F467912
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 599 | 297 | 586 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300048904|Ga0496101_0067094|Ga0496101_0067094_1151_1897 |
| Length | 248 |
| Sequence | MKSSTSSPARAEAEAAPAAENSPRPLDLPPRFAPRAAMASDTLHRRGLMFILSSPSGAGKTTIARRLLAEDREIAMSVSATTRPMRPGEVEGKDYHFVSQPEFDRMVEANEFYEWAHVFGHSYGTPKSHIRAALKDGQDFLFDIDWQGTQQLYQKAERDVVRVFILPPSLDELQRRLVGRGTDSAEIIAARMARAQAEISHWDGYDYVVVNDDVEACFGKVREILAAERMRRTRQTGLIDFVRELTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 5 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 6 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 7 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 8 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 11 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 12 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 13 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 14 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 192 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 202 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 203 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 204 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 205 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 237 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 238 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 239 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 276 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 280 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 282 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 284 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 294 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 295 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 296 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.33 |
| Metatranscriptomes | 0.5 |
| Isolates | 2.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.19 |
| Nodule | 0.33 |
| Rhizoplane | 3.51 |
| Rhizosphere | 74.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006349 | 3300000549 | Bacteria | 1474 |
| 2 | JGI24740J21852_10076201 | 3300001979 | Bacteria | 887 |
| 3 | JGI24739J22299_10061409 | 3300001989 | Bacteria | 1187 |
| 4 | JGI24034J26672_10028901 | 3300002239 | Bacteria | 896 |
| 5 | JGI24034J26672_10039392 | 3300002239 | Bacteria | 790 |
| 6 | JGI24751J29686_10000154 | 3300002459 | Bacteria | 32923 |
| 7 | Ga0055536_1006407 | 3300003781 | Bacteria | 5506 |
| 8 | Ga0055534_1003173 | 3300003784 | Bacteria | 5317 |
| 9 | Ga0055530_10000710 | 3300003791 | Bacteria | 28052 |
| 10 | Ga0055531_10000900 | 3300003794 | Bacteria | 24231 |
| 11 | Ga0055531_10009818 | 3300003794 | Bacteria | 4849 |
| 12 | Ga0065707_10096811 | 3300005295 | Bacteria | 3231 |
| 13 | Ga0070658_10000068 | 3300005327 | Bacteria | 102788 |
| 14 | Ga0070658_10026423 | 3300005327 | Bacteria | 4657 |
| 15 | Ga0070658_10123341 | 3300005327 | Bacteria | 2154 |
| 16 | Ga0070658_10313043 | 3300005327 | Bacteria | 1340 |
| 17 | Ga0070658_10508661 | 3300005327 | Bacteria | 1041 |
| 18 | Ga0070683_100244796 | 3300005329 | Bacteria | 1705 |
| 19 | Ga0070683_100405324 | 3300005329 | Bacteria | 1300 |
| 20 | Ga0070690_100022470 | 3300005330 | Bacteria | 3859 |
| 21 | Ga0070670_100041862 | 3300005331 | Bacteria | 3937 |
| 22 | Ga0070670_100407414 | 3300005331 | Bacteria | 1201 |
| 23 | Ga0070677_10268384 | 3300005333 | Bacteria | 855 |
| 24 | Ga0070666_10037423 | 3300005335 | Bacteria | 3226 |
| 25 | Ga0070666_10136157 | 3300005335 | Bacteria | 1709 |
| 26 | Ga0070680_100001399 | 3300005336 | Bacteria | 17424 |
| 27 | Ga0070680_100001683 | 3300005336 | Bacteria | 16198 |
| 28 | Ga0070682_100027871 | 3300005337 | Bacteria | 3393 |
| 29 | Ga0068868_100000184 | 3300005338 | Bacteria | 41969 |
| 30 | Ga0070660_100001498 | 3300005339 | Bacteria | 15998 |
| 31 | Ga0070660_100002033 | 3300005339 | Bacteria | 13954 |
| 32 | Ga0070660_100003201 | 3300005339 | Bacteria | 11252 |
| 33 | Ga0070660_100065395 | 3300005339 | Bacteria | 2830 |
| 34 | Ga0070661_100000009 | 3300005344 | Bacteria | 181351 |
| 35 | Ga0070661_100001882 | 3300005344 | Bacteria | 14532 |
| 36 | Ga0070661_100105137 | 3300005344 | Bacteria | 2104 |
| 37 | Ga0070692_10094346 | 3300005345 | Bacteria | 1631 |
| 38 | Ga0070668_100000048 | 3300005347 | Bacteria | 75276 |
| 39 | Ga0070668_100134495 | 3300005347 | Bacteria | 1987 |
| 40 | Ga0070668_100180957 | 3300005347 | Bacteria | 1722 |
| 41 | Ga0070668_100238134 | 3300005347 | Bacteria | 1506 |
| 42 | Ga0070668_100849010 | 3300005347 | Bacteria | 814 |
| 43 | Ga0070669_100000472 | 3300005353 | Bacteria | 30562 |
| 44 | Ga0070669_100691377 | 3300005353 | Bacteria | 861 |
| 45 | Ga0070675_100007629 | 3300005354 | Bacteria | 8371 |
| 46 | Ga0070671_100000067 | 3300005355 | Bacteria | 70750 |
| 47 | Ga0070671_100000532 | 3300005355 | Bacteria | 26743 |
| 48 | Ga0070671_100004246 | 3300005355 | Bacteria | 11342 |
| 49 | Ga0070659_100000009 | 3300005366 | Bacteria | 203891 |
| 50 | Ga0070659_100000979 | 3300005366 | Bacteria | 20993 |
| 51 | Ga0070659_100002377 | 3300005366 | Bacteria | 13375 |
| 52 | Ga0070659_100004263 | 3300005366 | Bacteria | 10207 |
| 53 | Ga0070659_100077995 | 3300005366 | Bacteria | 2643 |
| 54 | Ga0070659_100138493 | 3300005366 | Bacteria | 1980 |
| 55 | Ga0070667_100000167 | 3300005367 | Bacteria | 82055 |
| 56 | Ga0070667_100003664 | 3300005367 | Bacteria | 13079 |
| 57 | Ga0070667_100018045 | 3300005367 | Bacteria | 5848 |
| 58 | Ga0070663_100016991 | 3300005455 | Bacteria | 4738 |
| 59 | Ga0070663_100025285 | 3300005455 | Bacteria | 4006 |
| 60 | Ga0070678_100469301 | 3300005456 | Bacteria | 1105 |
| 61 | Ga0070662_100001446 | 3300005457 | Bacteria | 14637 |
| 62 | Ga0070662_100003248 | 3300005457 | Bacteria | 10110 |
| 63 | Ga0070662_100248859 | 3300005457 | Bacteria | 1428 |
| 64 | Ga0070681_10008385 | 3300005458 | Bacteria | 10120 |
| 65 | Ga0070681_10720379 | 3300005458 | Bacteria | 914 |
| 66 | Ga0070706_100330670 | 3300005467 | Bacteria | 1421 |
| 67 | Ga0070679_100000031 | 3300005530 | Bacteria | 107526 |
| 68 | Ga0070679_100005037 | 3300005530 | Bacteria | 12195 |
| 69 | Ga0070679_100033039 | 3300005530 | Bacteria | 5120 |
| 70 | Ga0070679_100230721 | 3300005530 | Bacteria | 1811 |
| 71 | Ga0070679_100859258 | 3300005530 | Bacteria | 851 |
| 72 | Ga0070684_100007437 | 3300005535 | Bacteria | 8514 |
| 73 | Ga0070684_100404689 | 3300005535 | Bacteria | 1258 |
| 74 | Ga0068853_100002549 | 3300005539 | Bacteria | 13684 |
| 75 | Ga0068853_100157427 | 3300005539 | Bacteria | 2047 |
| 76 | Ga0068853_100286382 | 3300005539 | Bacteria | 1520 |
| 77 | Ga0070686_100001770 | 3300005544 | Bacteria | 12065 |
| 78 | Ga0070686_100011498 | 3300005544 | Bacteria | 5021 |
| 79 | Ga0070665_100000145 | 3300005548 | Bacteria | 131599 |
| 80 | Ga0070665_100000541 | 3300005548 | Bacteria | 53057 |
| 81 | Ga0070665_100007174 | 3300005548 | Bacteria | 11332 |
| 82 | Ga0070665_100088206 | 3300005548 | Bacteria | 3108 |
| 83 | Ga0070665_100115291 | 3300005548 | Bacteria | 2689 |
| 84 | Ga0068855_100018885 | 3300005563 | Bacteria | 8287 |
| 85 | Ga0068855_100034692 | 3300005563 | Bacteria | 6013 |
| 86 | Ga0068855_100057353 | 3300005563 | Bacteria | 4565 |
| 87 | Ga0068855_100061409 | 3300005563 | Bacteria | 4391 |
| 88 | Ga0068855_100064206 | 3300005563 | Bacteria | 4282 |
| 89 | Ga0068855_100135070 | 3300005563 | Bacteria | 2815 |
| 90 | Ga0068855_100287646 | 3300005563 | Bacteria | 1823 |
| 91 | Ga0070664_100029564 | 3300005564 | Bacteria | 4568 |
| 92 | Ga0070664_100119757 | 3300005564 | Bacteria | 2304 |
| 93 | Ga0070664_100446009 | 3300005564 | Bacteria | 1188 |
| 94 | Ga0068857_100106632 | 3300005577 | Bacteria | 2516 |
| 95 | Ga0068857_100431439 | 3300005577 | Bacteria | 1230 |
| 96 | Ga0068857_100454158 | 3300005577 | Bacteria | 1198 |
| 97 | Ga0068857_100489168 | 3300005577 | Bacteria | 1154 |
| 98 | Ga0068857_100966506 | 3300005577 | Bacteria | 819 |
| 99 | Ga0068854_100009343 | 3300005578 | Bacteria | 6330 |
| 100 | Ga0068856_100007324 | 3300005614 | Bacteria | 10770 |
| 101 | Ga0068856_100007858 | 3300005614 | Bacteria | 10417 |
| 102 | Ga0068852_100000358 | 3300005616 | Bacteria | 30765 |
| 103 | Ga0068852_100041790 | 3300005616 | Bacteria | 3877 |
| 104 | Ga0068852_100127539 | 3300005616 | Bacteria | 2339 |
| 105 | Ga0068852_100224005 | 3300005616 | Bacteria | 1790 |
| 106 | Ga0068859_100003997 | 3300005617 | Bacteria | 15032 |
| 107 | Ga0068859_100058571 | 3300005617 | Bacteria | 3880 |
| 108 | Ga0068859_100242513 | 3300005617 | Bacteria | 1892 |
| 109 | Ga0068859_100250968 | 3300005617 | Bacteria | 1860 |
| 110 | Ga0068864_100033644 | 3300005618 | Bacteria | 4359 |
| 111 | Ga0068864_100141990 | 3300005618 | Bacteria | 2167 |
| 112 | Ga0068861_100495016 | 3300005719 | Bacteria | 1104 |
| 113 | Ga0068851_10228520 | 3300005834 | Bacteria | 1048 |
| 114 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 115 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 116 | Ga0068863_100395774 | 3300005841 | Bacteria | 1350 |
| 117 | Ga0068858_100000771 | 3300005842 | Bacteria | 33416 |
| 118 | Ga0068858_100001121 | 3300005842 | Bacteria | 27733 |
| 119 | Ga0068858_100074898 | 3300005842 | Bacteria | 3143 |
| 120 | Ga0068858_100090543 | 3300005842 | Bacteria | 2847 |
| 121 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 122 | Ga0068860_100076723 | 3300005843 | Bacteria | 3178 |
| 123 | Ga0068860_100101357 | 3300005843 | Bacteria | 2747 |
| 124 | Ga0068860_100111640 | 3300005843 | Bacteria | 2614 |
| 125 | Ga0068862_100025994 | 3300005844 | Bacteria | 4919 |
| 126 | Ga0068862_100065022 | 3300005844 | Bacteria | 3141 |
| 127 | Ga0068862_100182342 | 3300005844 | Bacteria | 1885 |
| 128 | Ga0081538_10125636 | 3300005981 | Bacteria | 1220 |
| 129 | Ga0081539_10031210 | 3300005985 | Bacteria | 3289 |
| 130 | Ga0075368_10000154 | 3300006042 | Bacteria | 18483 |
| 131 | Ga0075363_100006123 | 3300006048 | Bacteria | 5432 |
| 132 | Ga0075364_10035300 | 3300006051 | Bacteria | 3231 |
| 133 | Ga0075364_10114330 | 3300006051 | Bacteria | 1803 |
| 134 | Ga0075432_10010664 | 3300006058 | Bacteria | 3123 |
| 135 | Ga0075362_10000011 | 3300006177 | Bacteria | 108953 |
| 136 | Ga0075362_10004729 | 3300006177 | Bacteria | 4917 |
| 137 | Ga0075367_10433997 | 3300006178 | Bacteria | 832 |
| 138 | Ga0075369_10058793 | 3300006186 | Bacteria | 1674 |
| 139 | Ga0075369_10065933 | 3300006186 | Bacteria | 1587 |
| 140 | Ga0075366_10000190 | 3300006195 | Bacteria | 27138 |
| 141 | Ga0075366_10017228 | 3300006195 | Bacteria | 4156 |
| 142 | Ga0075366_10086040 | 3300006195 | Bacteria | 1881 |
| 143 | Ga0075370_10000004 | 3300006353 | Bacteria | 121166 |
| 144 | Ga0075430_100490504 | 3300006846 | Bacteria | 1014 |
| 145 | Ga0075431_100000392 | 3300006847 | Bacteria | 35161 |
| 146 | Ga0075429_100045313 | 3300006880 | Bacteria | 3826 |
| 147 | Ga0097620_100003997 | 3300006931 | Bacteria | 15032 |
| 148 | Ga0097620_100058572 | 3300006931 | Bacteria | 3880 |
| 149 | Ga0097620_100242491 | 3300006931 | Bacteria | 1892 |
| 150 | Ga0097620_100250968 | 3300006931 | Bacteria | 1860 |
| 151 | Ga0079104_1020081 | 3300006946 | Bacteria | 1851 |
| 152 | Ga0105240_10002141 | 3300009093 | Bacteria | 32242 |
| 153 | Ga0111539_10360572 | 3300009094 | Bacteria | 1692 |
| 154 | Ga0105243_10249271 | 3300009148 | Bacteria | 1584 |
| 155 | Ga0105241_10042269 | 3300009174 | Bacteria | 3447 |
| 156 | Ga0105248_10027636 | 3300009177 | Bacteria | 6319 |
| 157 | Ga0105248_10080346 | 3300009177 | Bacteria | 3665 |
| 158 | Ga0105248_10096944 | 3300009177 | Bacteria | 3322 |
| 159 | Ga0105248_10191968 | 3300009177 | Bacteria | 2301 |
| 160 | Ga0105237_10202735 | 3300009545 | Bacteria | 1984 |
| 161 | Ga0105238_10010117 | 3300009551 | Bacteria | 9456 |
| 162 | Ga0105238_10462754 | 3300009551 | Bacteria | 1266 |
| 163 | Ga0105249_10046691 | 3300009553 | Bacteria | 3942 |
| 164 | Ga0105249_10101016 | 3300009553 | Bacteria | 2713 |
| 165 | Ga0105246_10000137 | 3300011119 | Bacteria | 34064 |
| 166 | Ga0157373_10002927 | 3300013100 | Bacteria | 12934 |
| 167 | Ga0157373_10004669 | 3300013100 | Bacteria | 10305 |
| 168 | Ga0157373_10039391 | 3300013100 | Bacteria | 3384 |
| 169 | Ga0157373_10121063 | 3300013100 | Bacteria | 1839 |
| 170 | Ga0157373_10280455 | 3300013100 | Bacteria | 1181 |
| 171 | Ga0157371_10009329 | 3300013102 | Bacteria | 7734 |
| 172 | Ga0157371_10052635 | 3300013102 | Bacteria | 2891 |
| 173 | Ga0157371_10090878 | 3300013102 | Bacteria | 2162 |
| 174 | Ga0157371_10149686 | 3300013102 | Bacteria | 1664 |
| 175 | Ga0157370_10016607 | 3300013104 | Bacteria | 7448 |
| 176 | Ga0157369_10001072 | 3300013105 | Bacteria | 34302 |
| 177 | Ga0157369_10005499 | 3300013105 | Bacteria | 14721 |
| 178 | Ga0157369_10451425 | 3300013105 | Bacteria | 1331 |
| 179 | Ga0163162_10021427 | 3300013306 | Bacteria | 6365 |
| 180 | Ga0163162_10191791 | 3300013306 | Bacteria | 2171 |
| 181 | Ga0157372_10004382 | 3300013307 | Bacteria | 15061 |
| 182 | Ga0157372_10395557 | 3300013307 | Bacteria | 1610 |
| 183 | Ga0157372_10771293 | 3300013307 | Bacteria | 1118 |
| 184 | Ga0157375_10784652 | 3300013308 | Bacteria | 1102 |
| 185 | Ga0157375_10885116 | 3300013308 | Bacteria | 1038 |
| 186 | Ga0163163_10446799 | 3300014325 | Bacteria | 1353 |
| 187 | Ga0163163_10469272 | 3300014325 | Bacteria | 1319 |
| 188 | Ga0163163_10601791 | 3300014325 | Bacteria | 1162 |
| 189 | Ga0157380_10091084 | 3300014326 | Bacteria | 2517 |
| 190 | Ga0157380_10106324 | 3300014326 | Bacteria | 2348 |
| 191 | Ga0157379_10089128 | 3300014968 | Bacteria | 2767 |
| 192 | Ga0163161_10241234 | 3300017792 | Bacteria | 1406 |
| 193 | Ga0206356_11230827 | 3300020070 | Bacteria | 1978 |
| 194 | Ga0206354_11303983 | 3300020081 | Bacteria | 3470 |
| 195 | Ga0206353_11106162 | 3300020082 | Bacteria | 4265 |
| 196 | Ga0213873_10000065 | 3300021358 | Bacteria | 23450 |
| 197 | Ga0213874_10018530 | 3300021377 | Bacteria | 1883 |
| 198 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 199 | Ga0213876_10000134 | 3300021384 | Bacteria | 80875 |
| 200 | Ga0213876_10005473 | 3300021384 | Bacteria | 6973 |
| 201 | Ga0213876_10016540 | 3300021384 | Bacteria | 3899 |
| 202 | Ga0213876_10099446 | 3300021384 | Bacteria | 1542 |
| 203 | Ga0213876_10169798 | 3300021384 | Bacteria | 1160 |
| 204 | Ga0209675_1001522 | 3300025291 | Bacteria | 13230 |
| 205 | Ga0209676_1000273 | 3300025292 | Bacteria | 107724 |
| 206 | Ga0209676_1000402 | 3300025292 | Bacteria | 78796 |
| 207 | Ga0209676_1000667 | 3300025292 | Bacteria | 49009 |
| 208 | Ga0209676_1031770 | 3300025292 | Bacteria | 1595 |
| 209 | Ga0209025_1023201 | 3300025294 | Bacteria | 3253 |
| 210 | Ga0209050_1000637 | 3300025298 | Bacteria | 54380 |
| 211 | Ga0209050_1001280 | 3300025298 | Bacteria | 28715 |
| 212 | Ga0209050_1003693 | 3300025298 | Bacteria | 11029 |
| 213 | Ga0209257_1000248 | 3300025304 | Bacteria | 125170 |
| 214 | Ga0209257_1000435 | 3300025304 | Bacteria | 80311 |
| 215 | Ga0209257_1038844 | 3300025304 | Bacteria | 1437 |
| 216 | Ga0207697_10046240 | 3300025315 | Bacteria | 1792 |
| 217 | Ga0207656_10219507 | 3300025321 | Bacteria | 924 |
| 218 | Ga0207656_10230892 | 3300025321 | Bacteria | 902 |
| 219 | Ga0207682_10000110 | 3300025893 | Bacteria | 37556 |
| 220 | Ga0207647_10006567 | 3300025904 | Bacteria | 8449 |
| 221 | Ga0207647_10316020 | 3300025904 | Bacteria | 887 |
| 222 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 223 | Ga0207705_10000124 | 3300025909 | Bacteria | 85292 |
| 224 | Ga0207705_10007000 | 3300025909 | Bacteria | 8322 |
| 225 | Ga0207705_10015958 | 3300025909 | Bacteria | 5392 |
| 226 | Ga0207705_10261651 | 3300025909 | Bacteria | 1321 |
| 227 | Ga0207705_10322186 | 3300025909 | Bacteria | 1188 |
| 228 | Ga0207707_10208518 | 3300025912 | Bacteria | 1703 |
| 229 | Ga0207695_10001916 | 3300025913 | Bacteria | 32377 |
| 230 | Ga0207671_10131035 | 3300025914 | Bacteria | 1924 |
| 231 | Ga0207660_10001170 | 3300025917 | Bacteria | 17543 |
| 232 | Ga0207660_10009502 | 3300025917 | Bacteria | 6293 |
| 233 | Ga0207662_10326025 | 3300025918 | Bacteria | 1026 |
| 234 | Ga0207657_10001047 | 3300025919 | Bacteria | 29314 |
| 235 | Ga0207657_10001711 | 3300025919 | Bacteria | 23648 |
| 236 | Ga0207657_10006540 | 3300025919 | Bacteria | 12071 |
| 237 | Ga0207657_10075234 | 3300025919 | Bacteria | 2850 |
| 238 | Ga0207649_10000035 | 3300025920 | Bacteria | 134650 |
| 239 | Ga0207649_10058184 | 3300025920 | Bacteria | 2419 |
| 240 | Ga0207649_10764802 | 3300025920 | Bacteria | 752 |
| 241 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 242 | Ga0207652_10001853 | 3300025921 | Bacteria | 18346 |
| 243 | Ga0207652_10016241 | 3300025921 | Bacteria | 6074 |
| 244 | Ga0207681_10000142 | 3300025923 | Bacteria | 59744 |
| 245 | Ga0207681_10130551 | 3300025923 | Bacteria | 1857 |
| 246 | Ga0207681_10224841 | 3300025923 | Bacteria | 1454 |
| 247 | Ga0207681_10296163 | 3300025923 | Bacteria | 1279 |
| 248 | Ga0207694_10013918 | 3300025924 | Bacteria | 6066 |
| 249 | Ga0207694_10212342 | 3300025924 | Bacteria | 1577 |
| 250 | Ga0207650_10128752 | 3300025925 | Bacteria | 1979 |
| 251 | Ga0207650_10378087 | 3300025925 | Bacteria | 1169 |
| 252 | Ga0207650_10763187 | 3300025925 | Bacteria | 819 |
| 253 | Ga0207659_10014093 | 3300025926 | Bacteria | 5148 |
| 254 | Ga0207659_10504123 | 3300025926 | Bacteria | 1025 |
| 255 | Ga0207687_10017850 | 3300025927 | Bacteria | 4681 |
| 256 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 257 | Ga0207644_10000010 | 3300025931 | Bacteria | 226989 |
| 258 | Ga0207644_10003110 | 3300025931 | Bacteria | 10682 |
| 259 | Ga0207644_10013457 | 3300025931 | Bacteria | 5455 |
| 260 | Ga0207690_10000022 | 3300025932 | Bacteria | 215772 |
| 261 | Ga0207690_10000522 | 3300025932 | Bacteria | 24983 |
| 262 | Ga0207690_10000640 | 3300025932 | Bacteria | 22410 |
| 263 | Ga0207690_10006068 | 3300025932 | Bacteria | 7158 |
| 264 | Ga0207690_10011268 | 3300025932 | Bacteria | 5341 |
| 265 | Ga0207690_10243886 | 3300025932 | Bacteria | 1385 |
| 266 | Ga0207690_10566819 | 3300025932 | Bacteria | 924 |
| 267 | Ga0207706_10003725 | 3300025933 | Bacteria | 14537 |
| 268 | Ga0207706_10007107 | 3300025933 | Bacteria | 10358 |
| 269 | Ga0207706_10250049 | 3300025933 | Bacteria | 1549 |
| 270 | Ga0207709_10152572 | 3300025935 | Bacteria | 1602 |
| 271 | Ga0207691_10439524 | 3300025940 | Bacteria | 1111 |
| 272 | Ga0207711_10008830 | 3300025941 | Bacteria | 8426 |
| 273 | Ga0207711_10038155 | 3300025941 | Bacteria | 4084 |
| 274 | Ga0207711_10446491 | 3300025941 | Bacteria | 1204 |
| 275 | Ga0207689_10556882 | 3300025942 | Bacteria | 963 |
| 276 | Ga0207661_10048260 | 3300025944 | Bacteria | 3382 |
| 277 | Ga0207661_10171190 | 3300025944 | Bacteria | 1891 |
| 278 | Ga0207661_10287835 | 3300025944 | Bacteria | 1470 |
| 279 | Ga0207679_10018023 | 3300025945 | Bacteria | 4721 |
| 280 | Ga0207679_10063880 | 3300025945 | Bacteria | 2750 |
| 281 | Ga0207679_10527075 | 3300025945 | Bacteria | 1057 |
| 282 | Ga0207667_10021439 | 3300025949 | Bacteria | 7159 |
| 283 | Ga0207667_10023445 | 3300025949 | Bacteria | 6796 |
| 284 | Ga0207667_10068116 | 3300025949 | Bacteria | 3707 |
| 285 | Ga0207667_10072095 | 3300025949 | Bacteria | 3590 |
| 286 | Ga0207667_10078092 | 3300025949 | Bacteria | 3432 |
| 287 | Ga0207667_10317943 | 3300025949 | Bacteria | 1590 |
| 288 | Ga0207651_10765668 | 3300025960 | Bacteria | 854 |
| 289 | Ga0207712_10078244 | 3300025961 | Bacteria | 2399 |
| 290 | Ga0207712_10192312 | 3300025961 | Bacteria | 1611 |
| 291 | Ga0207668_10000075 | 3300025972 | Bacteria | 75329 |
| 292 | Ga0207668_10488305 | 3300025972 | Bacteria | 1057 |
| 293 | Ga0207640_10022581 | 3300025981 | Bacteria | 3768 |
| 294 | Ga0207640_10235677 | 3300025981 | Bacteria | 1411 |
| 295 | Ga0207658_10000742 | 3300025986 | Bacteria | 28124 |
| 296 | Ga0207658_10097674 | 3300025986 | Bacteria | 2293 |
| 297 | Ga0207658_10291662 | 3300025986 | Bacteria | 1402 |
| 298 | Ga0207658_10662154 | 3300025986 | Bacteria | 942 |
| 299 | Ga0207677_10000051 | 3300026023 | Bacteria | 100009 |
| 300 | Ga0207703_10001689 | 3300026035 | Bacteria | 19855 |
| 301 | Ga0207703_10002695 | 3300026035 | Bacteria | 15231 |
| 302 | Ga0207639_10003417 | 3300026041 | Bacteria | 10681 |
| 303 | Ga0207639_10229307 | 3300026041 | Bacteria | 1609 |
| 304 | Ga0207639_10278785 | 3300026041 | Bacteria | 1469 |
| 305 | Ga0207678_10019350 | 3300026067 | Bacteria | 5980 |
| 306 | Ga0207678_10030552 | 3300026067 | Bacteria | 4702 |
| 307 | Ga0207708_10221399 | 3300026075 | Bacteria | 1516 |
| 308 | Ga0207702_10004893 | 3300026078 | Bacteria | 11789 |
| 309 | Ga0207702_10049377 | 3300026078 | Bacteria | 3551 |
| 310 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 311 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 312 | Ga0207641_10030810 | 3300026088 | Bacteria | 4445 |
| 313 | Ga0207641_10605779 | 3300026088 | Bacteria | 1073 |
| 314 | Ga0207676_10001553 | 3300026095 | Bacteria | 16924 |
| 315 | Ga0207676_10105122 | 3300026095 | Bacteria | 2350 |
| 316 | Ga0207676_10118620 | 3300026095 | Bacteria | 2227 |
| 317 | Ga0207674_10041668 | 3300026116 | Bacteria | 4747 |
| 318 | Ga0207674_10049466 | 3300026116 | Bacteria | 4299 |
| 319 | Ga0207674_10285322 | 3300026116 | Bacteria | 1599 |
| 320 | Ga0207674_10286432 | 3300026116 | Bacteria | 1596 |
| 321 | Ga0207683_10167776 | 3300026121 | Bacteria | 1987 |
| 322 | Ga0207698_10000067 | 3300026142 | Bacteria | 70181 |
| 323 | Ga0207698_10002681 | 3300026142 | Bacteria | 10586 |
| 324 | Ga0207698_10100710 | 3300026142 | Bacteria | 2394 |
| 325 | Ga0207698_10112553 | 3300026142 | Bacteria | 2285 |
| 326 | Ga0207698_10304721 | 3300026142 | Bacteria | 1485 |
| 327 | Ga0209281_1019071 | 3300027111 | Bacteria | 1359 |
| 328 | Ga0209983_1007699 | 3300027665 | Bacteria | 2206 |
| 329 | Ga0207428_10095947 | 3300027907 | Bacteria | 2297 |
| 330 | Ga0268266_10000173 | 3300028379 | Bacteria | 117695 |
| 331 | Ga0268266_10001687 | 3300028379 | Bacteria | 25379 |
| 332 | Ga0268266_10002389 | 3300028379 | Bacteria | 20264 |
| 333 | Ga0268266_10206687 | 3300028379 | Bacteria | 1799 |
| 334 | Ga0268265_10057023 | 3300028380 | Bacteria | 2975 |
| 335 | Ga0268265_10140660 | 3300028380 | Bacteria | 2020 |
| 336 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 337 | Ga0268264_10003968 | 3300028381 | Bacteria | 12666 |
| 338 | Ga0268264_10618457 | 3300028381 | Bacteria | 1069 |
| 339 | Ga0265326_10071181 | 3300028558 | Bacteria | 983 |
| 340 | Ga0265334_10049056 | 3300028573 | Bacteria | 1625 |
| 341 | Ga0307517_10138615 | 3300028786 | Bacteria | 1718 |
| 342 | Ga0265338_10096777 | 3300028800 | Bacteria | 2420 |
| 343 | Ga0265338_10328361 | 3300028800 | Bacteria | 1105 |
| 344 | Ga0316177_1101816 | 3300030731 | Bacteria | 872 |
| 345 | Ga0307513_10000082 | 3300031456 | Bacteria | 131779 |
| 346 | Ga0307513_10001006 | 3300031456 | Bacteria | 40812 |
| 347 | Ga0307513_10394843 | 3300031456 | Bacteria | 1119 |
| 348 | Ga0307408_100032762 | 3300031548 | Bacteria | 3625 |
| 349 | Ga0307408_100047436 | 3300031548 | Bacteria | 3077 |
| 350 | Ga0307408_100151379 | 3300031548 | Bacteria | 1832 |
| 351 | Ga0307408_100859717 | 3300031548 | Bacteria | 827 |
| 352 | Ga0265314_10164351 | 3300031711 | Bacteria | 1347 |
| 353 | Ga0307405_10001767 | 3300031731 | Bacteria | 9253 |
| 354 | Ga0307405_10147627 | 3300031731 | Bacteria | 1649 |
| 355 | Ga0307405_10169729 | 3300031731 | Bacteria | 1555 |
| 356 | Ga0307405_10304888 | 3300031731 | Bacteria | 1210 |
| 357 | Ga0307405_10643660 | 3300031731 | Bacteria | 871 |
| 358 | Ga0307413_10004455 | 3300031824 | Bacteria | 6099 |
| 359 | Ga0307413_10013337 | 3300031824 | Bacteria | 4128 |
| 360 | Ga0307413_10034035 | 3300031824 | Bacteria | 2908 |
| 361 | Ga0307413_10135365 | 3300031824 | Bacteria | 1693 |
| 362 | Ga0307413_10416133 | 3300031824 | Bacteria | 1057 |
| 363 | Ga0307413_10608309 | 3300031824 | Bacteria | 895 |
| 364 | Ga0307410_10280063 | 3300031852 | Bacteria | 1308 |
| 365 | Ga0307410_10315942 | 3300031852 | Bacteria | 1238 |
| 366 | Ga0307410_10320929 | 3300031852 | Bacteria | 1229 |
| 367 | Ga0307410_10983883 | 3300031852 | Bacteria | 727 |
| 368 | Ga0307406_10138865 | 3300031901 | Bacteria | 1717 |
| 369 | Ga0307406_10475171 | 3300031901 | Bacteria | 1008 |
| 370 | Ga0307406_10576199 | 3300031901 | Bacteria | 924 |
| 371 | Ga0307407_10022735 | 3300031903 | Bacteria | 3259 |
| 372 | Ga0307412_10010943 | 3300031911 | Bacteria | 5238 |
| 373 | Ga0307412_10016837 | 3300031911 | Bacteria | 4366 |
| 374 | Ga0307412_10038066 | 3300031911 | Bacteria | 3094 |
| 375 | Ga0307412_10042957 | 3300031911 | Bacteria | 2941 |
| 376 | Ga0307412_10046661 | 3300031911 | Bacteria | 2840 |
| 377 | Ga0307412_10087077 | 3300031911 | Bacteria | 2175 |
| 378 | Ga0307412_10130868 | 3300031911 | Bacteria | 1822 |
| 379 | Ga0307412_10252537 | 3300031911 | Bacteria | 1370 |
| 380 | Ga0307412_10258545 | 3300031911 | Bacteria | 1356 |
| 381 | Ga0307412_10423302 | 3300031911 | Bacteria | 1090 |
| 382 | Ga0307412_10429171 | 3300031911 | Bacteria | 1083 |
| 383 | Ga0307409_100232451 | 3300031995 | Bacteria | 1672 |
| 384 | Ga0307409_100921541 | 3300031995 | Bacteria | 888 |
| 385 | Ga0307416_100009605 | 3300032002 | Bacteria | 6344 |
| 386 | Ga0307416_100026372 | 3300032002 | Bacteria | 4281 |
| 387 | Ga0307416_100412784 | 3300032002 | Bacteria | 1391 |
| 388 | Ga0307416_100547996 | 3300032002 | Bacteria | 1229 |
| 389 | Ga0307416_100620087 | 3300032002 | Bacteria | 1163 |
| 390 | Ga0307414_10001014 | 3300032004 | Bacteria | 14347 |
| 391 | Ga0307414_10014525 | 3300032004 | Bacteria | 4725 |
| 392 | Ga0307414_10086509 | 3300032004 | Bacteria | 2313 |
| 393 | Ga0307414_10110722 | 3300032004 | Bacteria | 2089 |
| 394 | Ga0307414_10123950 | 3300032004 | Bacteria | 1992 |
| 395 | Ga0307414_10132494 | 3300032004 | Bacteria | 1937 |
| 396 | Ga0307414_10219067 | 3300032004 | Bacteria | 1561 |
| 397 | Ga0307414_10341725 | 3300032004 | Bacteria | 1282 |
| 398 | Ga0307414_10472896 | 3300032004 | Bacteria | 1104 |
| 399 | Ga0307414_10485509 | 3300032004 | Bacteria | 1090 |
| 400 | Ga0307414_10674073 | 3300032004 | Bacteria | 934 |
| 401 | Ga0307411_10011964 | 3300032005 | Bacteria | 4710 |
| 402 | Ga0307411_10055176 | 3300032005 | Bacteria | 2613 |
| 403 | Ga0307411_10143292 | 3300032005 | Bacteria | 1765 |
| 404 | Ga0307411_10233615 | 3300032005 | Bacteria | 1435 |
| 405 | Ga0307415_100223595 | 3300032126 | Bacteria | 1511 |
| 406 | Ga0307510_10004202 | 3300033180 | Bacteria | 16921 |
| 407 | Ga0373932_0039642 | 3300035112 | Bacteria | 1352 |
| 408 | Ga0316574_0307309 | 3300035398 | Bacteria | 1008 |
| 409 | Ga0316574_0313766 | 3300035398 | Bacteria | 996 |
| 410 | Ga0373931_0041775 | 3300035691 | Bacteria | 2410 |
| 411 | Ga0373937_0506291 | 3300036401 | Bacteria | 1147 |
| 412 | Ga0316584_0048242 | 3300036712 | Bacteria | 3182 |
| 413 | Ga0395899_0000070 | 3300037312 | Bacteria | 189668 |
| 414 | Ga0395900_0707224 | 3300037418 | Bacteria | 941 |
| 415 | Ga0436364_0868772 | 3300037853 | Bacteria | 873 |
| 416 | Ga0400486_07735 | 3300038742 | Bacteria | 2251 |
| 417 | Ga0400487_04849 | 3300039110 | Bacteria | 2064 |
| 418 | Ga0436365_0058666 | 3300039437 | Bacteria | 9204 |
| 419 | Ga0436365_0591960 | 3300039437 | Bacteria | 5494 |
| 420 | Ga0436365_1180580 | 3300039437 | Bacteria | 852 |
| 421 | Ga0436365_1229924 | 3300039437 | Bacteria | 1149 |
| 422 | Ga0436365_1369819 | 3300039437 | Bacteria | 23136 |
| 423 | Ga0436365_1530544 | 3300039437 | Bacteria | 4301 |
| 424 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 425 | Ga0436363_0049765 | 3300039450 | Bacteria | 1568 |
| 426 | Ga0436363_1297661 | 3300039450 | Bacteria | 5607 |
| 427 | Ga0436362_0037733 | 3300039453 | Bacteria | 23770 |
| 428 | Ga0451789_0484133 | 3300041443 | Bacteria | 916 |
| 429 | Ga0451797_0437705 | 3300041453 | Bacteria | 868 |
| 430 | Ga0451798_0925254 | 3300041458 | Bacteria | 680 |
| 431 | Ga0451841_1283387 | 3300041498 | Bacteria | 1998 |
| 432 | Ga0451843_0412542 | 3300041509 | Bacteria | 1641 |
| 433 | Ga0451843_1205838 | 3300041509 | Bacteria | 1030 |
| 434 | Ga0439443_000582 | 3300042003 | Bacteria | 3392 |
| 435 | Ga0439445_0017912 | 3300042004 | Bacteria | 1754 |
| 436 | Ga0439462_0002205 | 3300042015 | Bacteria | 4493 |
| 437 | Ga0450912_004242 | 3300042116 | Bacteria | 1056 |
| 438 | Ga0439435_0018133 | 3300042436 | Bacteria | 1788 |
| 439 | Ga0466963_0123449 | 3300044694 | Bacteria | 1784 |
| 440 | Ga0451576_0000041 | 3300045051 | Bacteria | 343432 |
| 441 | Ga0495596_0000514 | 3300046500 | Bacteria | 24581 |
| 442 | Ga0495606_0036917 | 3300046507 | Bacteria | 3322 |
| 443 | Ga0495643_0020231 | 3300046522 | Bacteria | 3842 |
| 444 | Ga0495643_0068442 | 3300046522 | Bacteria | 1868 |
| 445 | Ga0495598_0003747 | 3300046537 | Bacteria | 3248 |
| 446 | Ga0495598_0060091 | 3300046537 | Bacteria | 1170 |
| 447 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 448 | Ga0495668_0092470 | 3300046616 | Bacteria | 1657 |
| 449 | Ga0495668_0123432 | 3300046616 | Bacteria | 1417 |
| 450 | Ga0495625_0000726 | 3300046660 | Bacteria | 46277 |
| 451 | Ga0495625_0062479 | 3300046660 | Bacteria | 2632 |
| 452 | Ga0495625_0431338 | 3300046660 | Bacteria | 817 |
| 453 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 454 | Ga0495669_0000236 | 3300046684 | Bacteria | 32667 |
| 455 | Ga0495670_0006827 | 3300046691 | Bacteria | 5620 |
| 456 | Ga0495649_0067010 | 3300046694 | Bacteria | 1926 |
| 457 | Ga0495636_0121468 | 3300047318 | Bacteria | 1156 |
| 458 | Ga0495672_0171018 | 3300047320 | Bacteria | 1108 |
| 459 | Ga0495687_117385 | 3300047443 | Bacteria | 966 |
| 460 | Ga0495677_0011390 | 3300047445 | Bacteria | 3254 |
| 461 | Ga0495677_0024720 | 3300047445 | Bacteria | 2179 |
| 462 | Ga0495686_0072656 | 3300047472 | Bacteria | 2115 |
| 463 | Ga0495626_0000301 | 3300048091 | Bacteria | 52582 |
| 464 | Ga0496100_0046731 | 3300048903 | Bacteria | 2786 |
| 465 | Ga0496101_0067094 | 3300048904 | Bacteria | 2618 |
| 466 | Ga0496104_0031840 | 3300048907 | Bacteria | 4906 |
| 467 | Ga0496104_0059496 | 3300048907 | Bacteria | 3617 |
| 468 | Ga0496105_0000931 | 3300048908 | Bacteria | 19939 |
| 469 | Ga0496105_0217071 | 3300048908 | Bacteria | 1557 |
| 470 | Ga0496106_0004294 | 3300048909 | Bacteria | 10594 |
| 471 | Ga0496107_0008469 | 3300048910 | Bacteria | 7118 |
| 472 | Ga0496108_0050204 | 3300048911 | Bacteria | 3491 |
| 473 | Ga0496109_0074652 | 3300048912 | Bacteria | 3117 |
| 474 | Ga0496110_0040880 | 3300048913 | Bacteria | 4043 |
| 475 | Ga0496110_0070530 | 3300048913 | Bacteria | 3096 |
| 476 | Ga0496111_0032932 | 3300048914 | Bacteria | 3695 |
| 477 | Ga0496113_0003104 | 3300048916 | Bacteria | 9869 |
| 478 | Ga0496114_0038363 | 3300048917 | Bacteria | 3964 |
| 479 | Ga0496114_0067164 | 3300048917 | Bacteria | 3008 |
| 480 | Ga0496115_0352992 | 3300048918 | Bacteria | 1199 |
| 481 | Ga0496116_0000284 | 3300048919 | Bacteria | 86342 |
| 482 | Ga0496117_0184107 | 3300048920 | Bacteria | 1197 |
| 483 | Ga0496117_0268486 | 3300048920 | Bacteria | 920 |
| 484 | Ga0496118_0002469 | 3300048921 | Bacteria | 24817 |
| 485 | Ga0496118_0221949 | 3300048921 | Bacteria | 1099 |
| 486 | Ga0496119_0202022 | 3300048922 | Bacteria | 1028 |
| 487 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 488 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 489 | Ga0496121_0000201 | 3300048924 | Bacteria | 131246 |
| 490 | Ga0496122_0018857 | 3300048925 | Bacteria | 6341 |
| 491 | Ga0496123_0002479 | 3300048926 | Bacteria | 22782 |
| 492 | Ga0496124_0001485 | 3300048927 | Bacteria | 34464 |
| 493 | Ga0496124_0012138 | 3300048927 | Bacteria | 8537 |
| 494 | Ga0496125_0018162 | 3300048928 | Bacteria | 6683 |
| 495 | Ga0496126_0001049 | 3300048929 | Bacteria | 46719 |
| 496 | Ga0496126_0009920 | 3300048929 | Bacteria | 10058 |
| 497 | Ga0496126_0410699 | 3300048929 | Bacteria | 1096 |
| 498 | Ga0496126_0762725 | 3300048929 | Bacteria | 746 |
| 499 | Ga0501031_0206951 | 3300049568 | Bacteria | 1279 |
| 500 | Ga0501032_0013948 | 3300049569 | Bacteria | 5701 |
| 501 | Ga0501032_0033845 | 3300049569 | Bacteria | 3500 |
| 502 | Ga0501033_0026706 | 3300049570 | Bacteria | 4343 |
| 503 | Ga0501034_0042149 | 3300049571 | Bacteria | 4620 |
| 504 | Ga0501034_0095274 | 3300049571 | Bacteria | 2973 |
| 505 | Ga0501034_0142260 | 3300049571 | Bacteria | 2378 |
| 506 | Ga0501034_0273929 | 3300049571 | Bacteria | 1628 |
| 507 | Ga0501036_0122570 | 3300049572 | Bacteria | 2195 |
| 508 | Ga0501037_0103407 | 3300049573 | Bacteria | 2054 |
| 509 | Ga0501038_0302257 | 3300049574 | Bacteria | 1256 |
| 510 | Ga0501039_0080056 | 3300049575 | Bacteria | 2542 |
| 511 | Ga0501043_0077104 | 3300049579 | Bacteria | 2618 |
| 512 | Ga0501043_0352023 | 3300049579 | Bacteria | 1119 |
| 513 | Ga0501043_0472285 | 3300049579 | Bacteria | 940 |
| 514 | Ga0501046_0573486 | 3300049580 | Bacteria | 803 |
| 515 | Ga0501047_0090006 | 3300049581 | Bacteria | 2946 |
| 516 | Ga0501047_0114509 | 3300049581 | Bacteria | 2579 |
| 517 | Ga0501047_0147683 | 3300049581 | Bacteria | 2227 |
| 518 | Ga0501047_0353336 | 3300049581 | Bacteria | 1306 |
| 519 | Ga0501047_0530800 | 3300049581 | Bacteria | 1002 |
| 520 | Ga0501047_0568972 | 3300049581 | Bacteria | 957 |
| 521 | Ga0501069_0018158 | 3300049585 | Bacteria | 3793 |
| 522 | Ga0501070_0091157 | 3300049586 | Bacteria | 2523 |
| 523 | Ga0501080_0141159 | 3300049742 | Bacteria | 2227 |
| 524 | Ga0501083_0179044 | 3300049744 | Bacteria | 1385 |
| 525 | Ga0501035_0160805 | 3300049822 | Bacteria | 1944 |
| 526 | Ga0501035_0341658 | 3300049822 | Bacteria | 1254 |
| 527 | Ga0501044_0000730 | 3300049823 | Bacteria | 39671 |
| 528 | Ga0501044_0219726 | 3300049823 | Bacteria | 1851 |
| 529 | Ga0501044_0225868 | 3300049823 | Bacteria | 1822 |
| 530 | Ga0501044_0379012 | 3300049823 | Bacteria | 1330 |
| 531 | Ga0501044_0528680 | 3300049823 | Bacteria | 1078 |
| 532 | Ga0501045_0097025 | 3300049824 | Bacteria | 2181 |
| 533 | nmdc:mga03683_11679_c1 | 3300050489 | Bacteria | 3188 |
| 534 | nmdc:mga03683_31_c1 | 3300050489 | Bacteria | 69502 |
| 535 | nmdc:mga03n38_222_c1 | 3300050490 | Bacteria | 13159 |
| 536 | nmdc:mga03n38_3692_c1 | 3300050490 | Bacteria | 4954 |
| 537 | nmdc:mga00v17_13083_c1 | 3300050491 | Bacteria | 4597 |
| 538 | nmdc:mga00v17_497382_c1 | 3300050491 | Bacteria | 790 |
| 539 | nmdc:mga0k408_13523_c1 | 3300050493 | Bacteria | 4479 |
| 540 | nmdc:mga0k408_1427_c1 | 3300050493 | Bacteria | 12938 |
| 541 | nmdc:mga0k408_18_c1 | 3300050493 | Bacteria | 112318 |
| 542 | nmdc:mga04h51_641_c1 | 3300050495 | Bacteria | 8181 |
| 543 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 544 | nmdc:mga07m45_299961_c1 | 3300050496 | Bacteria | 934 |
| 545 | nmdc:mga07m45_7_c1 | 3300050496 | Bacteria | 223540 |
| 546 | nmdc:mga09592_20410_c1 | 3300050508 | Bacteria | 5447 |
| 547 | nmdc:mga0qj67_13075_c1 | 3300050509 | Bacteria | 6269 |
| 548 | nmdc:mga0qj67_267869_c1 | 3300050509 | Bacteria | 1385 |
| 549 | nmdc:mga0qj67_574058_c1 | 3300050509 | Bacteria | 903 |
| 550 | nmdc:mga06r32_976_c1 | 3300050510 | Bacteria | 25615 |
| 551 | nmdc:mga0sz30_1125_c2 | 3300050516 | Bacteria | 7973 |
| 552 | nmdc:mga0sz30_14312_c1 | 3300050516 | Bacteria | 3120 |
| 553 | nmdc:mga0sz30_4304_c1 | 3300050516 | Bacteria | 5137 |
| 554 | Ga0500643_005450 | 3300053087 | Bacteria | 5483 |
| 555 | Ga0500647_0033753 | 3300053091 | Bacteria | 2442 |
| 556 | Ga0500592_015481 | 3300053116 | Bacteria | 1224 |
| 557 | Ga0500594_0023343 | 3300053118 | Bacteria | 1567 |
| 558 | Ga0500595_105371 | 3300053119 | Bacteria | 805 |
| 559 | Ga0500607_000395 | 3300053121 | Bacteria | 41884 |
| 560 | Ga0500607_000854 | 3300053121 | Bacteria | 29366 |
| 561 | Ga0500608_001181 | 3300053122 | Bacteria | 9303 |
| 562 | Ga0500614_088357 | 3300053123 | Bacteria | 877 |
| 563 | Ga0500614_114754 | 3300053123 | Bacteria | 788 |
| 564 | Ga0500618_007528 | 3300053125 | Bacteria | 3099 |
| 565 | Ga0500559_0001264 | 3300053136 | Bacteria | 14808 |
| 566 | Ga0500559_0038539 | 3300053136 | Bacteria | 2076 |
| 567 | Ga0500564_004287 | 3300053138 | Bacteria | 5686 |
| 568 | Ga0500568_0000814 | 3300053139 | Bacteria | 21910 |
| 569 | Ga0500568_0014556 | 3300053139 | Bacteria | 3549 |
| 570 | Ga0500568_0056679 | 3300053139 | Bacteria | 1527 |
| 571 | Ga0500573_0095506 | 3300053140 | Bacteria | 1676 |
| 572 | Ga0500573_0207981 | 3300053140 | Bacteria | 1034 |
| 573 | Ga0500577_0103196 | 3300053142 | Bacteria | 1168 |
| 574 | Ga0500590_000464 | 3300053148 | Bacteria | 13814 |
| 575 | Ga0500590_067366 | 3300053148 | Bacteria | 1787 |
| 576 | Ga0500604_0000007 | 3300053151 | Bacteria | 115773 |
| 577 | Ga0500604_0037163 | 3300053151 | Bacteria | 1455 |
| 578 | Ga0500616_0000080 | 3300053153 | Bacteria | 200381 |
| 579 | Ga0500627_0000035 | 3300053158 | Bacteria | 80123 |
| 580 | Ga0500630_127388 | 3300053159 | Bacteria | 1118 |
| 581 | Ga0500637_0021573 | 3300053178 | Bacteria | 3499 |
| 582 | Ga0500637_0185373 | 3300053178 | Bacteria | 1191 |
| 583 | Ga0500567_008334 | 3300053723 | Bacteria | 4901 |
| 584 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 585 | Ga0500645_011510 | 3300053730 | Bacteria | 2886 |
| 586 | Ga0500587_000415 | 3300053739 | Bacteria | 4976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0040880 | Ga0496110_0040880_1542_2144 | 191 |
| 2 | 3300048929 | Ga0496126_0001049 | Ga0496126_0001049_35709_36311 | 191 |
| 3 | 3300025321 | Ga0207656_10230892 | Ga0207656_102308921 | 196 |
| 4 | 3300005367 | Ga0070667_100003664 | Ga0070667_10000366415 | 198 |
| 5 | 3300005458 | Ga0070681_10008385 | Ga0070681_100083858 | 198 |
| 6 | 3300005467 | Ga0070706_100330670 | Ga0070706_1003306702 | 198 |
| 7 | 3300006051 | Ga0075364_10035300 | Ga0075364_100353003 | 198 |
| 8 | 3300036712 | Ga0316584_0048242 | Ga0316584_0048242_766_1365 | 198 |
| 9 | 3300037853 | Ga0436364_0868772 | Ga0436364_0868772_113_721 | 198 |
| 10 | 3300038742 | Ga0400486_07735 | Ga0400486_07735_1058_1663 | 198 |
| 11 | 3300039437 | Ga0436365_1830840 | Ga0436365_1830840_27704_28312 | 198 |
| 12 | 3300039450 | Ga0436363_1297661 | Ga0436363_1297661_1116_1724 | 198 |
| 13 | 3300041458 | Ga0451798_0925254 | Ga0451798_0925254_12_620 | 198 |
| 14 | 3300041498 | Ga0451841_1283387 | Ga0451841_1283387_71_679 | 198 |
| 15 | 3300041509 | Ga0451843_1205838 | Ga0451843_1205838_146_754 | 198 |
| 16 | 3300046684 | Ga0495669_0000236 | Ga0495669_0000236_7695_8303 | 198 |
| 17 | 3300047318 | Ga0495636_0121468 | Ga0495636_0121468_190_798 | 198 |
| 18 | 3300047445 | Ga0495677_0024720 | Ga0495677_0024720_151_759 | 198 |
| 19 | 3300048920 | Ga0496117_0184107 | Ga0496117_0184107_218_823 | 198 |
| 20 | 3300048921 | Ga0496118_0002469 | Ga0496118_0002469_7137_7742 | 198 |
| 21 | 3300048924 | Ga0496121_0000196 | Ga0496121_0000196_30973_31578 | 198 |
| 22 | 3300053123 | Ga0500614_114754 | Ga0500614_114754_154_759 | 198 |
| 23 | 3300006847 | Ga0075431_100000392 | Ga0075431_1000003925 | 199 |
| 24 | 3300006880 | Ga0075429_100045313 | Ga0075429_1000453133 | 199 |
| 25 | 3300050508 | nmdc:mga09592_20410_c1 | nmdc:mga09592_20410_c1_3441_4049 | 199 |
| 26 | 3300050509 | nmdc:mga0qj67_267869_c1 | nmdc:mga0qj67_267869_c1_367_975 | 199 |
| 27 | 3300050510 | nmdc:mga06r32_976_c1 | nmdc:mga06r32_976_c1_4868_5476 | 199 |
| 28 | 3300053125 | Ga0500618_007528 | Ga0500618_007528_1297_1917 | 200 |
| 29 | 3300005335 | Ga0070666_10136157 | Ga0070666_101361572 | 201 |
| 30 | 3300005355 | Ga0070671_100004246 | Ga0070671_10000424612 | 201 |
| 31 | 3300005617 | Ga0068859_100003997 | Ga0068859_10000399712 | 201 |
| 32 | 3300005842 | Ga0068858_100001121 | Ga0068858_10000112118 | 201 |
| 33 | 3300006931 | Ga0097620_100003997 | Ga0097620_10000399711 | 201 |
| 34 | 3300009177 | Ga0105248_10080346 | Ga0105248_100803463 | 201 |
| 35 | 3300014325 | Ga0163163_10469272 | Ga0163163_104692722 | 201 |
| 36 | 3300025931 | Ga0207644_10003110 | Ga0207644_100031105 | 201 |
| 37 | 3300026035 | Ga0207703_10002695 | Ga0207703_100026959 | 201 |
| 38 | 3300002239 | JGI24034J26672_10028901 | JGI24034J26672_100289012 | 204 |
| 39 | 3300005331 | Ga0070670_100041862 | Ga0070670_1000418622 | 204 |
| 40 | 3300005347 | Ga0070668_100000048 | Ga0070668_10000004883 | 204 |
| 41 | 3300005355 | Ga0070671_100000532 | Ga0070671_10000053225 | 204 |
| 42 | 3300005841 | Ga0068863_100000017 | Ga0068863_10000001778 | 204 |
| 43 | 3300005843 | Ga0068860_100101357 | Ga0068860_1001013572 | 204 |
| 44 | 3300005844 | Ga0068862_100025994 | Ga0068862_1000259942 | 204 |
| 45 | 3300025925 | Ga0207650_10378087 | Ga0207650_103780872 | 204 |
| 46 | 3300025931 | Ga0207644_10000010 | Ga0207644_10000010165 | 204 |
| 47 | 3300025961 | Ga0207712_10078244 | Ga0207712_100782444 | 204 |
| 48 | 3300025972 | Ga0207668_10000075 | Ga0207668_100000754 | 204 |
| 49 | 3300026088 | Ga0207641_10000036 | Ga0207641_1000003676 | 204 |
| 50 | 3300028380 | Ga0268265_10057023 | Ga0268265_100570233 | 204 |
| 51 | 3300028381 | Ga0268264_10003968 | Ga0268264_1000396811 | 204 |
| 52 | 3300025298 | Ga0209050_1001280 | Ga0209050_10012806 | 205 |
| 53 | 3300046500 | Ga0495596_0000514 | Ga0495596_0000514_10155_10808 | 205 |
| 54 | 3300046507 | Ga0495606_0036917 | Ga0495606_0036917_525_1178 | 205 |
| 55 | 3300046522 | Ga0495643_0020231 | Ga0495643_0020231_1734_2387 | 205 |
| 56 | 3300046616 | Ga0495668_0123432 | Ga0495668_0123432_119_772 | 205 |
| 57 | 3300048091 | Ga0495626_0000301 | Ga0495626_0000301_28922_29575 | 205 |
| 58 | 3300048903 | Ga0496100_0046731 | Ga0496100_0046731_912_1565 | 205 |
| 59 | 3300048919 | Ga0496116_0000284 | Ga0496116_0000284_52418_53071 | 205 |
| 60 | 3300048920 | Ga0496117_0268486 | Ga0496117_0268486_33_686 | 205 |
| 61 | 3300048925 | Ga0496122_0018857 | Ga0496122_0018857_1095_1748 | 205 |
| 62 | 3300048926 | Ga0496123_0002479 | Ga0496123_0002479_21059_21712 | 205 |
| 63 | 3300048927 | Ga0496124_0001485 | Ga0496124_0001485_30457_31110 | 205 |
| 64 | 3300048927 | Ga0496124_0012138 | Ga0496124_0012138_1310_1963 | 205 |
| 65 | 3300048928 | Ga0496125_0018162 | Ga0496125_0018162_5325_5978 | 205 |
| 66 | 3300048929 | Ga0496126_0009920 | Ga0496126_0009920_9256_9909 | 205 |
| 67 | 3300049569 | Ga0501032_0013948 | Ga0501032_0013948_4722_5357 | 205 |
| 68 | iso_pu_bacteria | 2739367664 | 2739649278 | 205 |
| 69 | iso_pu_bacteria | 2739367865 | 2740027751 | 205 |
| 70 | iso_pu_bacteria | 2818991438 | 2819552893 | 205 |
| 71 | iso_pu_bacteria | 2882806704 | 2882806844 | 205 |
| 72 | iso_pu_bacteria | 2896184354 | 2896185588 | 205 |
| 73 | iso_pu_bacteria | 2896253425 | 2896256434 | 205 |
| 74 | 3300005347 | Ga0070668_100180957 | Ga0070668_1001809571 | 206 |
| 75 | 3300005367 | Ga0070667_100000167 | Ga0070667_10000016749 | 206 |
| 76 | 3300005841 | Ga0068863_100395774 | Ga0068863_1003957742 | 206 |
| 77 | 3300006846 | Ga0075430_100490504 | Ga0075430_1004905042 | 206 |
| 78 | 3300025923 | Ga0207681_10224841 | Ga0207681_102248412 | 206 |
| 79 | 3300025986 | Ga0207658_10000742 | Ga0207658_1000074227 | 206 |
| 80 | 3300026088 | Ga0207641_10030810 | Ga0207641_100308102 | 206 |
| 81 | 3300026142 | Ga0207698_10304721 | Ga0207698_103047212 | 206 |
| 82 | 3300050509 | nmdc:mga0qj67_13075_c1 | nmdc:mga0qj67_13075_c1_3908_4528 | 206 |
| 83 | 3300050509 | nmdc:mga0qj67_574058_c1 | nmdc:mga0qj67_574058_c1_151_771 | 206 |
| 84 | 3300005327 | Ga0070658_10026423 | Ga0070658_100264233 | 207 |
| 85 | 3300005329 | Ga0070683_100405324 | Ga0070683_1004053242 | 207 |
| 86 | 3300005331 | Ga0070670_100407414 | Ga0070670_1004074142 | 207 |
| 87 | 3300005344 | Ga0070661_100105137 | Ga0070661_1001051372 | 207 |
| 88 | 3300005366 | Ga0070659_100077995 | Ga0070659_1000779953 | 207 |
| 89 | 3300005455 | Ga0070663_100025285 | Ga0070663_1000252852 | 207 |
| 90 | 3300005457 | Ga0070662_100003248 | Ga0070662_10000324812 | 207 |
| 91 | 3300005458 | Ga0070681_10720379 | Ga0070681_107203791 | 207 |
| 92 | 3300005530 | Ga0070679_100005037 | Ga0070679_1000050377 | 207 |
| 93 | 3300005530 | Ga0070679_100230721 | Ga0070679_1002307213 | 207 |
| 94 | 3300005530 | Ga0070679_100859258 | Ga0070679_1008592582 | 207 |
| 95 | 3300005535 | Ga0070684_100007437 | Ga0070684_1000074378 | 207 |
| 96 | 3300005539 | Ga0068853_100286382 | Ga0068853_1002863823 | 207 |
| 97 | 3300005564 | Ga0070664_100119757 | Ga0070664_1001197572 | 207 |
| 98 | 3300005577 | Ga0068857_100431439 | Ga0068857_1004314391 | 207 |
| 99 | 3300011119 | Ga0105246_10000137 | Ga0105246_1000013739 | 207 |
| 100 | 3300013100 | Ga0157373_10121063 | Ga0157373_101210632 | 207 |
| 101 | 3300013100 | Ga0157373_10280455 | Ga0157373_102804552 | 207 |
| 102 | 3300013102 | Ga0157371_10090878 | Ga0157371_100908783 | 207 |
| 103 | 3300013308 | Ga0157375_10784652 | Ga0157375_107846522 | 207 |
| 104 | 3300014326 | Ga0157380_10091084 | Ga0157380_100910843 | 207 |
| 105 | 3300025909 | Ga0207705_10007000 | Ga0207705_100070004 | 207 |
| 106 | 3300025909 | Ga0207705_10015958 | Ga0207705_100159582 | 207 |
| 107 | 3300025920 | Ga0207649_10764802 | Ga0207649_107648021 | 207 |
| 108 | 3300025921 | Ga0207652_10001853 | Ga0207652_100018537 | 207 |
| 109 | 3300025921 | Ga0207652_10016241 | Ga0207652_100162412 | 207 |
| 110 | 3300025925 | Ga0207650_10763187 | Ga0207650_107631872 | 207 |
| 111 | 3300025932 | Ga0207690_10243886 | Ga0207690_102438863 | 207 |
| 112 | 3300025932 | Ga0207690_10566819 | Ga0207690_105668192 | 207 |
| 113 | 3300025933 | Ga0207706_10007107 | Ga0207706_1000710713 | 207 |
| 114 | 3300025944 | Ga0207661_10287835 | Ga0207661_102878353 | 207 |
| 115 | 3300025945 | Ga0207679_10063880 | Ga0207679_100638802 | 207 |
| 116 | 3300026041 | Ga0207639_10229307 | Ga0207639_102293071 | 207 |
| 117 | 3300026067 | Ga0207678_10019350 | Ga0207678_100193505 | 207 |
| 118 | 3300026116 | Ga0207674_10285322 | Ga0207674_102853222 | 207 |
| 119 | 3300026142 | Ga0207698_10112553 | Ga0207698_101125532 | 207 |
| 120 | 3300039110 | Ga0400487_04849 | Ga0400487_04849_625_1269 | 207 |
| 121 | 3300048917 | Ga0496114_0067164 | Ga0496114_0067164_1612_2244 | 207 |
| 122 | 3300049581 | Ga0501047_0353336 | Ga0501047_0353336_636_1274 | 207 |
| 123 | 3300049822 | Ga0501035_0160805 | Ga0501035_0160805_581_1219 | 207 |
| 124 | 3300049823 | Ga0501044_0225868 | Ga0501044_0225868_205_837 | 207 |
| 125 | 3300049823 | Ga0501044_0379012 | Ga0501044_0379012_574_1206 | 207 |
| 126 | 3300049823 | Ga0501044_0528680 | Ga0501044_0528680_384_1022 | 207 |
| 127 | 3300001979 | JGI24740J21852_10076201 | JGI24740J21852_100762011 | 208 |
| 128 | 3300002239 | JGI24034J26672_10039392 | JGI24034J26672_100393921 | 208 |
| 129 | 3300002459 | JGI24751J29686_10000154 | JGI24751J29686_1000015426 | 208 |
| 130 | 3300005327 | Ga0070658_10123341 | Ga0070658_101233412 | 208 |
| 131 | 3300005327 | Ga0070658_10313043 | Ga0070658_103130431 | 208 |
| 132 | 3300005327 | Ga0070658_10508661 | Ga0070658_105086612 | 208 |
| 133 | 3300005330 | Ga0070690_100022470 | Ga0070690_1000224705 | 208 |
| 134 | 3300005333 | Ga0070677_10268384 | Ga0070677_102683841 | 208 |
| 135 | 3300005335 | Ga0070666_10037423 | Ga0070666_100374232 | 208 |
| 136 | 3300005336 | Ga0070680_100001683 | Ga0070680_1000016837 | 208 |
| 137 | 3300005337 | Ga0070682_100027871 | Ga0070682_1000278712 | 208 |
| 138 | 3300005339 | Ga0070660_100002033 | Ga0070660_1000020338 | 208 |
| 139 | 3300005344 | Ga0070661_100001882 | Ga0070661_1000018828 | 208 |
| 140 | 3300005345 | Ga0070692_10094346 | Ga0070692_100943462 | 208 |
| 141 | 3300005347 | Ga0070668_100134495 | Ga0070668_1001344953 | 208 |
| 142 | 3300005347 | Ga0070668_100238134 | Ga0070668_1002381342 | 208 |
| 143 | 3300005353 | Ga0070669_100000472 | Ga0070669_10000047214 | 208 |
| 144 | 3300005355 | Ga0070671_100000067 | Ga0070671_10000006764 | 208 |
| 145 | 3300005366 | Ga0070659_100138493 | Ga0070659_1001384932 | 208 |
| 146 | 3300005367 | Ga0070667_100018045 | Ga0070667_1000180454 | 208 |
| 147 | 3300005455 | Ga0070663_100016991 | Ga0070663_1000169913 | 208 |
| 148 | 3300005457 | Ga0070662_100001446 | Ga0070662_1000014468 | 208 |
| 149 | 3300005530 | Ga0070679_100033039 | Ga0070679_1000330393 | 208 |
| 150 | 3300005535 | Ga0070684_100404689 | Ga0070684_1004046891 | 208 |
| 151 | 3300005539 | Ga0068853_100002549 | Ga0068853_10000254915 | 208 |
| 152 | 3300005544 | Ga0070686_100011498 | Ga0070686_1000114984 | 208 |
| 153 | 3300005548 | Ga0070665_100007174 | Ga0070665_10000717410 | 208 |
| 154 | 3300005548 | Ga0070665_100115291 | Ga0070665_1001152914 | 208 |
| 155 | 3300005563 | Ga0068855_100018885 | Ga0068855_1000188858 | 208 |
| 156 | 3300005563 | Ga0068855_100034692 | Ga0068855_1000346922 | 208 |
| 157 | 3300005563 | Ga0068855_100061409 | Ga0068855_1000614093 | 208 |
| 158 | 3300005563 | Ga0068855_100135070 | Ga0068855_1001350704 | 208 |
| 159 | 3300005563 | Ga0068855_100287646 | Ga0068855_1002876462 | 208 |
| 160 | 3300005564 | Ga0070664_100446009 | Ga0070664_1004460092 | 208 |
| 161 | 3300005577 | Ga0068857_100106632 | Ga0068857_1001066323 | 208 |
| 162 | 3300005577 | Ga0068857_100454158 | Ga0068857_1004541581 | 208 |
| 163 | 3300005577 | Ga0068857_100966506 | Ga0068857_1009665061 | 208 |
| 164 | 3300005578 | Ga0068854_100009343 | Ga0068854_1000093434 | 208 |
| 165 | 3300005614 | Ga0068856_100007858 | Ga0068856_10000785815 | 208 |
| 166 | 3300005616 | Ga0068852_100127539 | Ga0068852_1001275392 | 208 |
| 167 | 3300005616 | Ga0068852_100224005 | Ga0068852_1002240052 | 208 |
| 168 | 3300005617 | Ga0068859_100242513 | Ga0068859_1002425132 | 208 |
| 169 | 3300005618 | Ga0068864_100141990 | Ga0068864_1001419902 | 208 |
| 170 | 3300005834 | Ga0068851_10228520 | Ga0068851_102285202 | 208 |
| 171 | 3300005841 | Ga0068863_100000103 | Ga0068863_10000010326 | 208 |
| 172 | 3300005842 | Ga0068858_100074898 | Ga0068858_1000748984 | 208 |
| 173 | 3300005842 | Ga0068858_100090543 | Ga0068858_1000905432 | 208 |
| 174 | 3300005843 | Ga0068860_100000093 | Ga0068860_10000009328 | 208 |
| 175 | 3300005843 | Ga0068860_100076723 | Ga0068860_1000767232 | 208 |
| 176 | 3300005844 | Ga0068862_100065022 | Ga0068862_1000650222 | 208 |
| 177 | 3300005844 | Ga0068862_100182342 | Ga0068862_1001823422 | 208 |
| 178 | 3300005985 | Ga0081539_10031210 | Ga0081539_100312102 | 208 |
| 179 | 3300006048 | Ga0075363_100006123 | Ga0075363_1000061239 | 208 |
| 180 | 3300006058 | Ga0075432_10010664 | Ga0075432_100106643 | 208 |
| 181 | 3300006177 | Ga0075362_10000011 | Ga0075362_1000001199 | 208 |
| 182 | 3300006178 | Ga0075367_10433997 | Ga0075367_104339972 | 208 |
| 183 | 3300006186 | Ga0075369_10058793 | Ga0075369_100587933 | 208 |
| 184 | 3300006195 | Ga0075366_10000190 | Ga0075366_1000019014 | 208 |
| 185 | 3300006195 | Ga0075366_10017228 | Ga0075366_100172286 | 208 |
| 186 | 3300006195 | Ga0075366_10086040 | Ga0075366_100860402 | 208 |
| 187 | 3300006353 | Ga0075370_10000004 | Ga0075370_1000000485 | 208 |
| 188 | 3300006931 | Ga0097620_100242491 | Ga0097620_1002424913 | 208 |
| 189 | 3300006946 | Ga0079104_1020081 | Ga0079104_10200812 | 208 |
| 190 | 3300009148 | Ga0105243_10249271 | Ga0105243_102492712 | 208 |
| 191 | 3300009174 | Ga0105241_10042269 | Ga0105241_100422692 | 208 |
| 192 | 3300009177 | Ga0105248_10096944 | Ga0105248_100969442 | 208 |
| 193 | 3300009177 | Ga0105248_10191968 | Ga0105248_101919683 | 208 |
| 194 | 3300009553 | Ga0105249_10101016 | Ga0105249_101010161 | 208 |
| 195 | 3300013100 | Ga0157373_10039391 | Ga0157373_100393912 | 208 |
| 196 | 3300013102 | Ga0157371_10009329 | Ga0157371_100093295 | 208 |
| 197 | 3300013102 | Ga0157371_10149686 | Ga0157371_101496862 | 208 |
| 198 | 3300013104 | Ga0157370_10016607 | Ga0157370_100166074 | 208 |
| 199 | 3300013105 | Ga0157369_10001072 | Ga0157369_100010727 | 208 |
| 200 | 3300013306 | Ga0163162_10191791 | Ga0163162_101917914 | 208 |
| 201 | 3300013307 | Ga0157372_10004382 | Ga0157372_100043826 | 208 |
| 202 | 3300013307 | Ga0157372_10395557 | Ga0157372_103955573 | 208 |
| 203 | 3300014968 | Ga0157379_10089128 | Ga0157379_100891284 | 208 |
| 204 | 3300021377 | Ga0213874_10018530 | Ga0213874_100185302 | 208 |
| 205 | 3300021384 | Ga0213876_10000134 | Ga0213876_1000013465 | 208 |
| 206 | 3300021384 | Ga0213876_10169798 | Ga0213876_101697982 | 208 |
| 207 | 3300025321 | Ga0207656_10219507 | Ga0207656_102195072 | 208 |
| 208 | 3300025904 | Ga0207647_10316020 | Ga0207647_103160201 | 208 |
| 209 | 3300025909 | Ga0207705_10261651 | Ga0207705_102616512 | 208 |
| 210 | 3300025909 | Ga0207705_10322186 | Ga0207705_103221862 | 208 |
| 211 | 3300025914 | Ga0207671_10131035 | Ga0207671_101310353 | 208 |
| 212 | 3300025917 | Ga0207660_10009502 | Ga0207660_100095025 | 208 |
| 213 | 3300025919 | Ga0207657_10001711 | Ga0207657_1000171127 | 208 |
| 214 | 3300025920 | Ga0207649_10058184 | Ga0207649_100581842 | 208 |
| 215 | 3300025923 | Ga0207681_10000142 | Ga0207681_1000014254 | 208 |
| 216 | 3300025923 | Ga0207681_10296163 | Ga0207681_102961632 | 208 |
| 217 | 3300025925 | Ga0207650_10128752 | Ga0207650_101287522 | 208 |
| 218 | 3300025931 | Ga0207644_10000004 | Ga0207644_1000000472 | 208 |
| 219 | 3300025932 | Ga0207690_10000640 | Ga0207690_1000064025 | 208 |
| 220 | 3300025933 | Ga0207706_10003725 | Ga0207706_100037257 | 208 |
| 221 | 3300025940 | Ga0207691_10439524 | Ga0207691_104395241 | 208 |
| 222 | 3300025941 | Ga0207711_10038155 | Ga0207711_100381557 | 208 |
| 223 | 3300025941 | Ga0207711_10446491 | Ga0207711_104464912 | 208 |
| 224 | 3300025944 | Ga0207661_10048260 | Ga0207661_100482602 | 208 |
| 225 | 3300025945 | Ga0207679_10018023 | Ga0207679_100180233 | 208 |
| 226 | 3300025949 | Ga0207667_10021439 | Ga0207667_100214392 | 208 |
| 227 | 3300025949 | Ga0207667_10023445 | Ga0207667_100234457 | 208 |
| 228 | 3300025949 | Ga0207667_10068116 | Ga0207667_100681163 | 208 |
| 229 | 3300025949 | Ga0207667_10072095 | Ga0207667_100720952 | 208 |
| 230 | 3300025972 | Ga0207668_10488305 | Ga0207668_104883052 | 208 |
| 231 | 3300025981 | Ga0207640_10022581 | Ga0207640_100225815 | 208 |
| 232 | 3300025986 | Ga0207658_10097674 | Ga0207658_100976742 | 208 |
| 233 | 3300025986 | Ga0207658_10291662 | Ga0207658_102916622 | 208 |
| 234 | 3300026041 | Ga0207639_10003417 | Ga0207639_100034172 | 208 |
| 235 | 3300026067 | Ga0207678_10030552 | Ga0207678_100305522 | 208 |
| 236 | 3300026078 | Ga0207702_10049377 | Ga0207702_100493772 | 208 |
| 237 | 3300026088 | Ga0207641_10000113 | Ga0207641_1000011326 | 208 |
| 238 | 3300026088 | Ga0207641_10605779 | Ga0207641_106057791 | 208 |
| 239 | 3300026095 | Ga0207676_10105122 | Ga0207676_101051221 | 208 |
| 240 | 3300026095 | Ga0207676_10118620 | Ga0207676_101186203 | 208 |
| 241 | 3300026116 | Ga0207674_10041668 | Ga0207674_100416682 | 208 |
| 242 | 3300026116 | Ga0207674_10049466 | Ga0207674_100494664 | 208 |
| 243 | 3300026116 | Ga0207674_10286432 | Ga0207674_102864322 | 208 |
| 244 | 3300026142 | Ga0207698_10100710 | Ga0207698_101007103 | 208 |
| 245 | 3300027111 | Ga0209281_1019071 | Ga0209281_10190712 | 208 |
| 246 | 3300027907 | Ga0207428_10095947 | Ga0207428_100959473 | 208 |
| 247 | 3300028379 | Ga0268266_10002389 | Ga0268266_100023898 | 208 |
| 248 | 3300028379 | Ga0268266_10206687 | Ga0268266_102066872 | 208 |
| 249 | 3300028380 | Ga0268265_10140660 | Ga0268265_101406602 | 208 |
| 250 | 3300028381 | Ga0268264_10000067 | Ga0268264_10000067264 | 208 |
| 251 | 3300030731 | Ga0316177_1101816 | Ga0316177_11018162 | 208 |
| 252 | 3300031548 | Ga0307408_100032762 | Ga0307408_1000327622 | 208 |
| 253 | 3300031548 | Ga0307408_100859717 | Ga0307408_1008597171 | 208 |
| 254 | 3300031731 | Ga0307405_10001767 | Ga0307405_100017675 | 208 |
| 255 | 3300031731 | Ga0307405_10147627 | Ga0307405_101476271 | 208 |
| 256 | 3300031824 | Ga0307413_10004455 | Ga0307413_100044553 | 208 |
| 257 | 3300031824 | Ga0307413_10013337 | Ga0307413_100133372 | 208 |
| 258 | 3300031824 | Ga0307413_10034035 | Ga0307413_100340352 | 208 |
| 259 | 3300031824 | Ga0307413_10135365 | Ga0307413_101353652 | 208 |
| 260 | 3300031852 | Ga0307410_10315942 | Ga0307410_103159423 | 208 |
| 261 | 3300031852 | Ga0307410_10983883 | Ga0307410_109838831 | 208 |
| 262 | 3300031903 | Ga0307407_10022735 | Ga0307407_100227353 | 208 |
| 263 | 3300031911 | Ga0307412_10010943 | Ga0307412_100109432 | 208 |
| 264 | 3300031911 | Ga0307412_10046661 | Ga0307412_100466612 | 208 |
| 265 | 3300031911 | Ga0307412_10087077 | Ga0307412_100870772 | 208 |
| 266 | 3300031995 | Ga0307409_100232451 | Ga0307409_1002324513 | 208 |
| 267 | 3300031995 | Ga0307409_100921541 | Ga0307409_1009215412 | 208 |
| 268 | 3300032002 | Ga0307416_100009605 | Ga0307416_1000096056 | 208 |
| 269 | 3300032002 | Ga0307416_100026372 | Ga0307416_1000263723 | 208 |
| 270 | 3300032002 | Ga0307416_100547996 | Ga0307416_1005479962 | 208 |
| 271 | 3300032004 | Ga0307414_10014525 | Ga0307414_100145252 | 208 |
| 272 | 3300032004 | Ga0307414_10110722 | Ga0307414_101107223 | 208 |
| 273 | 3300032004 | Ga0307414_10219067 | Ga0307414_102190672 | 208 |
| 274 | 3300032004 | Ga0307414_10341725 | Ga0307414_103417252 | 208 |
| 275 | 3300032004 | Ga0307414_10674073 | Ga0307414_106740732 | 208 |
| 276 | 3300032005 | Ga0307411_10011964 | Ga0307411_100119645 | 208 |
| 277 | 3300032005 | Ga0307411_10055176 | Ga0307411_100551762 | 208 |
| 278 | 3300032005 | Ga0307411_10143292 | Ga0307411_101432922 | 208 |
| 279 | 3300032126 | Ga0307415_100223595 | Ga0307415_1002235952 | 208 |
| 280 | 3300035112 | Ga0373932_0039642 | Ga0373932_0039642_15_662 | 208 |
| 281 | 3300035398 | Ga0316574_0307309 | Ga0316574_0307309_62_712 | 208 |
| 282 | 3300035398 | Ga0316574_0313766 | Ga0316574_0313766_154_783 | 208 |
| 283 | 3300035691 | Ga0373931_0041775 | Ga0373931_0041775_965_1612 | 208 |
| 284 | 3300037312 | Ga0395899_0000070 | Ga0395899_0000070_139553_140194 | 208 |
| 285 | 3300037418 | Ga0395900_0707224 | Ga0395900_0707224_50_691 | 208 |
| 286 | 3300039437 | Ga0436365_1530544 | Ga0436365_1530544_3243_3878 | 208 |
| 287 | 3300042003 | Ga0439443_000582 | Ga0439443_000582_421_1059 | 208 |
| 288 | 3300042015 | Ga0439462_0002205 | Ga0439462_0002205_3824_4462 | 208 |
| 289 | 3300042436 | Ga0439435_0018133 | Ga0439435_0018133_509_1147 | 208 |
| 290 | 3300046537 | Ga0495598_0003747 | Ga0495598_0003747_843_1481 | 208 |
| 291 | 3300046660 | Ga0495625_0431338 | Ga0495625_0431338_109_747 | 208 |
| 292 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_172173_172811 | 208 |
| 293 | 3300047445 | Ga0495677_0011390 | Ga0495677_0011390_681_1319 | 208 |
| 294 | 3300048907 | Ga0496104_0031840 | Ga0496104_0031840_2892_3527 | 208 |
| 295 | 3300048907 | Ga0496104_0059496 | Ga0496104_0059496_1010_1657 | 208 |
| 296 | 3300048908 | Ga0496105_0000931 | Ga0496105_0000931_15826_16473 | 208 |
| 297 | 3300048908 | Ga0496105_0217071 | Ga0496105_0217071_63_698 | 208 |
| 298 | 3300048909 | Ga0496106_0004294 | Ga0496106_0004294_2887_3522 | 208 |
| 299 | 3300048910 | Ga0496107_0008469 | Ga0496107_0008469_300_935 | 208 |
| 300 | 3300048911 | Ga0496108_0050204 | Ga0496108_0050204_1101_1736 | 208 |
| 301 | 3300048912 | Ga0496109_0074652 | Ga0496109_0074652_1790_2425 | 208 |
| 302 | 3300048913 | Ga0496110_0070530 | Ga0496110_0070530_717_1352 | 208 |
| 303 | 3300048914 | Ga0496111_0032932 | Ga0496111_0032932_2814_3449 | 208 |
| 304 | 3300048916 | Ga0496113_0003104 | Ga0496113_0003104_8785_9420 | 208 |
| 305 | 3300048922 | Ga0496119_0202022 | Ga0496119_0202022_337_984 | 208 |
| 306 | 3300048929 | Ga0496126_0762725 | Ga0496126_0762725_63_710 | 208 |
| 307 | 3300050489 | nmdc:mga03683_31_c1 | nmdc:mga03683_31_c1_34137_34784 | 208 |
| 308 | 3300050490 | nmdc:mga03n38_222_c1 | nmdc:mga03n38_222_c1_10397_11044 | 208 |
| 309 | 3300050491 | nmdc:mga00v17_497382_c1 | nmdc:mga00v17_497382_c1_60_707 | 208 |
| 310 | 3300050493 | nmdc:mga0k408_1427_c1 | nmdc:mga0k408_1427_c1_630_1280 | 208 |
| 311 | 3300050493 | nmdc:mga0k408_18_c1 | nmdc:mga0k408_18_c1_98245_98892 | 208 |
| 312 | 3300050496 | nmdc:mga07m45_19_c1 | nmdc:mga07m45_19_c1_33878_34525 | 208 |
| 313 | 3300050516 | nmdc:mga0sz30_1125_c2 | nmdc:mga0sz30_1125_c2_538_1185 | 208 |
| 314 | 3300053119 | Ga0500595_105371 | Ga0500595_105371_73_708 | 208 |
| 315 | iso_pu_bacteria | 2599185354 | 2600201775 | 208 |
| 316 | iso_pu_bacteria | 2643221560 | 2643820103 | 208 |
| 317 | iso_pu_bacteria | 2643221563 | 2643834471 | 208 |
| 318 | iso_pu_bacteria | 2643221608 | 2644055397 | 208 |
| 319 | iso_pu_bacteria | 2751185897 | 2753767850 | 208 |
| 320 | iso_pu_bacteria | 2852653556 | 2852656355 | 208 |
| 321 | iso_pu_bacteria | 2852680915 | 2852683466 | 208 |
| 322 | 3300005327 | Ga0070658_10000068 | Ga0070658_1000006819 | 209 |
| 323 | 3300005366 | Ga0070659_100002377 | Ga0070659_10000237712 | 209 |
| 324 | 3300005539 | Ga0068853_100157427 | Ga0068853_1001574273 | 209 |
| 325 | 3300005563 | Ga0068855_100057353 | Ga0068855_1000573537 | 209 |
| 326 | 3300005563 | Ga0068855_100064206 | Ga0068855_1000642066 | 209 |
| 327 | 3300005564 | Ga0070664_100029564 | Ga0070664_1000295645 | 209 |
| 328 | 3300005577 | Ga0068857_100489168 | Ga0068857_1004891682 | 209 |
| 329 | 3300005614 | Ga0068856_100007324 | Ga0068856_1000073243 | 209 |
| 330 | 3300005616 | Ga0068852_100000358 | Ga0068852_1000003587 | 209 |
| 331 | 3300005616 | Ga0068852_100041790 | Ga0068852_1000417905 | 209 |
| 332 | 3300009093 | Ga0105240_10002141 | Ga0105240_100021419 | 209 |
| 333 | 3300009545 | Ga0105237_10202735 | Ga0105237_102027352 | 209 |
| 334 | 3300009551 | Ga0105238_10010117 | Ga0105238_100101177 | 209 |
| 335 | 3300013100 | Ga0157373_10002927 | Ga0157373_100029279 | 209 |
| 336 | 3300013100 | Ga0157373_10004669 | Ga0157373_100046697 | 209 |
| 337 | 3300013102 | Ga0157371_10052635 | Ga0157371_100526354 | 209 |
| 338 | 3300014325 | Ga0163163_10601791 | Ga0163163_106017911 | 209 |
| 339 | 3300021384 | Ga0213876_10099446 | Ga0213876_100994461 | 209 |
| 340 | 3300025904 | Ga0207647_10006567 | Ga0207647_100065676 | 209 |
| 341 | 3300025909 | Ga0207705_10000124 | Ga0207705_1000012426 | 209 |
| 342 | 3300025913 | Ga0207695_10001916 | Ga0207695_100019169 | 209 |
| 343 | 3300025924 | Ga0207694_10013918 | Ga0207694_100139182 | 209 |
| 344 | 3300025932 | Ga0207690_10011268 | Ga0207690_100112686 | 209 |
| 345 | 3300025945 | Ga0207679_10527075 | Ga0207679_105270752 | 209 |
| 346 | 3300025949 | Ga0207667_10078092 | Ga0207667_100780922 | 209 |
| 347 | 3300025949 | Ga0207667_10317943 | Ga0207667_103179432 | 209 |
| 348 | 3300026078 | Ga0207702_10004893 | Ga0207702_100048935 | 209 |
| 349 | 3300026142 | Ga0207698_10000067 | Ga0207698_1000006726 | 209 |
| 350 | 3300026142 | Ga0207698_10002681 | Ga0207698_100026818 | 209 |
| 351 | 3300028558 | Ga0265326_10071181 | Ga0265326_100711812 | 209 |
| 352 | 3300028573 | Ga0265334_10049056 | Ga0265334_100490562 | 209 |
| 353 | 3300028800 | Ga0265338_10096777 | Ga0265338_100967772 | 209 |
| 354 | 3300028800 | Ga0265338_10328361 | Ga0265338_103283612 | 209 |
| 355 | 3300031456 | Ga0307513_10000082 | Ga0307513_10000082105 | 209 |
| 356 | 3300031456 | Ga0307513_10001006 | Ga0307513_1000100632 | 209 |
| 357 | 3300031711 | Ga0265314_10164351 | Ga0265314_101643512 | 209 |
| 358 | 3300031824 | Ga0307413_10416133 | Ga0307413_104161331 | 209 |
| 359 | 3300031901 | Ga0307406_10475171 | Ga0307406_104751712 | 209 |
| 360 | 3300031911 | Ga0307412_10258545 | Ga0307412_102585452 | 209 |
| 361 | 3300031911 | Ga0307412_10429171 | Ga0307412_104291711 | 209 |
| 362 | 3300039437 | Ga0436365_1180580 | Ga0436365_1180580_99_743 | 209 |
| 363 | 3300042116 | Ga0450912_004242 | Ga0450912_004242_303_950 | 209 |
| 364 | 3300045051 | Ga0451576_0000041 | Ga0451576_0000041_28762_29415 | 209 |
| 365 | 3300047320 | Ga0495672_0171018 | Ga0495672_0171018_117_764 | 209 |
| 366 | 3300047443 | Ga0495687_117385 | Ga0495687_117385_99_752 | 209 |
| 367 | 3300048918 | Ga0496115_0352992 | Ga0496115_0352992_40_684 | 209 |
| 368 | 3300053091 | Ga0500647_0033753 | Ga0500647_0033753_1100_1753 | 209 |
| 369 | 3300053118 | Ga0500594_0023343 | Ga0500594_0023343_813_1466 | 209 |
| 370 | 3300053121 | Ga0500607_000395 | Ga0500607_000395_38741_39403 | 209 |
| 371 | 3300053122 | Ga0500608_001181 | Ga0500608_001181_6079_6732 | 209 |
| 372 | 3300053123 | Ga0500614_088357 | Ga0500614_088357_142_795 | 209 |
| 373 | 3300053136 | Ga0500559_0001264 | Ga0500559_0001264_2457_3119 | 209 |
| 374 | 3300053138 | Ga0500564_004287 | Ga0500564_004287_2468_3121 | 209 |
| 375 | 3300053140 | Ga0500573_0095506 | Ga0500573_0095506_962_1615 | 209 |
| 376 | 3300053148 | Ga0500590_067366 | Ga0500590_067366_1025_1666 | 209 |
| 377 | 3300053159 | Ga0500630_127388 | Ga0500630_127388_422_1075 | 209 |
| 378 | 3300053178 | Ga0500637_0021573 | Ga0500637_0021573_789_1451 | 209 |
| 379 | 3300053723 | Ga0500567_008334 | Ga0500567_008334_2468_3121 | 209 |
| 380 | 3300053729 | Ga0500625_000009 | Ga0500625_000009_140593_141246 | 209 |
| 381 | 3300001989 | JGI24739J22299_10061409 | JGI24739J22299_100614092 | 210 |
| 382 | 3300005295 | Ga0065707_10096811 | Ga0065707_100968112 | 210 |
| 383 | 3300005329 | Ga0070683_100244796 | Ga0070683_1002447962 | 210 |
| 384 | 3300005336 | Ga0070680_100001399 | Ga0070680_1000013994 | 210 |
| 385 | 3300005338 | Ga0068868_100000184 | Ga0068868_10000018414 | 210 |
| 386 | 3300005339 | Ga0070660_100001498 | Ga0070660_10000149811 | 210 |
| 387 | 3300005339 | Ga0070660_100003201 | Ga0070660_1000032015 | 210 |
| 388 | 3300005339 | Ga0070660_100065395 | Ga0070660_1000653953 | 210 |
| 389 | 3300005344 | Ga0070661_100000009 | Ga0070661_10000000955 | 210 |
| 390 | 3300005347 | Ga0070668_100849010 | Ga0070668_1008490101 | 210 |
| 391 | 3300005353 | Ga0070669_100691377 | Ga0070669_1006913771 | 210 |
| 392 | 3300005354 | Ga0070675_100007629 | Ga0070675_10000762910 | 210 |
| 393 | 3300005366 | Ga0070659_100000009 | Ga0070659_10000000942 | 210 |
| 394 | 3300005366 | Ga0070659_100000979 | Ga0070659_10000097923 | 210 |
| 395 | 3300005366 | Ga0070659_100004263 | Ga0070659_1000042631 | 210 |
| 396 | 3300005530 | Ga0070679_100000031 | Ga0070679_10000003198 | 210 |
| 397 | 3300005544 | Ga0070686_100001770 | Ga0070686_10000177016 | 210 |
| 398 | 3300005548 | Ga0070665_100000145 | Ga0070665_10000014561 | 210 |
| 399 | 3300005548 | Ga0070665_100088206 | Ga0070665_1000882062 | 210 |
| 400 | 3300005617 | Ga0068859_100058571 | Ga0068859_1000585712 | 210 |
| 401 | 3300005617 | Ga0068859_100250968 | Ga0068859_1002509682 | 210 |
| 402 | 3300005719 | Ga0068861_100495016 | Ga0068861_1004950162 | 210 |
| 403 | 3300005843 | Ga0068860_100111640 | Ga0068860_1001116402 | 210 |
| 404 | 3300005981 | Ga0081538_10125636 | Ga0081538_101256362 | 210 |
| 405 | 3300006042 | Ga0075368_10000154 | Ga0075368_1000015423 | 210 |
| 406 | 3300006051 | Ga0075364_10114330 | Ga0075364_101143301 | 210 |
| 407 | 3300006177 | Ga0075362_10004729 | Ga0075362_100047293 | 210 |
| 408 | 3300006186 | Ga0075369_10065933 | Ga0075369_100659331 | 210 |
| 409 | 3300006931 | Ga0097620_100058572 | Ga0097620_1000585722 | 210 |
| 410 | 3300006931 | Ga0097620_100250968 | Ga0097620_1002509683 | 210 |
| 411 | 3300009094 | Ga0111539_10360572 | Ga0111539_103605723 | 210 |
| 412 | 3300009551 | Ga0105238_10462754 | Ga0105238_104627542 | 210 |
| 413 | 3300009553 | Ga0105249_10046691 | Ga0105249_100466916 | 210 |
| 414 | 3300013105 | Ga0157369_10005499 | Ga0157369_1000549910 | 210 |
| 415 | 3300013105 | Ga0157369_10451425 | Ga0157369_104514252 | 210 |
| 416 | 3300013306 | Ga0163162_10021427 | Ga0163162_100214276 | 210 |
| 417 | 3300014326 | Ga0157380_10106324 | Ga0157380_101063242 | 210 |
| 418 | 3300020070 | Ga0206356_11230827 | Ga0206356_112308273 | 210 |
| 419 | 3300020081 | Ga0206354_11303983 | Ga0206354_113039835 | 210 |
| 420 | 3300020082 | Ga0206353_11106162 | Ga0206353_111061621 | 210 |
| 421 | 3300021358 | Ga0213873_10000065 | Ga0213873_1000006528 | 210 |
| 422 | 3300021384 | Ga0213876_10000005 | Ga0213876_1000000528 | 210 |
| 423 | 3300021384 | Ga0213876_10016540 | Ga0213876_100165404 | 210 |
| 424 | 3300025893 | Ga0207682_10000110 | Ga0207682_1000011031 | 210 |
| 425 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002417 | 210 |
| 426 | 3300025912 | Ga0207707_10208518 | Ga0207707_102085183 | 210 |
| 427 | 3300025917 | Ga0207660_10001170 | Ga0207660_100011705 | 210 |
| 428 | 3300025918 | Ga0207662_10326025 | Ga0207662_103260252 | 210 |
| 429 | 3300025919 | Ga0207657_10001047 | Ga0207657_1000104718 | 210 |
| 430 | 3300025919 | Ga0207657_10006540 | Ga0207657_100065407 | 210 |
| 431 | 3300025919 | Ga0207657_10075234 | Ga0207657_100752343 | 210 |
| 432 | 3300025920 | Ga0207649_10000035 | Ga0207649_10000035118 | 210 |
| 433 | 3300025921 | Ga0207652_10000003 | Ga0207652_10000003458 | 210 |
| 434 | 3300025923 | Ga0207681_10130551 | Ga0207681_101305512 | 210 |
| 435 | 3300025924 | Ga0207694_10212342 | Ga0207694_102123422 | 210 |
| 436 | 3300025926 | Ga0207659_10014093 | Ga0207659_100140935 | 210 |
| 437 | 3300025926 | Ga0207659_10504123 | Ga0207659_105041232 | 210 |
| 438 | 3300025927 | Ga0207687_10017850 | Ga0207687_100178503 | 210 |
| 439 | 3300025931 | Ga0207644_10013457 | Ga0207644_100134573 | 210 |
| 440 | 3300025932 | Ga0207690_10000022 | Ga0207690_10000022203 | 210 |
| 441 | 3300025932 | Ga0207690_10000522 | Ga0207690_1000052234 | 210 |
| 442 | 3300025932 | Ga0207690_10006068 | Ga0207690_1000606810 | 210 |
| 443 | 3300025935 | Ga0207709_10152572 | Ga0207709_101525722 | 210 |
| 444 | 3300025942 | Ga0207689_10556882 | Ga0207689_105568822 | 210 |
| 445 | 3300025944 | Ga0207661_10171190 | Ga0207661_101711902 | 210 |
| 446 | 3300025960 | Ga0207651_10765668 | Ga0207651_107656681 | 210 |
| 447 | 3300025981 | Ga0207640_10235677 | Ga0207640_102356771 | 210 |
| 448 | 3300025986 | Ga0207658_10662154 | Ga0207658_106621541 | 210 |
| 449 | 3300026023 | Ga0207677_10000051 | Ga0207677_1000005197 | 210 |
| 450 | 3300026041 | Ga0207639_10278785 | Ga0207639_102787852 | 210 |
| 451 | 3300026075 | Ga0207708_10221399 | Ga0207708_102213992 | 210 |
| 452 | 3300027665 | Ga0209983_1007699 | Ga0209983_10076991 | 210 |
| 453 | 3300028379 | Ga0268266_10000173 | Ga0268266_1000017386 | 210 |
| 454 | 3300028381 | Ga0268264_10618457 | Ga0268264_106184572 | 210 |
| 455 | 3300031456 | Ga0307513_10394843 | Ga0307513_103948432 | 210 |
| 456 | 3300031548 | Ga0307408_100047436 | Ga0307408_1000474362 | 210 |
| 457 | 3300031731 | Ga0307405_10169729 | Ga0307405_101697292 | 210 |
| 458 | 3300031852 | Ga0307410_10280063 | Ga0307410_102800632 | 210 |
| 459 | 3300031852 | Ga0307410_10320929 | Ga0307410_103209292 | 210 |
| 460 | 3300031911 | Ga0307412_10252537 | Ga0307412_102525372 | 210 |
| 461 | 3300031911 | Ga0307412_10423302 | Ga0307412_104233022 | 210 |
| 462 | 3300032002 | Ga0307416_100412784 | Ga0307416_1004127841 | 210 |
| 463 | 3300032002 | Ga0307416_100620087 | Ga0307416_1006200871 | 210 |
| 464 | 3300032004 | Ga0307414_10086509 | Ga0307414_100865091 | 210 |
| 465 | 3300032004 | Ga0307414_10472896 | Ga0307414_104728962 | 210 |
| 466 | 3300032005 | Ga0307411_10233615 | Ga0307411_102336152 | 210 |
| 467 | 3300039437 | Ga0436365_0591960 | Ga0436365_0591960_1720_2352 | 210 |
| 468 | 3300039437 | Ga0436365_1369819 | Ga0436365_1369819_17290_17922 | 210 |
| 469 | 3300039453 | Ga0436362_0037733 | Ga0436362_0037733_17440_18072 | 210 |
| 470 | 3300041443 | Ga0451789_0484133 | Ga0451789_0484133_258_893 | 210 |
| 471 | 3300046537 | Ga0495598_0060091 | Ga0495598_0060091_383_1015 | 210 |
| 472 | 3300046616 | Ga0495668_0092470 | Ga0495668_0092470_105_779 | 210 |
| 473 | 3300047472 | Ga0495686_0072656 | Ga0495686_0072656_674_1306 | 210 |
| 474 | 3300048917 | Ga0496114_0038363 | Ga0496114_0038363_901_1533 | 210 |
| 475 | 3300048929 | Ga0496126_0410699 | Ga0496126_0410699_229_888 | 210 |
| 476 | 3300049571 | Ga0501034_0095274 | Ga0501034_0095274_310_942 | 210 |
| 477 | 3300049571 | Ga0501034_0142260 | Ga0501034_0142260_1330_1962 | 210 |
| 478 | 3300049571 | Ga0501034_0273929 | Ga0501034_0273929_192_845 | 210 |
| 479 | 3300049579 | Ga0501043_0352023 | Ga0501043_0352023_67_699 | 210 |
| 480 | 3300049579 | Ga0501043_0472285 | Ga0501043_0472285_50_700 | 210 |
| 481 | 3300049580 | Ga0501046_0573486 | Ga0501046_0573486_140_772 | 210 |
| 482 | 3300049581 | Ga0501047_0090006 | Ga0501047_0090006_2226_2879 | 210 |
| 483 | 3300049581 | Ga0501047_0568972 | Ga0501047_0568972_267_899 | 210 |
| 484 | 3300049585 | Ga0501069_0018158 | Ga0501069_0018158_793_1425 | 210 |
| 485 | 3300049586 | Ga0501070_0091157 | Ga0501070_0091157_55_687 | 210 |
| 486 | 3300049742 | Ga0501080_0141159 | Ga0501080_0141159_871_1524 | 210 |
| 487 | 3300049744 | Ga0501083_0179044 | Ga0501083_0179044_10_663 | 210 |
| 488 | 3300049823 | Ga0501044_0000730 | Ga0501044_0000730_33587_34237 | 210 |
| 489 | 3300050489 | nmdc:mga03683_11679_c1 | nmdc:mga03683_11679_c1_870_1538 | 210 |
| 490 | 3300050490 | nmdc:mga03n38_3692_c1 | nmdc:mga03n38_3692_c1_2142_2795 | 210 |
| 491 | 3300050491 | nmdc:mga00v17_13083_c1 | nmdc:mga00v17_13083_c1_3341_4009 | 210 |
| 492 | 3300050493 | nmdc:mga0k408_13523_c1 | nmdc:mga0k408_13523_c1_2799_3452 | 210 |
| 493 | 3300050495 | nmdc:mga04h51_641_c1 | nmdc:mga04h51_641_c1_3604_4257 | 210 |
| 494 | 3300050496 | nmdc:mga07m45_299961_c1 | nmdc:mga07m45_299961_c1_97_765 | 210 |
| 495 | 3300050496 | nmdc:mga07m45_7_c1 | nmdc:mga07m45_7_c1_105471_106124 | 210 |
| 496 | 3300050516 | nmdc:mga0sz30_14312_c1 | nmdc:mga0sz30_14312_c1_554_1222 | 210 |
| 497 | 3300050516 | nmdc:mga0sz30_4304_c1 | nmdc:mga0sz30_4304_c1_3452_4105 | 210 |
| 498 | 3300053121 | Ga0500607_000854 | Ga0500607_000854_7247_7906 | 210 |
| 499 | 3300053139 | Ga0500568_0056679 | Ga0500568_0056679_214_882 | 210 |
| 500 | 3300053142 | Ga0500577_0103196 | Ga0500577_0103196_216_860 | 210 |
| 501 | 3300053148 | Ga0500590_000464 | Ga0500590_000464_11277_11948 | 210 |
| 502 | 3300053178 | Ga0500637_0185373 | Ga0500637_0185373_403_1074 | 210 |
| 503 | 3300053730 | Ga0500645_011510 | Ga0500645_011510_1029_1682 | 210 |
| 504 | 3300048904 | Ga0496101_0067094 | Ga0496101_0067094_1151_1897 | 211 |
| 505 | 3300048924 | Ga0496121_0000070 | Ga0496121_0000070_145552_146223 | 211 |
| 506 | 3300003781 | Ga0055536_1006407 | Ga0055536_10064073 | 212 |
| 507 | 3300003784 | Ga0055534_1003173 | Ga0055534_10031734 | 212 |
| 508 | 3300003791 | Ga0055530_10000710 | Ga0055530_1000071014 | 212 |
| 509 | 3300003794 | Ga0055531_10000900 | Ga0055531_1000090011 | 212 |
| 510 | 3300003794 | Ga0055531_10009818 | Ga0055531_100098186 | 212 |
| 511 | 3300005456 | Ga0070678_100469301 | Ga0070678_1004693012 | 212 |
| 512 | 3300005457 | Ga0070662_100248859 | Ga0070662_1002488592 | 212 |
| 513 | 3300005548 | Ga0070665_100000541 | Ga0070665_10000054130 | 212 |
| 514 | 3300005618 | Ga0068864_100033644 | Ga0068864_1000336443 | 212 |
| 515 | 3300005842 | Ga0068858_100000771 | Ga0068858_10000077137 | 212 |
| 516 | 3300009177 | Ga0105248_10027636 | Ga0105248_100276362 | 212 |
| 517 | 3300013308 | Ga0157375_10885116 | Ga0157375_108851161 | 212 |
| 518 | 3300014325 | Ga0163163_10446799 | Ga0163163_104467992 | 212 |
| 519 | 3300021384 | Ga0213876_10005473 | Ga0213876_100054737 | 212 |
| 520 | 3300025291 | Ga0209675_1001522 | Ga0209675_100152212 | 212 |
| 521 | 3300025292 | Ga0209676_1000273 | Ga0209676_1000273106 | 212 |
| 522 | 3300025292 | Ga0209676_1000402 | Ga0209676_10004028 | 212 |
| 523 | 3300025292 | Ga0209676_1000667 | Ga0209676_100066730 | 212 |
| 524 | 3300025292 | Ga0209676_1031770 | Ga0209676_10317704 | 212 |
| 525 | 3300025294 | Ga0209025_1023201 | Ga0209025_10232014 | 212 |
| 526 | 3300025298 | Ga0209050_1000637 | Ga0209050_100063716 | 212 |
| 527 | 3300025298 | Ga0209050_1003693 | Ga0209050_10036933 | 212 |
| 528 | 3300025304 | Ga0209257_1000248 | Ga0209257_1000248112 | 212 |
| 529 | 3300025304 | Ga0209257_1000435 | Ga0209257_100043536 | 212 |
| 530 | 3300025304 | Ga0209257_1038844 | Ga0209257_10388441 | 212 |
| 531 | 3300025315 | Ga0207697_10046240 | Ga0207697_100462403 | 212 |
| 532 | 3300025933 | Ga0207706_10250049 | Ga0207706_102500492 | 212 |
| 533 | 3300025941 | Ga0207711_10008830 | Ga0207711_100088308 | 212 |
| 534 | 3300025961 | Ga0207712_10192312 | Ga0207712_101923122 | 212 |
| 535 | 3300026035 | Ga0207703_10001689 | Ga0207703_100016893 | 212 |
| 536 | 3300026095 | Ga0207676_10001553 | Ga0207676_1000155317 | 212 |
| 537 | 3300026121 | Ga0207683_10167776 | Ga0207683_101677764 | 212 |
| 538 | 3300028379 | Ga0268266_10001687 | Ga0268266_1000168721 | 212 |
| 539 | 3300031548 | Ga0307408_100151379 | Ga0307408_1001513792 | 212 |
| 540 | 3300031731 | Ga0307405_10304888 | Ga0307405_103048882 | 212 |
| 541 | 3300031731 | Ga0307405_10643660 | Ga0307405_106436601 | 212 |
| 542 | 3300031901 | Ga0307406_10138865 | Ga0307406_101388651 | 212 |
| 543 | 3300031901 | Ga0307406_10576199 | Ga0307406_105761991 | 212 |
| 544 | 3300031911 | Ga0307412_10016837 | Ga0307412_100168374 | 212 |
| 545 | 3300031911 | Ga0307412_10038066 | Ga0307412_100380662 | 212 |
| 546 | 3300031911 | Ga0307412_10042957 | Ga0307412_100429573 | 212 |
| 547 | 3300031911 | Ga0307412_10130868 | Ga0307412_101308682 | 212 |
| 548 | 3300032004 | Ga0307414_10001014 | Ga0307414_1000101411 | 212 |
| 549 | 3300032004 | Ga0307414_10123950 | Ga0307414_101239503 | 212 |
| 550 | 3300032004 | Ga0307414_10132494 | Ga0307414_101324942 | 212 |
| 551 | 3300032004 | Ga0307414_10485509 | Ga0307414_104855092 | 212 |
| 552 | 3300036401 | Ga0373937_0506291 | Ga0373937_0506291_211_864 | 212 |
| 553 | 3300039437 | Ga0436365_0058666 | Ga0436365_0058666_5886_6545 | 212 |
| 554 | 3300041453 | Ga0451797_0437705 | Ga0451797_0437705_184_846 | 212 |
| 555 | 3300041509 | Ga0451843_0412542 | Ga0451843_0412542_184_846 | 212 |
| 556 | 3300046522 | Ga0495643_0068442 | Ga0495643_0068442_546_1208 | 212 |
| 557 | 3300046616 | Ga0495668_0000087 | Ga0495668_0000087_118817_119479 | 212 |
| 558 | 3300046660 | Ga0495625_0000726 | Ga0495625_0000726_7451_8113 | 212 |
| 559 | 3300046660 | Ga0495625_0062479 | Ga0495625_0062479_1698_2336 | 212 |
| 560 | 3300048921 | Ga0496118_0221949 | Ga0496118_0221949_190_840 | 212 |
| 561 | 3300048924 | Ga0496121_0000201 | Ga0496121_0000201_117423_118073 | 212 |
| 562 | 3300049568 | Ga0501031_0206951 | Ga0501031_0206951_532_1194 | 212 |
| 563 | 3300049569 | Ga0501032_0033845 | Ga0501032_0033845_1323_1985 | 212 |
| 564 | 3300049570 | Ga0501033_0026706 | Ga0501033_0026706_1600_2262 | 212 |
| 565 | 3300049571 | Ga0501034_0042149 | Ga0501034_0042149_3737_4399 | 212 |
| 566 | 3300049572 | Ga0501036_0122570 | Ga0501036_0122570_105_767 | 212 |
| 567 | 3300049573 | Ga0501037_0103407 | Ga0501037_0103407_490_1152 | 212 |
| 568 | 3300049574 | Ga0501038_0302257 | Ga0501038_0302257_540_1202 | 212 |
| 569 | 3300049575 | Ga0501039_0080056 | Ga0501039_0080056_1383_2045 | 212 |
| 570 | 3300049579 | Ga0501043_0077104 | Ga0501043_0077104_544_1206 | 212 |
| 571 | 3300049581 | Ga0501047_0114509 | Ga0501047_0114509_1834_2484 | 212 |
| 572 | 3300049581 | Ga0501047_0147683 | Ga0501047_0147683_917_1579 | 212 |
| 573 | 3300049581 | Ga0501047_0530800 | Ga0501047_0530800_94_744 | 212 |
| 574 | 3300049822 | Ga0501035_0341658 | Ga0501035_0341658_373_1023 | 212 |
| 575 | 3300049823 | Ga0501044_0219726 | Ga0501044_0219726_189_839 | 212 |
| 576 | 3300049824 | Ga0501045_0097025 | Ga0501045_0097025_174_836 | 212 |
| 577 | 3300053116 | Ga0500592_015481 | Ga0500592_015481_361_1023 | 212 |
| 578 | 3300053139 | Ga0500568_0000814 | Ga0500568_0000814_5033_5695 | 212 |
| 579 | 3300053139 | Ga0500568_0014556 | Ga0500568_0014556_2771_3409 | 212 |
| 580 | 3300053140 | Ga0500573_0207981 | Ga0500573_0207981_218_859 | 212 |
| 581 | 3300053151 | Ga0500604_0000007 | Ga0500604_0000007_94704_95342 | 212 |
| 582 | 3300053151 | Ga0500604_0037163 | Ga0500604_0037163_473_1135 | 212 |
| 583 | 3300053153 | Ga0500616_0000080 | Ga0500616_0000080_175141_175779 | 212 |
| 584 | 3300053158 | Ga0500627_0000035 | Ga0500627_0000035_35825_36487 | 212 |
| 585 | 3300053739 | Ga0500587_000415 | Ga0500587_000415_663_1301 | 212 |
| 586 | 3300013307 | Ga0157372_10771293 | Ga0157372_107712932 | 213 |
| 587 | 3300028786 | Ga0307517_10138615 | Ga0307517_101386152 | 213 |
| 588 | 3300033180 | Ga0307510_10004202 | Ga0307510_1000420219 | 213 |
| 589 | 3300039450 | Ga0436363_0049765 | Ga0436363_0049765_619_1293 | 213 |
| 590 | 3300042004 | Ga0439445_0017912 | Ga0439445_0017912_383_1069 | 213 |
| 591 | 3300044694 | Ga0466963_0123449 | Ga0466963_0123449_361_1071 | 213 |
| 592 | 3300046691 | Ga0495670_0006827 | Ga0495670_0006827_4317_4982 | 213 |
| 593 | 3300046694 | Ga0495649_0067010 | Ga0495649_0067010_342_1049 | 213 |
| 594 | 3300053087 | Ga0500643_005450 | Ga0500643_005450_2567_3226 | 213 |
| 595 | 3300053136 | Ga0500559_0038539 | Ga0500559_0038539_999_1658 | 213 |
| 596 | 3300000549 | LJQas_1006349 | LJQas_10063492 | 215 |
| 597 | 3300017792 | Ga0163161_10241234 | Ga0163161_102412342 | 215 |
| 598 | 3300031824 | Ga0307413_10608309 | Ga0307413_106083091 | 215 |
| 599 | 3300039437 | Ga0436365_1229924 | Ga0436365_1229924_468_1136 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yki-assembly1.cif.gz_A | crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide | 0.9665 | 44 | 94 |
| 7luy-assembly1.cif.gz_F | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9415 | 11 | 215 |
| 7luy-assembly1.cif.gz_F | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.932 | 11 | 215 |
| 7luy-assembly2.cif.gz_E | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9256 | 11 | 215 |
| 7luy-assembly2.cif.gz_E | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9168 | 11 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9951 | 46 | 92 | 3.30.63.10 |
| 2qorA02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9878 | 46 | 101 | 3.30.63.10 |
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9796 | 46 | 94 | 3.30.63.10 |
| 1s4qA02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9565 | 46 | 100 | 3.30.63.10 |
| af_Q5TCQ9_142_196_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9499 | 44 | 94 | 3.30.63.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0IFV5-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9807 | 11 | 202 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A2K9P5S6-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9737 | 13 | 195 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A1VKF2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9712 | 11 | 198 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A2E0NG25-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9695 | 11 | 196 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A3C1YTT2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9676 | 12 | 197 |
GO:0004385
GO:0005524 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar