0633838 3300037853 Bacteria 2748
383 Ga0436364_0699238 3300037853 Bacteria 158550
384 Ga0436364_0972777 3300037853 Bacteria 1864
385 Ga0436364_1048956 3300037853 Bacteria 1604
386 Ga0436364_1232097 3300037853 Bacteria 76315
387 Ga0436364_1239878 3300037853 Bacteria 3444
388 Ga0436361_0063923 3300039447 Bacteria 1438
389 Ga0436363_0518648 3300039450 Bacteria 1659
390 Ga0436363_1016555 3300039450 Bacteria 1332
391 Ga0466966_0009840 3300044684 Bacteria 6337
392 Ga0466961_0014742 3300044693 Bacteria 5023
393 Ga0466961_0038635 3300044693 Bacteria 3062
394 Ga0466963_0021698 3300044694 Bacteria 4055
395 Ga0466963_0052483 3300044694 Bacteria 2706
396 Ga0466963_0203500 3300044694 Bacteria 1385
397 Ga0466971_0081825 3300044719 Bacteria 1473
398 Ga0466970_0024984 3300044765 Bacteria 3126
399 Ga0466959_0008388 3300045049 Bacteria 7302
400 Ga0466958_0259791 3300045836 Bacteria 1111
401 Ga0466967_0089726 3300045976 Bacteria 2791
402 Ga0495592_0136218 3300046454 Bacteria 1712
403 Ga0495592_0138765 3300046454 Bacteria 1693
404 Ga0495592_0160130 3300046454 Bacteria 1549
405 Ga0495592_0168585 3300046454 Bacteria 1501
406 Ga0495592_0309560 3300046454 Bacteria 1024
407 Ga0495629_0054425 3300046459 Bacteria 2798
408 Ga0495629_0260103 3300046459 Bacteria 1193
409 Ga0495641_0001394 3300046461 Bacteria 20600
410 Ga0495641_0046056 3300046461 Bacteria 2006
411 Ga0495651_0008725 3300046462 Bacteria 7774
412 Ga0495651_0026531 3300046462 Bacteria 4512
413 Ga0495651_0040855 3300046462 Bacteria 3603
414 Ga0495651_0040882 3300046462 Bacteria 3602
415 Ga0495651_0065099 3300046462 Bacteria 2784
416 Ga0495651_0518735 3300046462 Bacteria 761
417 Ga0495653_0003695 3300046463 Bacteria 12370
418 Ga0495653_0031185 3300046463 Bacteria 4238
419 Ga0495653_0044845 3300046463 Bacteria 3430
420 Ga0495653_0054675 3300046463 Bacteria 3049
421 Ga0495653_0146134 3300046463 Bacteria 1656
422 Ga0495639_0008353 3300046475 Bacteria 4441
423 Ga0495662_0017513 3300046476 Bacteria 3466
424 Ga0495662_0231461 3300046476 Bacteria 911
425 Ga0495664_0004488 3300046477 Bacteria 7639
426 Ga0495664_0005575 3300046477 Bacteria 6920
427 Ga0495664_0009847 3300046477 Bacteria 5358
428 Ga0495664_0073080 3300046477 Bacteria 2050
429 Ga0495664_0094004 3300046477 Bacteria 1804
430 Ga0495594_0011621 3300046499 Bacteria 4579
431 Ga0495608_0005470 3300046511 Bacteria 9081
432 Ga0495608_0009742 3300046511 Bacteria 6703
433 Ga0495608_0029441 3300046511 Bacteria 3723
434 Ga0495608_0084378 3300046511 Bacteria 2060
435 Ga0495618_0030116 3300046514 Bacteria 3388
436 Ga0495618_0034515 3300046514 Bacteria 3172
437 Ga0495618_0099631 3300046514 Bacteria 1859
438 Ga0495618_0133627 3300046514 Bacteria 1587
439 Ga0495628_0018615 3300046516 Bacteria 5749
440 Ga0495628_0057352 3300046516 Bacteria 3063
441 Ga0495628_0152522 3300046516 Bacteria 1759
442 Ga0495628_0358029 3300046516 Bacteria 1072
443 Ga0495630_0017176 3300046517 Bacteria 5298
444 Ga0495630_0378098 3300046517 Bacteria 1085
445 Ga0495666_0007081 3300046526 Bacteria 5637
446 Ga0495666_0085488 3300046526 Bacteria 1490
447 Ga0495652_0001307 3300046529 Bacteria 27791
448 Ga0495652_0009794 3300046529 Bacteria 8691
449 Ga0495652_0013169 3300046529 Bacteria 7446
450 Ga0495652_0049915 3300046529 Bacteria 3579
451 Ga0495652_0068639 3300046529 Bacteria 2969
452 Ga0495652_0394385 3300046529 Bacteria 981
453 Ga0495652_0408658 3300046529 Bacteria 959
454 Ga0495665_0002508 3300046531 Bacteria 9915
455 Ga0495665_0119191 3300046531 Bacteria 1382
456 Ga0495640_0003592 3300046533 Bacteria 12453
457 Ga0495640_0024076 3300046533 Bacteria 4430
458 Ga0495640_0280860 3300046533 Unclassified 1037
459 Ga0495586_0001455 3300046535 Bacteria 13064
460 Ga0495586_0107258 3300046535 Bacteria 1553
461 Ga0495587_0011734 3300046536 Bacteria 5545
462 Ga0495587_0036329 3300046536 Bacteria 2964
463 Ga0495587_0037617 3300046536 Bacteria 2905
464 Ga0495587_0082607 3300046536 Bacteria 1861
465 Ga0495587_0094318 3300046536 Bacteria 1728
466 Ga0495587_0116850 3300046536 Bacteria 1529
467 Ga0495645_0013094 3300046543 Bacteria 5861
468 Ga0495645_0016390 3300046543 Bacteria 5289
469 Ga0495645_0021802 3300046543 Bacteria 4631
470 Ga0495645_0118775 3300046543 Bacteria 1863
471 Ga0495622_0109082 3300046557 Bacteria 1267
472 Ga0495667_0005542 3300046559 Bacteria 8532
473 Ga0495667_0008452 3300046559 Bacteria 6987
474 Ga0495667_0050438 3300046559 Bacteria 2747
475 Ga0495667_0061288 3300046559 Bacteria 2466
476 Ga0495667_0098394 3300046559 Bacteria 1894
477 Ga0495634_0004547 3300046642 Bacteria 10849
478 Ga0495634_0052680 3300046642 Bacteria 2727
479 Ga0495634_0110245 3300046642 Bacteria 1770
480 Ga0495634_0180333 3300046642 Bacteria 1322
481 Ga0495635_0002349 3300046663 Bacteria 12867
482 Ga0495635_0003410 3300046663 Bacteria 10985
483 Ga0495635_0007622 3300046663 Bacteria 7554
484 Ga0495635_0025915 3300046663 Bacteria 4083
485 Ga0495588_0027144 3300046674 Bacteria 2861
486 Ga0495657_0013444 3300046675 Bacteria 6041
487 Ga0495657_0014354 3300046675 Bacteria 5814
488 Ga0495657_0024665 3300046675 Bacteria 4279
489 Ga0495657_0094565 3300046675 Bacteria 1911
490 Ga0495657_0150488 3300046675 Bacteria 1445
491 Ga0495657_0365253 3300046675 Bacteria 852
492 Ga0495599_0008048 3300046678 Bacteria 6399
493 Ga0495599_0105639 3300046678 Bacteria 1754
494 Ga0495599_0119814 3300046678 Bacteria 1636
495 Ga0495599_0123408 3300046678 Bacteria 1610
496 Ga0495599_0163681 3300046678 Bacteria 1374
497 Ga0495599_0163888 3300046678 Bacteria 1373
498 Ga0495623_0030092 3300046679 Bacteria 3493
499 Ga0495646_0008820 3300046680 Bacteria 6404
500 Ga0495646_0042025 3300046680 Bacteria 2807
501 Ga0495646_0261509 3300046680 Bacteria 924
502 Ga0495647_0001380 3300046681 Bacteria 7494
503 Ga0495658_0008607 3300046683 Bacteria 5062
504 Ga0495613_0019382 3300046689 Bacteria 5070
505 Ga0495624_0002654 3300046690 Bacteria 13486
506 Ga0495624_0083475 3300046690 Bacteria 1975
507 Ga0495600_0002469 3300046809 Bacteria 10609
508 Ga0495600_0003021 3300046809 Bacteria 9821
509 Ga0495600_0071069 3300046809 Bacteria 2274
510 Ga0495600_0115522 3300046809 Bacteria 1747
511 Ga0495600_0305352 3300046809 Bacteria 1003
512 Ga0495581_0004259 3300047315 Bacteria 8248
513 Ga0495581_0053098 3300047315 Bacteria 2341
514 Ga0495581_0172695 3300047315 Bacteria 1264
515 Ga0495604_0010560 3300047317 Bacteria 7320
516 Ga0495604_0104278 3300047317 Bacteria 2078
517 Ga0495604_0133557 3300047317 Bacteria 1781
518 Ga0495604_0330367 3300047317 Bacteria 1017
519 Ga0495674_0038537 3300047319 Bacteria 4289
520 Ga0495674_0079875 3300047319 Bacteria 2807
521 Ga0495674_0096764 3300047319 Bacteria 2515
522 Ga0495674_0251848 3300047319 Bacteria 1453
523 Ga0495674_0352521 3300047319 Bacteria 1194
524 Ga0495676_0021123 3300047321 Bacteria 5697
525 Ga0495676_0026482 3300047321 Bacteria 4990
526 Ga0495680_0009470 3300047322 Bacteria 8757
527 Ga0495680_0014938 3300047322 Bacteria 6709
528 Ga0495680_0031301 3300047322 Bacteria 4332
529 Ga0495680_0056122 3300047322 Bacteria 3050
530 Ga0495680_0086429 3300047322 Bacteria 2359
531 Ga0495680_0087818 3300047322 Bacteria 2338
532 Ga0495675_0020297 3300047444 Bacteria 4225
533 Ga0495675_0033072 3300047444 Bacteria 3300
534 Ga0495675_0149974 3300047444 Bacteria 1441
535 Ga0495684_0009176 3300047471 Bacteria 7639
536 Ga0495684_0033793 3300047471 Bacteria 3923
537 Ga0495684_0045902 3300047471 Bacteria 3342
538 Ga0495593_0008781 3300047673 Bacteria 5868
539 Ga0495593_0092713 3300047673 Bacteria 1554
540 Ga0495602_0015981 3300048088 Bacteria 7556
541 Ga0495602_0045464 3300048088 Bacteria 3973
542 Ga0495602_0119482 3300048088 Bacteria 2123
543 Ga0495602_0161370 3300048088 Bacteria 1749
544 Ga0495614_0011790 3300048089 Bacteria 3843
545 Ga0496100_0087654 3300048903 Bacteria 2117
546 Ga0496102_0068769 3300048905 Bacteria 3250
547 Ga0496102_0099687 3300048905 Bacteria 2697
548 Ga0496102_0283351 3300048905 Bacteria 1562
549 Ga0496104_0003101 3300048907 Bacteria 14330
550 Ga0496104_0310144 3300048907 Bacteria 1491
551 Ga0496105_0003287 3300048908 Bacteria 11929
552 Ga0496105_0080770 3300048908 Bacteria 2686
553 Ga0496108_0061623 3300048911 Bacteria 3157
554 Ga0496109_0041059 3300048912 Bacteria 4191
555 Ga0496109_0324014 3300048912 Bacteria 1454
556 Ga0496109_0345440 3300048912 Bacteria 1405
557 Ga0496110_0153725 3300048913 Bacteria 2084
558 Ga0496110_0518152 3300048913 Bacteria 1085
559 Ga0496112_0029997 3300048915 Bacteria 5262
560 Ga0496112_0551224 3300048915 Bacteria 1087
561 Ga0496113_0023731 3300048916 Bacteria 4352
562 Ga0496114_0113395 3300048917 Bacteria 2324
563 Ga0496115_0248004 3300048918 Bacteria 1467
564 Ga0496115_0324721 3300048918 Bacteria 1258
565 Ga0496119_0190984 3300048922 Bacteria 1067
566 Ga0496126_0049758 3300048929 Bacteria 3824
567 Ga0496126_0051744 3300048929 Bacteria 3737
568 Ga0496126_0108006 3300048929 Bacteria 2427
569 Ga0496126_0384763 3300048929 Bacteria 1141
570 Ga0501047_0065251 3300049581 Bacteria 3509
571 nmdc:mga03n38_25062_c1 3300050490 Bacteria 2445
572 nmdc:mga0yw44_32356_c1 3300050492 Bacteria 3047
573 nmdc:mga0yw44_841_c1 3300050492 Bacteria 11464
574 nmdc:mga06z11_13039_c1 3300050494 Bacteria 3635
575 nmdc:mga06z11_54358_c1 3300050494 Bacteria 2063
576 nmdc:mga05p37_162217_c1 3300050507 Bacteria 2729
577 nmdc:mga05p37_2128_c1 3300050507 Bacteria 23129
578 nmdc:mga05p37_67804_c1 3300050507 Bacteria 4389
579 nmdc:mga09592_794_c1 3300050508 Bacteria 24428
580 nmdc:mga0qj67_193_c1 3300050509 Bacteria 41569
581 nmdc:mga0qj67_274332_c1 3300050509 Bacteria 1367
582 nmdc:mga06r32_130149_c1 3300050510 Bacteria 2488
583 nmdc:mga06r32_275_c1 3300050510 Bacteria 42703
584 nmdc:mga06r32_9434_c1 3300050510 Bacteria 8805
585 nmdc:mga08x19_252628_c1 3300050514 Bacteria 1217
586 Ga0495601_0002324 3300053077 Bacteria 10751
587 Ga0495601_0020491 3300053077 Bacteria 4040
588 Ga0495601_0035782 3300053077 Bacteria 3100
589 Ga0495601_0042210 3300053077 Bacteria 2861
590 Ga0495612_0033475 3300053078 Bacteria 2079
591 Ga0495612_0034828 3300053078 Bacteria 2039
592 Ga0495612_0102702 3300053078 Bacteria 1218
593 Ga0495612_0123231 3300053078 Bacteria 1116
594 Ga0495595_0195622 3300053084 Bacteria 1006
595 Ga0495595_0217498 3300053084 Bacteria 953
596 Ga0495619_0003499 3300053085 Bacteria 10122
597 Ga0495619_0021969 3300053085 Bacteria 4079
598 Ga0495619_0406027 3300053085 Bacteria 940
599 Ga0500646_0156992 3300053090 Bacteria 757
600 Ga0466962_0030436 3300061719 Bacteria 2585
601 Ga0070706_100009700
602 Ga0070683_100002983
603 Ga0070683_100013859
604 Ga0070670_100144323
605 Ga0068869_100015222
606 Ga0070680_100286423
607 Ga0070682_100096491
608 Ga0068868_100003947
609 Ga0070660_100024518
610 Ga0070660_100168670
611 Ga0070691_10062691
612 Ga0070692_10125842
613 Ga0070675_100001399
614 Ga0070709_10013875
615 Ga0070709_10019060
616 Ga0070714_100004362
617 Ga0070714_100006105
618 Ga0070714_100013007
619 Ga0070714_100085533
620 Ga0070714_100189799
621 Ga0070714_100355034
622 Ga0070714_100380417
623 Ga0070714_100412932
624 Ga0070714_100452542
625 Ga0070714_100634725
626 Ga0070713_100031599
627 Ga0070713_100033100
628 Ga0070713_100051899
629 Ga0070713_100055833
630 Ga0070713_100301322
631 Ga0070713_100440767
632 Ga0070713_100450637
633 Ga0070710_10001515
634 Ga0070710_10010163
635 Ga0070710_10016665
636 Ga0070710_10130940
637 Ga0070710_10198455
638 Ga0070710_10202651
639 Ga0070711_100005054
640 Ga0070711_100008116
641 Ga0070711_100201733
642 Ga0070711_100262032
643 Ga0070711_100315188
644 Ga0070708_100002694
645 Ga0070708_100010117
646 Ga0070708_100019525
647 Ga0070708_100044666
648 Ga0070708_100068992
649 Ga0070708_100208673
650 Ga0070708_100356928
651 Ga0070708_100471580
652 Ga0070678_100441247
653 Ga0070681_10000044
654 Ga0070681_10013993
655 Ga0070706_100018696
656 Ga0070706_100063303
657 Ga0070706_100331966
658 Ga0070706_100726295
659 Ga0070706_100835894
660 Ga0070707_100006227
661 Ga0070707_100008767
662 Ga0070707_100021431
663 Ga0070707_100259027
664 Ga0070698_100000057
665 Ga0070698_100011175
666 Ga0070698_100034056
667 Ga0070698_100037538
668 Ga0070698_100624839
669 Ga0070699_100001068
670 Ga0070699_100278286
671 Ga0070679_100000022
672 Ga0070679_100013796
673 Ga0070679_100019351
674 Ga0070679_100123616
675 Ga0070684_100266649
676 Ga0070697_100000741
677 Ga0068853_100036208
678 Ga0070665_100021997
679 Ga0068855_100003454
680 Ga0070664_100000450
681 Ga0070664_100198010
682 Ga0070664_100448715
683 Ga0068857_100016669
684 Ga0068857_100140382
685 Ga0068854_100001190
686 Ga0068854_100320329
687 Ga0068856_100197009
688 Ga0068856_100278607
689 Ga0068856_100660586
690 Ga0068852_100002473
691 Ga0068864_100177421
692 Ga0068870_10067202
693 Ga0068860_100396310
694 Ga0068862_100386906
695 Ga0081540_1000082
696 Ga0081540_1001248
697 Ga0081539_10001834
698 Ga0081539_10004674
699 Ga0081539_10020066
700 Ga0070717_10007222
701 Ga0070717_10015698
702 Ga0070717_10039381
703 Ga0070717_10042197
704 Ga0070717_10048210
705 Ga0070717_10062140
706 Ga0070717_10078676
707 Ga0075365_10040272
708 Ga0075365_10110954
709 Ga0075363_100048110
710 Ga0075364_10000298
711 Ga0070715_10007805
712 Ga0070715_10008936
713 Ga0070715_10024858
714 Ga0070716_100002385
715 Ga0070716_100011611
716 Ga0070716_100018856
717 Ga0070716_100094229
718 Ga0070716_100123472
719 Ga0070712_100004955
720 Ga0070712_100020491
721 Ga0070712_100174748
722 Ga0070712_100188662
723 Ga0070712_100213093
724 Ga0070712_100534026
725 Ga0075367_10021947
726 Ga0075367_10073263
727 Ga0097621_100069883
728 Ga0075430_100001812
729 Ga0075430_100008120
730 Ga0075430_100400092
731 Ga0075431_100001436
732 Ga0075431_100058489
733 Ga0075434_100200423
734 Ga0075434_100363363
735 Ga0075429_100000244
736 Ga0075429_100051876
737 Ga0099795_10179145
738 Ga0105240_10007061
739 Ga0105240_10402027
740 Ga0111539_10005195
741 Ga0105245_10004765
742 Ga0105245_10079091
743 Ga0114129_10000723
744 Ga0114129_10046266
745 Ga0105241_10003881
746 Ga0105241_10553920
747 Ga0105237_10009613
748 Ga0105237_10405936
749 Ga0105237_10419209
750 Ga0105238_10041172
751 Ga0105238_10714937
752 Ga0105249_10147207
753 Ga0105239_10044471
754 Ga0105239_10917062
755 Ga0157370_10198113
756 Ga0157370_10228017
757 Ga0157370_10277515
758 Ga0157369_10041167
759 Ga0157369_10631564
760 Ga0157369_10672213
761 Ga0157374_10069527
762 Ga0157372_10340327
763 Ga0157372_10623328
764 Ga0157375_10163852
765 Ga0163163_10320805
766 Ga0157379_10645467
767 Ga0197907_10931930
768 Ga0197907_11161104
769 Ga0206356_11080520
770 Ga0206356_11585391
771 Ga0206351_10081016
772 Ga0206351_10378242
773 Ga0206352_11091526
774 Ga0206350_11267928
775 Ga0206354_11706882
776 Ga0206353_10283825
777 Ga0206353_10385475
778 Ga0213875_10000133
779 Ga0213875_10000906
780 Ga0213875_10005816
781 Ga0213875_10069633
782 Ga0224712_10007303
783 Ga0224712_10008936
784 Ga0207692_10001689
785 Ga0207692_10024822
786 Ga0207692_10102120
787 Ga0207642_10225986
788 Ga0207647_10003099
789 Ga0207685_10032776
790 Ga0207685_10080032
791 Ga0207699_10000350
792 Ga0207699_10007717
793 Ga0207699_10009114
794 Ga0207699_10130000
795 Ga0207699_10264468
796 Ga0207645_10067388
797 Ga0207643_10030196
798 Ga0207684_10037716
799 Ga0207684_10042747
800 Ga0207684_10054060
801 Ga0207684_10126049
802 Ga0207684_10464136
803 Ga0207654_10002031
804 Ga0207707_10000041
805 Ga0207707_10002673
806 Ga0207695_10000796
807 Ga0207671_10000188
808 Ga0207693_10008037
809 Ga0207693_10011030
810 Ga0207693_10014000
811 Ga0207693_10031130
812 Ga0207693_10036403
813 Ga0207693_10045320
814 Ga0207693_10067360
815 Ga0207693_10172042
816 Ga0207693_10198922
817 Ga0207663_10001697
818 Ga0207663_10019381
819 Ga0207663_10043435
820 Ga0207663_10080667
821 Ga0207663_10123043
822 Ga0207663_10143082
823 Ga0207663_10458738
824 Ga0207660_10000628
825 Ga0207657_10035633
826 Ga0207657_10035923
827 Ga0207652_10000533
828 Ga0207652_10029997
829 Ga0207652_10073827
830 Ga0207646_10010574
831 Ga0207646_10013664
832 Ga0207646_10024588
833 Ga0207646_10036315
834 Ga0207646_10301862
835 Ga0207694_10000164
836 Ga0207650_10101867
837 Ga0207659_10072654
838 Ga0207687_10038914
839 Ga0207687_10290787
840 Ga0207700_10000221
841 Ga0207700_10002376
842 Ga0207700_10002489
843 Ga0207700_10072997
844 Ga0207700_10085635
845 Ga0207700_10099454
846 Ga0207700_10178675
847 Ga0207700_10241620
848 Ga0207664_10000439
849 Ga0207664_10008435
850 Ga0207664_10026771
851 Ga0207664_10028259
852 Ga0207664_10039262
853 Ga0207664_10148309
854 Ga0207664_10291786
855 Ga0207664_10329026
856 Ga0207664_10462044
857 Ga0207690_10049698
858 Ga0207665_10001848
859 Ga0207665_10002114
860 Ga0207665_10005805
861 Ga0207665_10057583
862 Ga0207665_10145125
863 Ga0207665_10311187
864 Ga0207689_10005109
865 Ga0207661_10124977
866 Ga0207661_10500216
867 Ga0207679_10006352
868 Ga0207679_10148697
869 Ga0207667_10012835
870 Ga0207712_10314341
871 Ga0207640_10328453
872 Ga0207677_10339082
873 Ga0207677_10425325
874 Ga0207639_10042170
875 Ga0207678_10020259
876 Ga0207678_10022277
877 Ga0207678_10027679
878 Ga0207678_10376643
879 Ga0207702_10023626
880 Ga0207702_10167787
881 Ga0207702_10593916
882 Ga0207641_10054858
883 Ga0207674_10005875
884 Ga0207674_10158202
885 Ga0207675_100061814
886 Ga0207683_10049666
887 Ga0207698_10003604
888 Ga0207428_10014135
889 Ga0268266_10037282
890 Ga0268266_10194616
891 Ga0268265_10316997
892 Ga0265337_1000446
893 Ga0265326_10004078
894 Ga0265319_1000384
895 Ga0265334_10000656
896 Ga0265323_10001803
897 Ga0265322_10002612
898 Ga0265336_10002411
899 Ga0265336_10007370
900 Ga0307515_10000027
901 Ga0265338_10000175
902 Ga0265338_10016444
903 Ga0265324_10002832
904 Ga0265763_1002154
905 Ga0265763_1004501
906 Ga0265760_10010877
907 Ga0265332_10017952
908 Ga0265320_10004241
909 Ga0265325_10007028
910 Ga0265340_10010731
911 Ga0265316_10083607
912 Ga0307513_10042996
913 Ga0307513_10049545
914 Ga0307509_10037641
915 Ga0307509_10047503
916 Ga0307509_10069969
917 Ga0307408_100059097
918 Ga0307408_100344690
919 Ga0307508_10193851
920 Ga0265314_10054516
921 Ga0265342_10004867
922 Ga0307516_10000946
923 Ga0307405_10037388
924 Ga0307406_10074329
925 Ga0307406_10193839
926 Ga0307407_10245320
927 Ga0307409_100333108
928 Ga0307416_100068364
929 Ga0307415_100102722
930 Ga0307507_10000001
931 Ga0316214_1000546
932 Ga0316212_1000872
933 Ga0373926_0003300
934 Ga0373934_0124765
935 Ga0373940_0017382
936 Ga0373944_0000796
937 Ga0373944_0002776
938 Ga0373923_0084966
939 Ga0373923_0187762
940 Ga0373936_0001461
941 Ga0373936_0005054
942 Ga0373936_0036874
943 Ga0373945_0000495
944 Ga0373945_0000624
945 Ga0373953_0007390
946 Ga0373953_0063959
947 Ga0373954_0064258
948 Ga0373956_0010856
949 Ga0373957_0010915
950 Ga0373957_0016551
951 Ga0373960_0149509
952 Ga0373946_0001477
953 Ga0373955_0011865
954 Ga0373955_0013531
955 Ga0373955_0176161
956 Ga0373955_0212739
957 Ga0373924_0088979
958 Ga0373924_0152349
959 Ga0373924_0192571
960 Ga0373935_0004952
961 Ga0373935_0111987
962 Ga0373935_0323718
963 Ga0373927_0020630
964 Ga0373927_0055858
965 Ga0373933_0014091
966 Ga0373933_0022183
967 Ga0373933_0036396
968 Ga0373933_0057558
969 Ga0373933_0092322
970 Ga0373947_0025975
971 Ga0373947_0112279
972 Ga0373937_0019793
973 Ga0373937_0053858
974 Ga0373937_0132931
975 Ga0373937_0349023
976 Ga0373937_0739610
977 Ga0316582_0471041
978 Ga0373925_0000033
979 Ga0373925_0000872
980 Ga0373925_0517318
981 Ga0436364_0335518
982 Ga0436364_0633838
983 Ga0436364_0699238
984 Ga0436364_0972777
985 Ga0436364_1048956
986 Ga0436364_1232097
987 Ga0436364_1239878
988 Ga0436361_0063923
989 Ga0436363_0518648
990 Ga0436363_1016555
991 Ga0466966_0009840
992 Ga0466961_0014742
993 Ga0466961_0038635
994 Ga0466963_0021698
995 Ga0466963_0052483
996 Ga0466963_0203500
997 Ga0466971_0081825
998 Ga0466970_0024984
999 Ga0466959_0008388
1000 Ga0466958_0259791
1001 Ga0466967_0089726
1002 Ga0495592_0136218
1003 Ga0495592_0138765
1004 Ga0495592_0160130
1005 Ga0495592_0168585
1006 Ga0495592_0309560
1007 Ga0495629_0054425
1008 Ga0495629_0260103
1009 Ga0495641_0001394
1010 Ga0495641_0046056
1011 Ga0495651_0008725
1012 Ga0495651_0026531
1013 Ga0495651_0040855
1014 Ga0495651_0040882
1015 Ga0495651_0065099
1016 Ga0495651_0518735
1017 Ga0495653_0003695
1018 Ga0495653_0031185
1019 Ga0495653_0044845
1020 Ga0495653_0054675
1021 Ga0495653_0146134
1022 Ga0495639_0008353
1023 Ga0495662_0017513
1024 Ga0495662_0231461
1025 Ga0495664_0004488
1026 Ga0495664_0005575
1027 Ga0495664_0009847
1028 Ga0495664_0073080
1029 Ga0495664_0094004
1030 Ga0495594_0011621
1031 Ga0495608_0005470
1032 Ga0495608_0009742
1033 Ga0495608_0029441
1034 Ga0495608_0084378
1035 Ga0495618_0030116
1036 Ga0495618_0034515
1037 Ga0495618_0099631
1038 Ga0495618_0133627
1039 Ga0495628_0018615
1040 Ga0495628_0057352
1041 Ga0495628_0152522
1042 Ga0495628_0358029
1043 Ga0495630_0017176
1044 Ga0495630_0378098
1045 Ga0495666_0007081
1046 Ga0495666_0085488
1047 Ga0495652_0001307
1048 Ga0495652_0009794
1049 Ga0495652_0013169
1050 Ga0495652_0049915
1051 Ga0495652_0068639
1052 Ga0495652_0394385
1053 Ga0495652_0408658
1054 Ga0495665_0002508
1055 Ga0495665_0119191
1056 Ga0495640_0003592
1057 Ga0495640_0024076
1058 Ga0495640_0280860
1059 Ga0495586_0001455
1060 Ga0495586_0107258
1061 Ga0495587_0011734
1062 Ga0495587_0036329
1063 Ga0495587_0037617
1064 Ga0495587_0082607
1065 Ga0495587_0094318
1066 Ga0495587_0116850
1067 Ga0495645_0013094
1068 Ga0495645_0016390
1069 Ga0495645_0021802
1070 Ga0495645_0118775
1071 Ga0495622_0109082
1072 Ga0495667_0005542
1073 Ga0495667_0008452
1074 Ga0495667_0050438
1075 Ga0495667_0061288
1076 Ga0495667_0098394
1077 Ga0495634_0004547
1078 Ga0495634_0052680
1079 Ga0495634_0110245
1080 Ga0495634_0180333
1081 Ga0495635_0002349
1082 Ga0495635_0003410
1083 Ga0495635_0007622
1084 Ga0495635_0025915
1085 Ga0495588_0027144
1086 Ga0495657_0013444
1087 Ga0495657_0014354
1088 Ga0495657_0024665
1089 Ga0495657_0094565
1090 Ga0495657_0150488
1091 Ga0495657_0365253
1092 Ga0495599_0008048
1093 Ga0495599_0105639
1094 Ga0495599_0119814
1095 Ga0495599_0123408
1096 Ga0495599_0163681
1097 Ga0495599_0163888
1098 Ga0495623_0030092
1099 Ga0495646_0008820
1100 Ga0495646_0042025
1101 Ga0495646_0261509
1102 Ga0495647_0001380
1103 Ga0495658_0008607
1104 Ga0495613_0019382
1105 Ga0495624_0002654
1106 Ga0495624_0083475
1107 Ga0495600_0002469
1108 Ga0495600_0003021
1109 Ga0495600_0071069
1110 Ga0495600_0115522
1111 Ga0495600_0305352
1112 Ga0495581_0004259
1113 Ga0495581_0053098
1114 Ga0495581_0172695
1115 Ga0495604_0010560
1116 Ga0495604_0104278
1117 Ga0495604_0133557
1118 Ga0495604_0330367
1119 Ga0495674_0038537
1120 Ga0495674_0079875
1121 Ga0495674_0096764
1122 Ga0495674_0251848
1123 Ga0495674_0352521
1124 Ga0495676_0021123
1125 Ga0495676_0026482
1126 Ga0495680_0009470
1127 Ga0495680_0014938
1128 Ga0495680_0031301
1129 Ga0495680_0056122
1130 Ga0495680_0086429
1131 Ga0495680_0087818
1132 Ga0495675_0020297
1133 Ga0495675_0033072
1134 Ga0495675_0149974
1135 Ga0495684_0009176
1136 Ga0495684_0033793
1137 Ga0495684_0045902
1138 Ga0495593_0008781
1139 Ga0495593_0092713
1140 Ga0495602_0015981
1141 Ga0495602_0045464
1142 Ga0495602_0119482
1143 Ga0495602_0161370
1144 Ga0495614_0011790
1145 Ga0496100_0087654
1146 Ga0496102_0068769
1147 Ga0496102_0099687
1148 Ga0496102_0283351
1149 Ga0496104_0003101
1150 Ga0496104_0310144
1151 Ga0496105_0003287
1152 Ga0496105_0080770
1153 Ga0496108_0061623
1154 Ga0496109_0041059
1155 Ga0496109_0324014
1156 Ga0496109_0345440
1157 Ga0496110_0153725
1158 Ga0496110_0518152
1159 Ga0496112_0029997
1160 Ga0496112_0551224
1161 Ga0496113_0023731
1162 Ga0496114_0113395
1163 Ga0496115_0248004
1164 Ga0496115_0324721
1165 Ga0496119_0190984
1166 Ga0496126_0049758
1167 Ga0496126_0051744
1168 Ga0496126_0108006
1169 Ga0496126_0384763
1170 Ga0501047_0065251
1171 nmdc:mga03n38_25062_c1
1172 nmdc:mga0yw44_32356_c1
1173 nmdc:mga0yw44_841_c1
1174 nmdc:mga06z11_13039_c1
1175 nmdc:mga06z11_54358_c1
1176 nmdc:mga05p37_162217_c1
1177 nmdc:mga05p37_2128_c1
1178 nmdc:mga05p37_67804_c1
1179 nmdc:mga09592_794_c1
1180 nmdc:mga0qj67_193_c1
1181 nmdc:mga0qj67_274332_c1
1182 nmdc:mga06r32_130149_c1
1183 nmdc:mga06r32_275_c1
1184 nmdc:mga06r32_9434_c1
1185 nmdc:mga08x19_252628_c1
1186 Ga0495601_0002324
1187 Ga0495601_0020491
1188 Ga0495601_0035782
1189 Ga0495601_0042210
1190 Ga0495612_0033475
1191 Ga0495612_0034828
1192 Ga0495612_0102702
1193 Ga0495612_0123231
1194 Ga0495595_0195622
1195 Ga0495595_0217498
1196 Ga0495619_0003499
1197 Ga0495619_0021969
1198 Ga0495619_0406027
1199 Ga0500646_0156992
1200 Ga0466962_0030436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

24

189

0.93

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

21

189

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ckq-assembly1.cif.gz_A-2 crystal structure of a mycobacterial protein 0.723 7 231
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.717 7 229
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7146 2 233
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.7077 7 230
2bo7-assembly2.cif.gz_F dissection of mannosylglycerate synthase: an archetypal mannosyltransferase 0.7067 11 231
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8078 10 230 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7873 8 229 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7855 10 230 3.90.550.10
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7831 7 234 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7734 9 229 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A840AX79-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9205 8 117 GO:0004582
GO:0009247
GO:0016020
AF-F7S7D9-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.8949 7 113 GO:0004582
GO:0009247
GO:0016020
AF-A0A1X7MIX0-F1-model_v4 deleted 0.8875 5 106
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.8815 8 105 GO:0005886
GO:0016757
AF-A0A6I3HNA5-F1-model_v4 Glycosyltransferase 0.876 8 239 GO:0016757

Map