F467912

General Info

Members Datasets Scaffolds Average Seq Length
599 297 586 213

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0067094|Ga0496101_0067094_1151_1897
Length 248
Sequence MKSSTSSPARAEAEAAPAAENSPRPLDLPPRFAPRAAMASDTLHRRGLMFILSSPSGAGKTTIARRLLAEDREIAMSVSATTRPMRPGEVEGKDYHFVSQPEFDRMVEANEFYEWAHVFGHSYGTPKSHIRAALKDGQDFLFDIDWQGTQQLYQKAERDVVRVFILPPSLDELQRRLVGRGTDSAEIIAARMARAQAEISHWDGYDYVVVNDDVEACFGKVREILAAERMRRTRQTGLIDFVRELTRS

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
6 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
13 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
14 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
192 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
199 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
276 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
282 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
295 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.5
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.19
Nodule 0.33
Rhizoplane 3.51
Rhizosphere 74.29
Stem 0
Stem Tuber 0
Unclassified 8.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006349 3300000549 Bacteria 1474
2 JGI24740J21852_10076201 3300001979 Bacteria 887
3 JGI24739J22299_10061409 3300001989 Bacteria 1187
4 JGI24034J26672_10028901 3300002239 Bacteria 896
5 JGI24034J26672_10039392 3300002239 Bacteria 790
6 JGI24751J29686_10000154 3300002459 Bacteria 32923
7 Ga0055536_1006407 3300003781 Bacteria 5506
8 Ga0055534_1003173 3300003784 Bacteria 5317
9 Ga0055530_10000710 3300003791 Bacteria 28052
10 Ga0055531_10000900 3300003794 Bacteria 24231
11 Ga0055531_10009818 3300003794 Bacteria 4849
12 Ga0065707_10096811 3300005295 Bacteria 3231
13 Ga0070658_10000068 3300005327 Bacteria 102788
14 Ga0070658_10026423 3300005327 Bacteria 4657
15 Ga0070658_10123341 3300005327 Bacteria 2154
16 Ga0070658_10313043 3300005327 Bacteria 1340
17 Ga0070658_10508661 3300005327 Bacteria 1041
18 Ga0070683_100244796 3300005329 Bacteria 1705
19 Ga0070683_100405324 3300005329 Bacteria 1300
20 Ga0070690_100022470 3300005330 Bacteria 3859
21 Ga0070670_100041862 3300005331 Bacteria 3937
22 Ga0070670_100407414 3300005331 Bacteria 1201
23 Ga0070677_10268384 3300005333 Bacteria 855
24 Ga0070666_10037423 3300005335 Bacteria 3226
25 Ga0070666_10136157 3300005335 Bacteria 1709
26 Ga0070680_100001399 3300005336 Bacteria 17424
27 Ga0070680_100001683 3300005336 Bacteria 16198
28 Ga0070682_100027871 3300005337 Bacteria 3393
29 Ga0068868_100000184 3300005338 Bacteria 41969
30 Ga0070660_100001498 3300005339 Bacteria 15998
31 Ga0070660_100002033 3300005339 Bacteria 13954
32 Ga0070660_100003201 3300005339 Bacteria 11252
33 Ga0070660_100065395 3300005339 Bacteria 2830
34 Ga0070661_100000009 3300005344 Bacteria 181351
35 Ga0070661_100001882 3300005344 Bacteria 14532
36 Ga0070661_100105137 3300005344 Bacteria 2104
37 Ga0070692_10094346 3300005345 Bacteria 1631
38 Ga0070668_100000048 3300005347 Bacteria 75276
39 Ga0070668_100134495 3300005347 Bacteria 1987
40 Ga0070668_100180957 3300005347 Bacteria 1722
41 Ga0070668_100238134 3300005347 Bacteria 1506
42 Ga0070668_100849010 3300005347 Bacteria 814
43 Ga0070669_100000472 3300005353 Bacteria 30562
44 Ga0070669_100691377 3300005353 Bacteria 861
45 Ga0070675_100007629 3300005354 Bacteria 8371
46 Ga0070671_100000067 3300005355 Bacteria 70750
47 Ga0070671_100000532 3300005355 Bacteria 26743
48 Ga0070671_100004246 3300005355 Bacteria 11342
49 Ga0070659_100000009 3300005366 Bacteria 203891
50 Ga0070659_100000979 3300005366 Bacteria 20993
51 Ga0070659_100002377 3300005366 Bacteria 13375
52 Ga0070659_100004263 3300005366 Bacteria 10207
53 Ga0070659_100077995 3300005366 Bacteria 2643
54 Ga0070659_100138493 3300005366 Bacteria 1980
55 Ga0070667_100000167 3300005367 Bacteria 82055
56 Ga0070667_100003664 3300005367 Bacteria 13079
57 Ga0070667_100018045 3300005367 Bacteria 5848
58 Ga0070663_100016991 3300005455 Bacteria 4738
59 Ga0070663_100025285 3300005455 Bacteria 4006
60 Ga0070678_100469301 3300005456 Bacteria 1105
61 Ga0070662_100001446 3300005457 Bacteria 14637
62 Ga0070662_100003248 3300005457 Bacteria 10110
63 Ga0070662_100248859 3300005457 Bacteria 1428
64 Ga0070681_10008385 3300005458 Bacteria 10120
65 Ga0070681_10720379 3300005458 Bacteria 914
66 Ga0070706_100330670 3300005467 Bacteria 1421
67 Ga0070679_100000031 3300005530 Bacteria 107526
68 Ga0070679_100005037 3300005530 Bacteria 12195
69 Ga0070679_100033039 3300005530 Bacteria 5120
70 Ga0070679_100230721 3300005530 Bacteria 1811
71 Ga0070679_100859258 3300005530 Bacteria 851
72 Ga0070684_100007437 3300005535 Bacteria 8514
73 Ga0070684_100404689 3300005535 Bacteria 1258
74 Ga0068853_100002549 3300005539 Bacteria 13684
75 Ga0068853_100157427 3300005539 Bacteria 2047
76 Ga0068853_100286382 3300005539 Bacteria 1520
77 Ga0070686_100001770 3300005544 Bacteria 12065
78 Ga0070686_100011498 3300005544 Bacteria 5021
79 Ga0070665_100000145 3300005548 Bacteria 131599
80 Ga0070665_100000541 3300005548 Bacteria 53057
81 Ga0070665_100007174 3300005548 Bacteria 11332
82 Ga0070665_100088206 3300005548 Bacteria 3108
83 Ga0070665_100115291 3300005548 Bacteria 2689
84 Ga0068855_100018885 3300005563 Bacteria 8287
85 Ga0068855_100034692 3300005563 Bacteria 6013
86 Ga0068855_100057353 3300005563 Bacteria 4565
87 Ga0068855_100061409 3300005563 Bacteria 4391
88 Ga0068855_100064206 3300005563 Bacteria 4282
89 Ga0068855_100135070 3300005563 Bacteria 2815
90 Ga0068855_100287646 3300005563 Bacteria 1823
91 Ga0070664_100029564 3300005564 Bacteria 4568
92 Ga0070664_100119757 3300005564 Bacteria 2304
93 Ga0070664_100446009 3300005564 Bacteria 1188
94 Ga0068857_100106632 3300005577 Bacteria 2516
95 Ga0068857_100431439 3300005577 Bacteria 1230
96 Ga0068857_100454158 3300005577 Bacteria 1198
97 Ga0068857_100489168 3300005577 Bacteria 1154
98 Ga0068857_100966506 3300005577 Bacteria 819
99 Ga0068854_100009343 3300005578 Bacteria 6330
100 Ga0068856_100007324 3300005614 Bacteria 10770
101 Ga0068856_100007858 3300005614 Bacteria 10417
102 Ga0068852_100000358 3300005616 Bacteria 30765
103 Ga0068852_100041790 3300005616 Bacteria 3877
104 Ga0068852_100127539 3300005616 Bacteria 2339
105 Ga0068852_100224005 3300005616 Bacteria 1790
106 Ga0068859_100003997 3300005617 Bacteria 15032
107 Ga0068859_100058571 3300005617 Bacteria 3880
108 Ga0068859_100242513 3300005617 Bacteria 1892
109 Ga0068859_100250968 3300005617 Bacteria 1860
110 Ga0068864_100033644 3300005618 Bacteria 4359
111 Ga0068864_100141990 3300005618 Bacteria 2167
112 Ga0068861_100495016 3300005719 Bacteria 1104
113 Ga0068851_10228520 3300005834 Bacteria 1048
114 Ga0068863_100000017 3300005841 Bacteria 207950
115 Ga0068863_100000103 3300005841 Bacteria 91380
116 Ga0068863_100395774 3300005841 Bacteria 1350
117 Ga0068858_100000771 3300005842 Bacteria 33416
118 Ga0068858_100001121 3300005842 Bacteria 27733
119 Ga0068858_100074898 3300005842 Bacteria 3143
120 Ga0068858_100090543 3300005842 Bacteria 2847
121 Ga0068860_100000093 3300005843 Bacteria 150034
122 Ga0068860_100076723 3300005843 Bacteria 3178
123 Ga0068860_100101357 3300005843 Bacteria 2747
124 Ga0068860_100111640 3300005843 Bacteria 2614
125 Ga0068862_100025994 3300005844 Bacteria 4919
126 Ga0068862_100065022 3300005844 Bacteria 3141
127 Ga0068862_100182342 3300005844 Bacteria 1885
128 Ga0081538_10125636 3300005981 Bacteria 1220
129 Ga0081539_10031210 3300005985 Bacteria 3289
130 Ga0075368_10000154 3300006042 Bacteria 18483
131 Ga0075363_100006123 3300006048 Bacteria 5432
132 Ga0075364_10035300 3300006051 Bacteria 3231
133 Ga0075364_10114330 3300006051 Bacteria 1803
134 Ga0075432_10010664 3300006058 Bacteria 3123
135 Ga0075362_10000011 3300006177 Bacteria 108953
136 Ga0075362_10004729 3300006177 Bacteria 4917
137 Ga0075367_10433997 3300006178 Bacteria 832
138 Ga0075369_10058793 3300006186 Bacteria 1674
139 Ga0075369_10065933 3300006186 Bacteria 1587
140 Ga0075366_10000190 3300006195 Bacteria 27138
141 Ga0075366_10017228 3300006195 Bacteria 4156
142 Ga0075366_10086040 3300006195 Bacteria 1881
143 Ga0075370_10000004 3300006353 Bacteria 121166
144 Ga0075430_100490504 3300006846 Bacteria 1014
145 Ga0075431_100000392 3300006847 Bacteria 35161
146 Ga0075429_100045313 3300006880 Bacteria 3826
147 Ga0097620_100003997 3300006931 Bacteria 15032
148 Ga0097620_100058572 3300006931 Bacteria 3880
149 Ga0097620_100242491 3300006931 Bacteria 1892
150 Ga0097620_100250968 3300006931 Bacteria 1860
151 Ga0079104_1020081 3300006946 Bacteria 1851
152 Ga0105240_10002141 3300009093 Bacteria 32242
153 Ga0111539_10360572 3300009094 Bacteria 1692
154 Ga0105243_10249271 3300009148 Bacteria 1584
155 Ga0105241_10042269 3300009174 Bacteria 3447
156 Ga0105248_10027636 3300009177 Bacteria 6319
157 Ga0105248_10080346 3300009177 Bacteria 3665
158 Ga0105248_10096944 3300009177 Bacteria 3322
159 Ga0105248_10191968 3300009177 Bacteria 2301
160 Ga0105237_10202735 3300009545 Bacteria 1984
161 Ga0105238_10010117 3300009551 Bacteria 9456
162 Ga0105238_10462754 3300009551 Bacteria 1266
163 Ga0105249_10046691 3300009553 Bacteria 3942
164 Ga0105249_10101016 3300009553 Bacteria 2713
165 Ga0105246_10000137 3300011119 Bacteria 34064
166 Ga0157373_10002927 3300013100 Bacteria 12934
167 Ga0157373_10004669 3300013100 Bacteria 10305
168 Ga0157373_10039391 3300013100 Bacteria 3384
169 Ga0157373_10121063 3300013100 Bacteria 1839
170 Ga0157373_10280455 3300013100 Bacteria 1181
171 Ga0157371_10009329 3300013102 Bacteria 7734
172 Ga0157371_10052635 3300013102 Bacteria 2891
173 Ga0157371_10090878 3300013102 Bacteria 2162
174 Ga0157371_10149686 3300013102 Bacteria 1664
175 Ga0157370_10016607 3300013104 Bacteria 7448
176 Ga0157369_10001072 3300013105 Bacteria 34302
177 Ga0157369_10005499 3300013105 Bacteria 14721
178 Ga0157369_10451425 3300013105 Bacteria 1331
179 Ga0163162_10021427 3300013306 Bacteria 6365
180 Ga0163162_10191791 3300013306 Bacteria 2171
181 Ga0157372_10004382 3300013307 Bacteria 15061
182 Ga0157372_10395557 3300013307 Bacteria 1610
183 Ga0157372_10771293 3300013307 Bacteria 1118
184 Ga0157375_10784652 3300013308 Bacteria 1102
185 Ga0157375_10885116 3300013308 Bacteria 1038
186 Ga0163163_10446799 3300014325 Bacteria 1353
187 Ga0163163_10469272 3300014325 Bacteria 1319
188 Ga0163163_10601791 3300014325 Bacteria 1162
189 Ga0157380_10091084 3300014326 Bacteria 2517
190 Ga0157380_10106324 3300014326 Bacteria 2348
191 Ga0157379_10089128 3300014968 Bacteria 2767
192 Ga0163161_10241234 3300017792 Bacteria 1406
193 Ga0206356_11230827 3300020070 Bacteria 1978
194 Ga0206354_11303983 3300020081 Bacteria 3470
195 Ga0206353_11106162 3300020082 Bacteria 4265
196 Ga0213873_10000065 3300021358 Bacteria 23450
197 Ga0213874_10018530 3300021377 Bacteria 1883
198 Ga0213876_10000005 3300021384 Bacteria 727326
199 Ga0213876_10000134 3300021384 Bacteria 80875
200 Ga0213876_10005473 3300021384 Bacteria 6973
201 Ga0213876_10016540 3300021384 Bacteria 3899
202 Ga0213876_10099446 3300021384 Bacteria 1542
203 Ga0213876_10169798 3300021384 Bacteria 1160
204 Ga0209675_1001522 3300025291 Bacteria 13230
205 Ga0209676_1000273 3300025292 Bacteria 107724
206 Ga0209676_1000402 3300025292 Bacteria 78796
207 Ga0209676_1000667 3300025292 Bacteria 49009
208 Ga0209676_1031770 3300025292 Bacteria 1595
209 Ga0209025_1023201 3300025294 Bacteria 3253
210 Ga0209050_1000637 3300025298 Bacteria 54380
211 Ga0209050_1001280 3300025298 Bacteria 28715
212 Ga0209050_1003693 3300025298 Bacteria 11029
213 Ga0209257_1000248 3300025304 Bacteria 125170
214 Ga0209257_1000435 3300025304 Bacteria 80311
215 Ga0209257_1038844 3300025304 Bacteria 1437
216 Ga0207697_10046240 3300025315 Bacteria 1792
217 Ga0207656_10219507 3300025321 Bacteria 924
218 Ga0207656_10230892 3300025321 Bacteria 902
219 Ga0207682_10000110 3300025893 Bacteria 37556
220 Ga0207647_10006567 3300025904 Bacteria 8449
221 Ga0207647_10316020 3300025904 Bacteria 887
222 Ga0207705_10000002 3300025909 Bacteria 2046852
223 Ga0207705_10000124 3300025909 Bacteria 85292
224 Ga0207705_10007000 3300025909 Bacteria 8322
225 Ga0207705_10015958 3300025909 Bacteria 5392
226 Ga0207705_10261651 3300025909 Bacteria 1321
227 Ga0207705_10322186 3300025909 Bacteria 1188
228 Ga0207707_10208518 3300025912 Bacteria 1703
229 Ga0207695_10001916 3300025913 Bacteria 32377
230 Ga0207671_10131035 3300025914 Bacteria 1924
231 Ga0207660_10001170 3300025917 Bacteria 17543
232 Ga0207660_10009502 3300025917 Bacteria 6293
233 Ga0207662_10326025 3300025918 Bacteria 1026
234 Ga0207657_10001047 3300025919 Bacteria 29314
235 Ga0207657_10001711 3300025919 Bacteria 23648
236 Ga0207657_10006540 3300025919 Bacteria 12071
237 Ga0207657_10075234 3300025919 Bacteria 2850
238 Ga0207649_10000035 3300025920 Bacteria 134650
239 Ga0207649_10058184 3300025920 Bacteria 2419
240 Ga0207649_10764802 3300025920 Bacteria 752
241 Ga0207652_10000003 3300025921 Bacteria 502441
242 Ga0207652_10001853 3300025921 Bacteria 18346
243 Ga0207652_10016241 3300025921 Bacteria 6074
244 Ga0207681_10000142 3300025923 Bacteria 59744
245 Ga0207681_10130551 3300025923 Bacteria 1857
246 Ga0207681_10224841 3300025923 Bacteria 1454
247 Ga0207681_10296163 3300025923 Bacteria 1279
248 Ga0207694_10013918 3300025924 Bacteria 6066
249 Ga0207694_10212342 3300025924 Bacteria 1577
250 Ga0207650_10128752 3300025925 Bacteria 1979
251 Ga0207650_10378087 3300025925 Bacteria 1169
252 Ga0207650_10763187 3300025925 Bacteria 819
253 Ga0207659_10014093 3300025926 Bacteria 5148
254 Ga0207659_10504123 3300025926 Bacteria 1025
255 Ga0207687_10017850 3300025927 Bacteria 4681
256 Ga0207644_10000004 3300025931 Bacteria 566613
257 Ga0207644_10000010 3300025931 Bacteria 226989
258 Ga0207644_10003110 3300025931 Bacteria 10682
259 Ga0207644_10013457 3300025931 Bacteria 5455
260 Ga0207690_10000022 3300025932 Bacteria 215772
261 Ga0207690_10000522 3300025932 Bacteria 24983
262 Ga0207690_10000640 3300025932 Bacteria 22410
263 Ga0207690_10006068 3300025932 Bacteria 7158
264 Ga0207690_10011268 3300025932 Bacteria 5341
265 Ga0207690_10243886 3300025932 Bacteria 1385
266 Ga0207690_10566819 3300025932 Bacteria 924
267 Ga0207706_10003725 3300025933 Bacteria 14537
268 Ga0207706_10007107 3300025933 Bacteria 10358
269 Ga0207706_10250049 3300025933 Bacteria 1549
270 Ga0207709_10152572 3300025935 Bacteria 1602
271 Ga0207691_10439524 3300025940 Bacteria 1111
272 Ga0207711_10008830 3300025941 Bacteria 8426
273 Ga0207711_10038155 3300025941 Bacteria 4084
274 Ga0207711_10446491 3300025941 Bacteria 1204
275 Ga0207689_10556882 3300025942 Bacteria 963
276 Ga0207661_10048260 3300025944 Bacteria 3382
277 Ga0207661_10171190 3300025944 Bacteria 1891
278 Ga0207661_10287835 3300025944 Bacteria 1470
279 Ga0207679_10018023 3300025945 Bacteria 4721
280 Ga0207679_10063880 3300025945 Bacteria 2750
281 Ga0207679_10527075 3300025945 Bacteria 1057
282 Ga0207667_10021439 3300025949 Bacteria 7159
283 Ga0207667_10023445 3300025949 Bacteria 6796
284 Ga0207667_10068116 3300025949 Bacteria 3707
285 Ga0207667_10072095 3300025949 Bacteria 3590
286 Ga0207667_10078092 3300025949 Bacteria 3432
287 Ga0207667_10317943 3300025949 Bacteria 1590
288 Ga0207651_10765668 3300025960 Bacteria 854
289 Ga0207712_10078244 3300025961 Bacteria 2399
290 Ga0207712_10192312 3300025961 Bacteria 1611
291 Ga0207668_10000075 3300025972 Bacteria 75329
292 Ga0207668_10488305 3300025972 Bacteria 1057
293 Ga0207640_10022581 3300025981 Bacteria 3768
294 Ga0207640_10235677 3300025981 Bacteria 1411
295 Ga0207658_10000742 3300025986 Bacteria 28124
296 Ga0207658_10097674 3300025986 Bacteria 2293
297 Ga0207658_10291662 3300025986 Bacteria 1402
298 Ga0207658_10662154 3300025986 Bacteria 942
299 Ga0207677_10000051 3300026023 Bacteria 100009
300 Ga0207703_10001689 3300026035 Bacteria 19855
301 Ga0207703_10002695 3300026035 Bacteria 15231
302 Ga0207639_10003417 3300026041 Bacteria 10681
303 Ga0207639_10229307 3300026041 Bacteria 1609
304 Ga0207639_10278785 3300026041 Bacteria 1469
305 Ga0207678_10019350 3300026067 Bacteria 5980
306 Ga0207678_10030552 3300026067 Bacteria 4702
307 Ga0207708_10221399 3300026075 Bacteria 1516
308 Ga0207702_10004893 3300026078 Bacteria 11789
309 Ga0207702_10049377 3300026078 Bacteria 3551
310 Ga0207641_10000036 3300026088 Bacteria 213165
311 Ga0207641_10000113 3300026088 Bacteria 119188
312 Ga0207641_10030810 3300026088 Bacteria 4445
313 Ga0207641_10605779 3300026088 Bacteria 1073
314 Ga0207676_10001553 3300026095 Bacteria 16924
315 Ga0207676_10105122 3300026095 Bacteria 2350
316 Ga0207676_10118620 3300026095 Bacteria 2227
317 Ga0207674_10041668 3300026116 Bacteria 4747
318 Ga0207674_10049466 3300026116 Bacteria 4299
319 Ga0207674_10285322 3300026116 Bacteria 1599
320 Ga0207674_10286432 3300026116 Bacteria 1596
321 Ga0207683_10167776 3300026121 Bacteria 1987
322 Ga0207698_10000067 3300026142 Bacteria 70181
323 Ga0207698_10002681 3300026142 Bacteria 10586
324 Ga0207698_10100710 3300026142 Bacteria 2394
325 Ga0207698_10112553 3300026142 Bacteria 2285
326 Ga0207698_10304721 3300026142 Bacteria 1485
327 Ga0209281_1019071 3300027111 Bacteria 1359
328 Ga0209983_1007699 3300027665 Bacteria 2206
329 Ga0207428_10095947 3300027907 Bacteria 2297
330 Ga0268266_10000173 3300028379 Bacteria 117695
331 Ga0268266_10001687 3300028379 Bacteria 25379
332 Ga0268266_10002389 3300028379 Bacteria 20264
333 Ga0268266_10206687 3300028379 Bacteria 1799
334 Ga0268265_10057023 3300028380 Bacteria 2975
335 Ga0268265_10140660 3300028380 Bacteria 2020
336 Ga0268264_10000067 3300028381 Bacteria 284445
337 Ga0268264_10003968 3300028381 Bacteria 12666
338 Ga0268264_10618457 3300028381 Bacteria 1069
339 Ga0265326_10071181 3300028558 Bacteria 983
340 Ga0265334_10049056 3300028573 Bacteria 1625
341 Ga0307517_10138615 3300028786 Bacteria 1718
342 Ga0265338_10096777 3300028800 Bacteria 2420
343 Ga0265338_10328361 3300028800 Bacteria 1105
344 Ga0316177_1101816 3300030731 Bacteria 872
345 Ga0307513_10000082 3300031456 Bacteria 131779
346 Ga0307513_10001006 3300031456 Bacteria 40812
347 Ga0307513_10394843 3300031456 Bacteria 1119
348 Ga0307408_100032762 3300031548 Bacteria 3625
349 Ga0307408_100047436 3300031548 Bacteria 3077
350 Ga0307408_100151379 3300031548 Bacteria 1832
351 Ga0307408_100859717 3300031548 Bacteria 827
352 Ga0265314_10164351 3300031711 Bacteria 1347
353 Ga0307405_10001767 3300031731 Bacteria 9253
354 Ga0307405_10147627 3300031731 Bacteria 1649
355 Ga0307405_10169729 3300031731 Bacteria 1555
356 Ga0307405_10304888 3300031731 Bacteria 1210
357 Ga0307405_10643660 3300031731 Bacteria 871
358 Ga0307413_10004455 3300031824 Bacteria 6099
359 Ga0307413_10013337 3300031824 Bacteria 4128
360 Ga0307413_10034035 3300031824 Bacteria 2908
361 Ga0307413_10135365 3300031824 Bacteria 1693
362 Ga0307413_10416133 3300031824 Bacteria 1057
363 Ga0307413_10608309 3300031824 Bacteria 895
364 Ga0307410_10280063 3300031852 Bacteria 1308
365 Ga0307410_10315942 3300031852 Bacteria 1238
366 Ga0307410_10320929 3300031852 Bacteria 1229
367 Ga0307410_10983883 3300031852 Bacteria 727
368 Ga0307406_10138865 3300031901 Bacteria 1717
369 Ga0307406_10475171 3300031901 Bacteria 1008
370 Ga0307406_10576199 3300031901 Bacteria 924
371 Ga0307407_10022735 3300031903 Bacteria 3259
372 Ga0307412_10010943 3300031911 Bacteria 5238
373 Ga0307412_10016837 3300031911 Bacteria 4366
374 Ga0307412_10038066 3300031911 Bacteria 3094
375 Ga0307412_10042957 3300031911 Bacteria 2941
376 Ga0307412_10046661 3300031911 Bacteria 2840
377 Ga0307412_10087077 3300031911 Bacteria 2175
378 Ga0307412_10130868 3300031911 Bacteria 1822
379 Ga0307412_10252537 3300031911 Bacteria 1370
380 Ga0307412_10258545 3300031911 Bacteria 1356
381 Ga0307412_10423302 3300031911 Bacteria 1090
382 Ga0307412_10429171 3300031911 Bacteria 1083
383 Ga0307409_100232451 3300031995 Bacteria 1672
384 Ga0307409_100921541 3300031995 Bacteria 888
385 Ga0307416_100009605 3300032002 Bacteria 6344
386 Ga0307416_100026372 3300032002 Bacteria 4281
387 Ga0307416_100412784 3300032002 Bacteria 1391
388 Ga0307416_100547996 3300032002 Bacteria 1229
389 Ga0307416_100620087 3300032002 Bacteria 1163
390 Ga0307414_10001014 3300032004 Bacteria 14347
391 Ga0307414_10014525 3300032004 Bacteria 4725
392 Ga0307414_10086509 3300032004 Bacteria 2313
393 Ga0307414_10110722 3300032004 Bacteria 2089
394 Ga0307414_10123950 3300032004 Bacteria 1992
395 Ga0307414_10132494 3300032004 Bacteria 1937
396 Ga0307414_10219067 3300032004 Bacteria 1561
397 Ga0307414_10341725 3300032004 Bacteria 1282
398 Ga0307414_10472896 3300032004 Bacteria 1104
399 Ga0307414_10485509 3300032004 Bacteria 1090
400 Ga0307414_10674073 3300032004 Bacteria 934
401 Ga0307411_10011964 3300032005 Bacteria 4710
402 Ga0307411_10055176 3300032005 Bacteria 2613
403 Ga0307411_10143292 3300032005 Bacteria 1765
404 Ga0307411_10233615 3300032005 Bacteria 1435
405 Ga0307415_100223595 3300032126 Bacteria 1511
406 Ga0307510_10004202 3300033180 Bacteria 16921
407 Ga0373932_0039642 3300035112 Bacteria 1352
408 Ga0316574_0307309 3300035398 Bacteria 1008
409 Ga0316574_0313766 3300035398 Bacteria 996
410 Ga0373931_0041775 3300035691 Bacteria 2410
411 Ga0373937_0506291 3300036401 Bacteria 1147
412 Ga0316584_0048242 3300036712 Bacteria 3182
413 Ga0395899_0000070 3300037312 Bacteria 189668
414 Ga0395900_0707224 3300037418 Bacteria 941
415 Ga0436364_0868772 3300037853 Bacteria 873
416 Ga0400486_07735 3300038742 Bacteria 2251
417 Ga0400487_04849 3300039110 Bacteria 2064
418 Ga0436365_0058666 3300039437 Bacteria 9204
419 Ga0436365_0591960 3300039437 Bacteria 5494
420 Ga0436365_1180580 3300039437 Bacteria 852
421 Ga0436365_1229924 3300039437 Bacteria 1149
422 Ga0436365_1369819 3300039437 Bacteria 23136
423 Ga0436365_1530544 3300039437 Bacteria 4301
424 Ga0436365_1830840 3300039437 Bacteria 45078
425 Ga0436363_0049765 3300039450 Bacteria 1568
426 Ga0436363_1297661 3300039450 Bacteria 5607
427 Ga0436362_0037733 3300039453 Bacteria 23770
428 Ga0451789_0484133 3300041443 Bacteria 916
429 Ga0451797_0437705 3300041453 Bacteria 868
430 Ga0451798_0925254 3300041458 Bacteria 680
431 Ga0451841_1283387 3300041498 Bacteria 1998
432 Ga0451843_0412542 3300041509 Bacteria 1641
433 Ga0451843_1205838 3300041509 Bacteria 1030
434 Ga0439443_000582 3300042003 Bacteria 3392
435 Ga0439445_0017912 3300042004 Bacteria 1754
436 Ga0439462_0002205 3300042015 Bacteria 4493
437 Ga0450912_004242 3300042116 Bacteria 1056
438 Ga0439435_0018133 3300042436 Bacteria 1788
439 Ga0466963_0123449 3300044694 Bacteria 1784
440 Ga0451576_0000041 3300045051 Bacteria 343432
441 Ga0495596_0000514 3300046500 Bacteria 24581
442 Ga0495606_0036917 3300046507 Bacteria 3322
443 Ga0495643_0020231 3300046522 Bacteria 3842
444 Ga0495643_0068442 3300046522 Bacteria 1868
445 Ga0495598_0003747 3300046537 Bacteria 3248
446 Ga0495598_0060091 3300046537 Bacteria 1170
447 Ga0495668_0000087 3300046616 Bacteria 151819
448 Ga0495668_0092470 3300046616 Bacteria 1657
449 Ga0495668_0123432 3300046616 Bacteria 1417
450 Ga0495625_0000726 3300046660 Bacteria 46277
451 Ga0495625_0062479 3300046660 Bacteria 2632
452 Ga0495625_0431338 3300046660 Bacteria 817
453 Ga0495669_0000001 3300046684 Bacteria 291866
454 Ga0495669_0000236 3300046684 Bacteria 32667
455 Ga0495670_0006827 3300046691 Bacteria 5620
456 Ga0495649_0067010 3300046694 Bacteria 1926
457 Ga0495636_0121468 3300047318 Bacteria 1156
458 Ga0495672_0171018 3300047320 Bacteria 1108
459 Ga0495687_117385 3300047443 Bacteria 966
460 Ga0495677_0011390 3300047445 Bacteria 3254
461 Ga0495677_0024720 3300047445 Bacteria 2179
462 Ga0495686_0072656 3300047472 Bacteria 2115
463 Ga0495626_0000301 3300048091 Bacteria 52582
464 Ga0496100_0046731 3300048903 Bacteria 2786
465 Ga0496101_0067094 3300048904 Bacteria 2618
466 Ga0496104_0031840 3300048907 Bacteria 4906
467 Ga0496104_0059496 3300048907 Bacteria 3617
468 Ga0496105_0000931 3300048908 Bacteria 19939
469 Ga0496105_0217071 3300048908 Bacteria 1557
470 Ga0496106_0004294 3300048909 Bacteria 10594
471 Ga0496107_0008469 3300048910 Bacteria 7118
472 Ga0496108_0050204 3300048911 Bacteria 3491
473 Ga0496109_0074652 3300048912 Bacteria 3117
474 Ga0496110_0040880 3300048913 Bacteria 4043
475 Ga0496110_0070530 3300048913 Bacteria 3096
476 Ga0496111_0032932 3300048914 Bacteria 3695
477 Ga0496113_0003104 3300048916 Bacteria 9869
478 Ga0496114_0038363 3300048917 Bacteria 3964
479 Ga0496114_0067164 3300048917 Bacteria 3008
480 Ga0496115_0352992 3300048918 Bacteria 1199
481 Ga0496116_0000284 3300048919 Bacteria 86342
482 Ga0496117_0184107 3300048920 Bacteria 1197
483 Ga0496117_0268486 3300048920 Bacteria 920
484 Ga0496118_0002469 3300048921 Bacteria 24817
485 Ga0496118_0221949 3300048921 Bacteria 1099
486 Ga0496119_0202022 3300048922 Bacteria 1028
487 Ga0496121_0000070 3300048924 Bacteria 249187
488 Ga0496121_0000196 3300048924 Bacteria 135812
489 Ga0496121_0000201 3300048924 Bacteria 131246
490 Ga0496122_0018857 3300048925 Bacteria 6341
491 Ga0496123_0002479 3300048926 Bacteria 22782
492 Ga0496124_0001485 3300048927 Bacteria 34464
493 Ga0496124_0012138 3300048927 Bacteria 8537
494 Ga0496125_0018162 3300048928 Bacteria 6683
495 Ga0496126_0001049 3300048929 Bacteria 46719
496 Ga0496126_0009920 3300048929 Bacteria 10058
497 Ga0496126_0410699 3300048929 Bacteria 1096
498 Ga0496126_0762725 3300048929 Bacteria 746
499 Ga0501031_0206951 3300049568 Bacteria 1279
500 Ga0501032_0013948 3300049569 Bacteria 5701
501 Ga0501032_0033845 3300049569 Bacteria 3500
502 Ga0501033_0026706 3300049570 Bacteria 4343
503 Ga0501034_0042149 3300049571 Bacteria 4620
504 Ga0501034_0095274 3300049571 Bacteria 2973
505 Ga0501034_0142260 3300049571 Bacteria 2378
506 Ga0501034_0273929 3300049571 Bacteria 1628
507 Ga0501036_0122570 3300049572 Bacteria 2195
508 Ga0501037_0103407 3300049573 Bacteria 2054
509 Ga0501038_0302257 3300049574 Bacteria 1256
510 Ga0501039_0080056 3300049575 Bacteria 2542
511 Ga0501043_0077104 3300049579 Bacteria 2618
512 Ga0501043_0352023 3300049579 Bacteria 1119
513 Ga0501043_0472285 3300049579 Bacteria 940
514 Ga0501046_0573486 3300049580 Bacteria 803
515 Ga0501047_0090006 3300049581 Bacteria 2946
516 Ga0501047_0114509 3300049581 Bacteria 2579
517 Ga0501047_0147683 3300049581 Bacteria 2227
518 Ga0501047_0353336 3300049581 Bacteria 1306
519 Ga0501047_0530800 3300049581 Bacteria 1002
520 Ga0501047_0568972 3300049581 Bacteria 957
521 Ga0501069_0018158 3300049585 Bacteria 3793
522 Ga0501070_0091157 3300049586 Bacteria 2523
523 Ga0501080_0141159 3300049742 Bacteria 2227
524 Ga0501083_0179044 3300049744 Bacteria 1385
525 Ga0501035_0160805 3300049822 Bacteria 1944
526 Ga0501035_0341658 3300049822 Bacteria 1254
527 Ga0501044_0000730 3300049823 Bacteria 39671
528 Ga0501044_0219726 3300049823 Bacteria 1851
529 Ga0501044_0225868 3300049823 Bacteria 1822
530 Ga0501044_0379012 3300049823 Bacteria 1330
531 Ga0501044_0528680 3300049823 Bacteria 1078
532 Ga0501045_0097025 3300049824 Bacteria 2181
533 nmdc:mga03683_11679_c1 3300050489 Bacteria 3188
534 nmdc:mga03683_31_c1 3300050489 Bacteria 69502
535 nmdc:mga03n38_222_c1 3300050490 Bacteria 13159
536 nmdc:mga03n38_3692_c1 3300050490 Bacteria 4954
537 nmdc:mga00v17_13083_c1 3300050491 Bacteria 4597
538 nmdc:mga00v17_497382_c1 3300050491 Bacteria 790
539 nmdc:mga0k408_13523_c1 3300050493 Bacteria 4479
540 nmdc:mga0k408_1427_c1 3300050493 Bacteria 12938
541 nmdc:mga0k408_18_c1 3300050493 Bacteria 112318
542 nmdc:mga04h51_641_c1 3300050495 Bacteria 8181
543 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
544 nmdc:mga07m45_299961_c1 3300050496 Bacteria 934
545 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
546 nmdc:mga09592_20410_c1 3300050508 Bacteria 5447
547 nmdc:mga0qj67_13075_c1 3300050509 Bacteria 6269
548 nmdc:mga0qj67_267869_c1 3300050509 Bacteria 1385
549 nmdc:mga0qj67_574058_c1 3300050509 Bacteria 903
550 nmdc:mga06r32_976_c1 3300050510 Bacteria 25615
551 nmdc:mga0sz30_1125_c2 3300050516 Bacteria 7973
552 nmdc:mga0sz30_14312_c1 3300050516 Bacteria 3120
553 nmdc:mga0sz30_4304_c1 3300050516 Bacteria 5137
554 Ga0500643_005450 3300053087 Bacteria 5483
555 Ga0500647_0033753 3300053091 Bacteria 2442
556 Ga0500592_015481 3300053116 Bacteria 1224
557 Ga0500594_0023343 3300053118 Bacteria 1567
558 Ga0500595_105371 3300053119 Bacteria 805
559 Ga0500607_000395 3300053121 Bacteria 41884
560 Ga0500607_000854 3300053121 Bacteria 29366
561 Ga0500608_001181 3300053122 Bacteria 9303
562 Ga0500614_088357 3300053123 Bacteria 877
563 Ga0500614_114754 3300053123 Bacteria 788
564 Ga0500618_007528 3300053125 Bacteria 3099
565 Ga0500559_0001264 3300053136 Bacteria 14808
566 Ga0500559_0038539 3300053136 Bacteria 2076
567 Ga0500564_004287 3300053138 Bacteria 5686
568 Ga0500568_0000814 3300053139 Bacteria 21910
569 Ga0500568_0014556 3300053139 Bacteria 3549
570 Ga0500568_0056679 3300053139 Bacteria 1527
571 Ga0500573_0095506 3300053140 Bacteria 1676
572 Ga0500573_0207981 3300053140 Bacteria 1034
573 Ga0500577_0103196 3300053142 Bacteria 1168
574 Ga0500590_000464 3300053148 Bacteria 13814
575 Ga0500590_067366 3300053148 Bacteria 1787
576 Ga0500604_0000007 3300053151 Bacteria 115773
577 Ga0500604_0037163 3300053151 Bacteria 1455
578 Ga0500616_0000080 3300053153 Bacteria 200381
579 Ga0500627_0000035 3300053158 Bacteria 80123
580 Ga0500630_127388 3300053159 Bacteria 1118
581 Ga0500637_0021573 3300053178 Bacteria 3499
582 Ga0500637_0185373 3300053178 Bacteria 1191
583 Ga0500567_008334 3300053723 Bacteria 4901
584 Ga0500625_000009 3300053729 Bacteria 159296
585 Ga0500645_011510 3300053730 Bacteria 2886
586 Ga0500587_000415 3300053739 Bacteria 4976

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0040880 Ga0496110_0040880_1542_2144 191
2 3300048929 Ga0496126_0001049 Ga0496126_0001049_35709_36311 191
3 3300025321 Ga0207656_10230892 Ga0207656_102308921 196
4 3300005367 Ga0070667_100003664 Ga0070667_10000366415 198
5 3300005458 Ga0070681_10008385 Ga0070681_100083858 198
6 3300005467 Ga0070706_100330670 Ga0070706_1003306702 198
7 3300006051 Ga0075364_10035300 Ga0075364_100353003 198
8 3300036712 Ga0316584_0048242 Ga0316584_0048242_766_1365 198
9 3300037853 Ga0436364_0868772 Ga0436364_0868772_113_721 198
10 3300038742 Ga0400486_07735 Ga0400486_07735_1058_1663 198
11 3300039437 Ga0436365_1830840 Ga0436365_1830840_27704_28312 198
12 3300039450 Ga0436363_1297661 Ga0436363_1297661_1116_1724 198
13 3300041458 Ga0451798_0925254 Ga0451798_0925254_12_620 198
14 3300041498 Ga0451841_1283387 Ga0451841_1283387_71_679 198
15 3300041509 Ga0451843_1205838 Ga0451843_1205838_146_754 198
16 3300046684 Ga0495669_0000236 Ga0495669_0000236_7695_8303 198
17 3300047318 Ga0495636_0121468 Ga0495636_0121468_190_798 198
18 3300047445 Ga0495677_0024720 Ga0495677_0024720_151_759 198
19 3300048920 Ga0496117_0184107 Ga0496117_0184107_218_823 198
20 3300048921 Ga0496118_0002469 Ga0496118_0002469_7137_7742 198
21 3300048924 Ga0496121_0000196 Ga0496121_0000196_30973_31578 198
22 3300053123 Ga0500614_114754 Ga0500614_114754_154_759 198
23 3300006847 Ga0075431_100000392 Ga0075431_1000003925 199
24 3300006880 Ga0075429_100045313 Ga0075429_1000453133 199
25 3300050508 nmdc:mga09592_20410_c1 nmdc:mga09592_20410_c1_3441_4049 199
26 3300050509 nmdc:mga0qj67_267869_c1 nmdc:mga0qj67_267869_c1_367_975 199
27 3300050510 nmdc:mga06r32_976_c1 nmdc:mga06r32_976_c1_4868_5476 199
28 3300053125 Ga0500618_007528 Ga0500618_007528_1297_1917 200
29 3300005335 Ga0070666_10136157 Ga0070666_101361572 201
30 3300005355 Ga0070671_100004246 Ga0070671_10000424612 201
31 3300005617 Ga0068859_100003997 Ga0068859_10000399712 201
32 3300005842 Ga0068858_100001121 Ga0068858_10000112118 201
33 3300006931 Ga0097620_100003997 Ga0097620_10000399711 201
34 3300009177 Ga0105248_10080346 Ga0105248_100803463 201
35 3300014325 Ga0163163_10469272 Ga0163163_104692722 201
36 3300025931 Ga0207644_10003110 Ga0207644_100031105 201
37 3300026035 Ga0207703_10002695 Ga0207703_100026959 201
38 3300002239 JGI24034J26672_10028901 JGI24034J26672_100289012 204
39 3300005331 Ga0070670_100041862 Ga0070670_1000418622 204
40 3300005347 Ga0070668_100000048 Ga0070668_10000004883 204
41 3300005355 Ga0070671_100000532 Ga0070671_10000053225 204
42 3300005841 Ga0068863_100000017 Ga0068863_10000001778 204
43 3300005843 Ga0068860_100101357 Ga0068860_1001013572 204
44 3300005844 Ga0068862_100025994 Ga0068862_1000259942 204
45 3300025925 Ga0207650_10378087 Ga0207650_103780872 204
46 3300025931 Ga0207644_10000010 Ga0207644_10000010165 204
47 3300025961 Ga0207712_10078244 Ga0207712_100782444 204
48 3300025972 Ga0207668_10000075 Ga0207668_100000754 204
49 3300026088 Ga0207641_10000036 Ga0207641_1000003676 204
50 3300028380 Ga0268265_10057023 Ga0268265_100570233 204
51 3300028381 Ga0268264_10003968 Ga0268264_1000396811 204
52 3300025298 Ga0209050_1001280 Ga0209050_10012806 205
53 3300046500 Ga0495596_0000514 Ga0495596_0000514_10155_10808 205
54 3300046507 Ga0495606_0036917 Ga0495606_0036917_525_1178 205
55 3300046522 Ga0495643_0020231 Ga0495643_0020231_1734_2387 205
56 3300046616 Ga0495668_0123432 Ga0495668_0123432_119_772 205
57 3300048091 Ga0495626_0000301 Ga0495626_0000301_28922_29575 205
58 3300048903 Ga0496100_0046731 Ga0496100_0046731_912_1565 205
59 3300048919 Ga0496116_0000284 Ga0496116_0000284_52418_53071 205
60 3300048920 Ga0496117_0268486 Ga0496117_0268486_33_686 205
61 3300048925 Ga0496122_0018857 Ga0496122_0018857_1095_1748 205
62 3300048926 Ga0496123_0002479 Ga0496123_0002479_21059_21712 205
63 3300048927 Ga0496124_0001485 Ga0496124_0001485_30457_31110 205
64 3300048927 Ga0496124_0012138 Ga0496124_0012138_1310_1963 205
65 3300048928 Ga0496125_0018162 Ga0496125_0018162_5325_5978 205
66 3300048929 Ga0496126_0009920 Ga0496126_0009920_9256_9909 205
67 3300049569 Ga0501032_0013948 Ga0501032_0013948_4722_5357 205
68 iso_pu_bacteria 2739367664 2739649278 205
69 iso_pu_bacteria 2739367865 2740027751 205
70 iso_pu_bacteria 2818991438 2819552893 205
71 iso_pu_bacteria 2882806704 2882806844 205
72 iso_pu_bacteria 2896184354 2896185588 205
73 iso_pu_bacteria 2896253425 2896256434 205
74 3300005347 Ga0070668_100180957 Ga0070668_1001809571 206
75 3300005367 Ga0070667_100000167 Ga0070667_10000016749 206
76 3300005841 Ga0068863_100395774 Ga0068863_1003957742 206
77 3300006846 Ga0075430_100490504 Ga0075430_1004905042 206
78 3300025923 Ga0207681_10224841 Ga0207681_102248412 206
79 3300025986 Ga0207658_10000742 Ga0207658_1000074227 206
80 3300026088 Ga0207641_10030810 Ga0207641_100308102 206
81 3300026142 Ga0207698_10304721 Ga0207698_103047212 206
82 3300050509 nmdc:mga0qj67_13075_c1 nmdc:mga0qj67_13075_c1_3908_4528 206
83 3300050509 nmdc:mga0qj67_574058_c1 nmdc:mga0qj67_574058_c1_151_771 206
84 3300005327 Ga0070658_10026423 Ga0070658_100264233 207
85 3300005329 Ga0070683_100405324 Ga0070683_1004053242 207
86 3300005331 Ga0070670_100407414 Ga0070670_1004074142 207
87 3300005344 Ga0070661_100105137 Ga0070661_1001051372 207
88 3300005366 Ga0070659_100077995 Ga0070659_1000779953 207
89 3300005455 Ga0070663_100025285 Ga0070663_1000252852 207
90 3300005457 Ga0070662_100003248 Ga0070662_10000324812 207
91 3300005458 Ga0070681_10720379 Ga0070681_107203791 207
92 3300005530 Ga0070679_100005037 Ga0070679_1000050377 207
93 3300005530 Ga0070679_100230721 Ga0070679_1002307213 207
94 3300005530 Ga0070679_100859258 Ga0070679_1008592582 207
95 3300005535 Ga0070684_100007437 Ga0070684_1000074378 207
96 3300005539 Ga0068853_100286382 Ga0068853_1002863823 207
97 3300005564 Ga0070664_100119757 Ga0070664_1001197572 207
98 3300005577 Ga0068857_100431439 Ga0068857_1004314391 207
99 3300011119 Ga0105246_10000137 Ga0105246_1000013739 207
100 3300013100 Ga0157373_10121063 Ga0157373_101210632 207
101 3300013100 Ga0157373_10280455 Ga0157373_102804552 207
102 3300013102 Ga0157371_10090878 Ga0157371_100908783 207
103 3300013308 Ga0157375_10784652 Ga0157375_107846522 207
104 3300014326 Ga0157380_10091084 Ga0157380_100910843 207
105 3300025909 Ga0207705_10007000 Ga0207705_100070004 207
106 3300025909 Ga0207705_10015958 Ga0207705_100159582 207
107 3300025920 Ga0207649_10764802 Ga0207649_107648021 207
108 3300025921 Ga0207652_10001853 Ga0207652_100018537 207
109 3300025921 Ga0207652_10016241 Ga0207652_100162412 207
110 3300025925 Ga0207650_10763187 Ga0207650_107631872 207
111 3300025932 Ga0207690_10243886 Ga0207690_102438863 207
112 3300025932 Ga0207690_10566819 Ga0207690_105668192 207
113 3300025933 Ga0207706_10007107 Ga0207706_1000710713 207
114 3300025944 Ga0207661_10287835 Ga0207661_102878353 207
115 3300025945 Ga0207679_10063880 Ga0207679_100638802 207
116 3300026041 Ga0207639_10229307 Ga0207639_102293071 207
117 3300026067 Ga0207678_10019350 Ga0207678_100193505 207
118 3300026116 Ga0207674_10285322 Ga0207674_102853222 207
119 3300026142 Ga0207698_10112553 Ga0207698_101125532 207
120 3300039110 Ga0400487_04849 Ga0400487_04849_625_1269 207
121 3300048917 Ga0496114_0067164 Ga0496114_0067164_1612_2244 207
122 3300049581 Ga0501047_0353336 Ga0501047_0353336_636_1274 207
123 3300049822 Ga0501035_0160805 Ga0501035_0160805_581_1219 207
124 3300049823 Ga0501044_0225868 Ga0501044_0225868_205_837 207
125 3300049823 Ga0501044_0379012 Ga0501044_0379012_574_1206 207
126 3300049823 Ga0501044_0528680 Ga0501044_0528680_384_1022 207
127 3300001979 JGI24740J21852_10076201 JGI24740J21852_100762011 208
128 3300002239 JGI24034J26672_10039392 JGI24034J26672_100393921 208
129 3300002459 JGI24751J29686_10000154 JGI24751J29686_1000015426 208
130 3300005327 Ga0070658_10123341 Ga0070658_101233412 208
131 3300005327 Ga0070658_10313043 Ga0070658_103130431 208
132 3300005327 Ga0070658_10508661 Ga0070658_105086612 208
133 3300005330 Ga0070690_100022470 Ga0070690_1000224705 208
134 3300005333 Ga0070677_10268384 Ga0070677_102683841 208
135 3300005335 Ga0070666_10037423 Ga0070666_100374232 208
136 3300005336 Ga0070680_100001683 Ga0070680_1000016837 208
137 3300005337 Ga0070682_100027871 Ga0070682_1000278712 208
138 3300005339 Ga0070660_100002033 Ga0070660_1000020338 208
139 3300005344 Ga0070661_100001882 Ga0070661_1000018828 208
140 3300005345 Ga0070692_10094346 Ga0070692_100943462 208
141 3300005347 Ga0070668_100134495 Ga0070668_1001344953 208
142 3300005347 Ga0070668_100238134 Ga0070668_1002381342 208
143 3300005353 Ga0070669_100000472 Ga0070669_10000047214 208
144 3300005355 Ga0070671_100000067 Ga0070671_10000006764 208
145 3300005366 Ga0070659_100138493 Ga0070659_1001384932 208
146 3300005367 Ga0070667_100018045 Ga0070667_1000180454 208
147 3300005455 Ga0070663_100016991 Ga0070663_1000169913 208
148 3300005457 Ga0070662_100001446 Ga0070662_1000014468 208
149 3300005530 Ga0070679_100033039 Ga0070679_1000330393 208
150 3300005535 Ga0070684_100404689 Ga0070684_1004046891 208
151 3300005539 Ga0068853_100002549 Ga0068853_10000254915 208
152 3300005544 Ga0070686_100011498 Ga0070686_1000114984 208
153 3300005548 Ga0070665_100007174 Ga0070665_10000717410 208
154 3300005548 Ga0070665_100115291 Ga0070665_1001152914 208
155 3300005563 Ga0068855_100018885 Ga0068855_1000188858 208
156 3300005563 Ga0068855_100034692 Ga0068855_1000346922 208
157 3300005563 Ga0068855_100061409 Ga0068855_1000614093 208
158 3300005563 Ga0068855_100135070 Ga0068855_1001350704 208
159 3300005563 Ga0068855_100287646 Ga0068855_1002876462 208
160 3300005564 Ga0070664_100446009 Ga0070664_1004460092 208
161 3300005577 Ga0068857_100106632 Ga0068857_1001066323 208
162 3300005577 Ga0068857_100454158 Ga0068857_1004541581 208
163 3300005577 Ga0068857_100966506 Ga0068857_1009665061 208
164 3300005578 Ga0068854_100009343 Ga0068854_1000093434 208
165 3300005614 Ga0068856_100007858 Ga0068856_10000785815 208
166 3300005616 Ga0068852_100127539 Ga0068852_1001275392 208
167 3300005616 Ga0068852_100224005 Ga0068852_1002240052 208
168 3300005617 Ga0068859_100242513 Ga0068859_1002425132 208
169 3300005618 Ga0068864_100141990 Ga0068864_1001419902 208
170 3300005834 Ga0068851_10228520 Ga0068851_102285202 208
171 3300005841 Ga0068863_100000103 Ga0068863_10000010326 208
172 3300005842 Ga0068858_100074898 Ga0068858_1000748984 208
173 3300005842 Ga0068858_100090543 Ga0068858_1000905432 208
174 3300005843 Ga0068860_100000093 Ga0068860_10000009328 208
175 3300005843 Ga0068860_100076723 Ga0068860_1000767232 208
176 3300005844 Ga0068862_100065022 Ga0068862_1000650222 208
177 3300005844 Ga0068862_100182342 Ga0068862_1001823422 208
178 3300005985 Ga0081539_10031210 Ga0081539_100312102 208
179 3300006048 Ga0075363_100006123 Ga0075363_1000061239 208
180 3300006058 Ga0075432_10010664 Ga0075432_100106643 208
181 3300006177 Ga0075362_10000011 Ga0075362_1000001199 208
182 3300006178 Ga0075367_10433997 Ga0075367_104339972 208
183 3300006186 Ga0075369_10058793 Ga0075369_100587933 208
184 3300006195 Ga0075366_10000190 Ga0075366_1000019014 208
185 3300006195 Ga0075366_10017228 Ga0075366_100172286 208
186 3300006195 Ga0075366_10086040 Ga0075366_100860402 208
187 3300006353 Ga0075370_10000004 Ga0075370_1000000485 208
188 3300006931 Ga0097620_100242491 Ga0097620_1002424913 208
189 3300006946 Ga0079104_1020081 Ga0079104_10200812 208
190 3300009148 Ga0105243_10249271 Ga0105243_102492712 208
191 3300009174 Ga0105241_10042269 Ga0105241_100422692 208
192 3300009177 Ga0105248_10096944 Ga0105248_100969442 208
193 3300009177 Ga0105248_10191968 Ga0105248_101919683 208
194 3300009553 Ga0105249_10101016 Ga0105249_101010161 208
195 3300013100 Ga0157373_10039391 Ga0157373_100393912 208
196 3300013102 Ga0157371_10009329 Ga0157371_100093295 208
197 3300013102 Ga0157371_10149686 Ga0157371_101496862 208
198 3300013104 Ga0157370_10016607 Ga0157370_100166074 208
199 3300013105 Ga0157369_10001072 Ga0157369_100010727 208
200 3300013306 Ga0163162_10191791 Ga0163162_101917914 208
201 3300013307 Ga0157372_10004382 Ga0157372_100043826 208
202 3300013307 Ga0157372_10395557 Ga0157372_103955573 208
203 3300014968 Ga0157379_10089128 Ga0157379_100891284 208
204 3300021377 Ga0213874_10018530 Ga0213874_100185302 208
205 3300021384 Ga0213876_10000134 Ga0213876_1000013465 208
206 3300021384 Ga0213876_10169798 Ga0213876_101697982 208
207 3300025321 Ga0207656_10219507 Ga0207656_102195072 208
208 3300025904 Ga0207647_10316020 Ga0207647_103160201 208
209 3300025909 Ga0207705_10261651 Ga0207705_102616512 208
210 3300025909 Ga0207705_10322186 Ga0207705_103221862 208
211 3300025914 Ga0207671_10131035 Ga0207671_101310353 208
212 3300025917 Ga0207660_10009502 Ga0207660_100095025 208
213 3300025919 Ga0207657_10001711 Ga0207657_1000171127 208
214 3300025920 Ga0207649_10058184 Ga0207649_100581842 208
215 3300025923 Ga0207681_10000142 Ga0207681_1000014254 208
216 3300025923 Ga0207681_10296163 Ga0207681_102961632 208
217 3300025925 Ga0207650_10128752 Ga0207650_101287522 208
218 3300025931 Ga0207644_10000004 Ga0207644_1000000472 208
219 3300025932 Ga0207690_10000640 Ga0207690_1000064025 208
220 3300025933 Ga0207706_10003725 Ga0207706_100037257 208
221 3300025940 Ga0207691_10439524 Ga0207691_104395241 208
222 3300025941 Ga0207711_10038155 Ga0207711_100381557 208
223 3300025941 Ga0207711_10446491 Ga0207711_104464912 208
224 3300025944 Ga0207661_10048260 Ga0207661_100482602 208
225 3300025945 Ga0207679_10018023 Ga0207679_100180233 208
226 3300025949 Ga0207667_10021439 Ga0207667_100214392 208
227 3300025949 Ga0207667_10023445 Ga0207667_100234457 208
228 3300025949 Ga0207667_10068116 Ga0207667_100681163 208
229 3300025949 Ga0207667_10072095 Ga0207667_100720952 208
230 3300025972 Ga0207668_10488305 Ga0207668_104883052 208
231 3300025981 Ga0207640_10022581 Ga0207640_100225815 208
232 3300025986 Ga0207658_10097674 Ga0207658_100976742 208
233 3300025986 Ga0207658_10291662 Ga0207658_102916622 208
234 3300026041 Ga0207639_10003417 Ga0207639_100034172 208
235 3300026067 Ga0207678_10030552 Ga0207678_100305522 208
236 3300026078 Ga0207702_10049377 Ga0207702_100493772 208
237 3300026088 Ga0207641_10000113 Ga0207641_1000011326 208
238 3300026088 Ga0207641_10605779 Ga0207641_106057791 208
239 3300026095 Ga0207676_10105122 Ga0207676_101051221 208
240 3300026095 Ga0207676_10118620 Ga0207676_101186203 208
241 3300026116 Ga0207674_10041668 Ga0207674_100416682 208
242 3300026116 Ga0207674_10049466 Ga0207674_100494664 208
243 3300026116 Ga0207674_10286432 Ga0207674_102864322 208
244 3300026142 Ga0207698_10100710 Ga0207698_101007103 208
245 3300027111 Ga0209281_1019071 Ga0209281_10190712 208
246 3300027907 Ga0207428_10095947 Ga0207428_100959473 208
247 3300028379 Ga0268266_10002389 Ga0268266_100023898 208
248 3300028379 Ga0268266_10206687 Ga0268266_102066872 208
249 3300028380 Ga0268265_10140660 Ga0268265_101406602 208
250 3300028381 Ga0268264_10000067 Ga0268264_10000067264 208
251 3300030731 Ga0316177_1101816 Ga0316177_11018162 208
252 3300031548 Ga0307408_100032762 Ga0307408_1000327622 208
253 3300031548 Ga0307408_100859717 Ga0307408_1008597171 208
254 3300031731 Ga0307405_10001767 Ga0307405_100017675 208
255 3300031731 Ga0307405_10147627 Ga0307405_101476271 208
256 3300031824 Ga0307413_10004455 Ga0307413_100044553 208
257 3300031824 Ga0307413_10013337 Ga0307413_100133372 208
258 3300031824 Ga0307413_10034035 Ga0307413_100340352 208
259 3300031824 Ga0307413_10135365 Ga0307413_101353652 208
260 3300031852 Ga0307410_10315942 Ga0307410_103159423 208
261 3300031852 Ga0307410_10983883 Ga0307410_109838831 208
262 3300031903 Ga0307407_10022735 Ga0307407_100227353 208
263 3300031911 Ga0307412_10010943 Ga0307412_100109432 208
264 3300031911 Ga0307412_10046661 Ga0307412_100466612 208
265 3300031911 Ga0307412_10087077 Ga0307412_100870772 208
266 3300031995 Ga0307409_100232451 Ga0307409_1002324513 208
267 3300031995 Ga0307409_100921541 Ga0307409_1009215412 208
268 3300032002 Ga0307416_100009605 Ga0307416_1000096056 208
269 3300032002 Ga0307416_100026372 Ga0307416_1000263723 208
270 3300032002 Ga0307416_100547996 Ga0307416_1005479962 208
271 3300032004 Ga0307414_10014525 Ga0307414_100145252 208
272 3300032004 Ga0307414_10110722 Ga0307414_101107223 208
273 3300032004 Ga0307414_10219067 Ga0307414_102190672 208
274 3300032004 Ga0307414_10341725 Ga0307414_103417252 208
275 3300032004 Ga0307414_10674073 Ga0307414_106740732 208
276 3300032005 Ga0307411_10011964 Ga0307411_100119645 208
277 3300032005 Ga0307411_10055176 Ga0307411_100551762 208
278 3300032005 Ga0307411_10143292 Ga0307411_101432922 208
279 3300032126 Ga0307415_100223595 Ga0307415_1002235952 208
280 3300035112 Ga0373932_0039642 Ga0373932_0039642_15_662 208
281 3300035398 Ga0316574_0307309 Ga0316574_0307309_62_712 208
282 3300035398 Ga0316574_0313766 Ga0316574_0313766_154_783 208
283 3300035691 Ga0373931_0041775 Ga0373931_0041775_965_1612 208
284 3300037312 Ga0395899_0000070 Ga0395899_0000070_139553_140194 208
285 3300037418 Ga0395900_0707224 Ga0395900_0707224_50_691 208
286 3300039437 Ga0436365_1530544 Ga0436365_1530544_3243_3878 208
287 3300042003 Ga0439443_000582 Ga0439443_000582_421_1059 208
288 3300042015 Ga0439462_0002205 Ga0439462_0002205_3824_4462 208
289 3300042436 Ga0439435_0018133 Ga0439435_0018133_509_1147 208
290 3300046537 Ga0495598_0003747 Ga0495598_0003747_843_1481 208
291 3300046660 Ga0495625_0431338 Ga0495625_0431338_109_747 208
292 3300046684 Ga0495669_0000001 Ga0495669_0000001_172173_172811 208
293 3300047445 Ga0495677_0011390 Ga0495677_0011390_681_1319 208
294 3300048907 Ga0496104_0031840 Ga0496104_0031840_2892_3527 208
295 3300048907 Ga0496104_0059496 Ga0496104_0059496_1010_1657 208
296 3300048908 Ga0496105_0000931 Ga0496105_0000931_15826_16473 208
297 3300048908 Ga0496105_0217071 Ga0496105_0217071_63_698 208
298 3300048909 Ga0496106_0004294 Ga0496106_0004294_2887_3522 208
299 3300048910 Ga0496107_0008469 Ga0496107_0008469_300_935 208
300 3300048911 Ga0496108_0050204 Ga0496108_0050204_1101_1736 208
301 3300048912 Ga0496109_0074652 Ga0496109_0074652_1790_2425 208
302 3300048913 Ga0496110_0070530 Ga0496110_0070530_717_1352 208
303 3300048914 Ga0496111_0032932 Ga0496111_0032932_2814_3449 208
304 3300048916 Ga0496113_0003104 Ga0496113_0003104_8785_9420 208
305 3300048922 Ga0496119_0202022 Ga0496119_0202022_337_984 208
306 3300048929 Ga0496126_0762725 Ga0496126_0762725_63_710 208
307 3300050489 nmdc:mga03683_31_c1 nmdc:mga03683_31_c1_34137_34784 208
308 3300050490 nmdc:mga03n38_222_c1 nmdc:mga03n38_222_c1_10397_11044 208
309 3300050491 nmdc:mga00v17_497382_c1 nmdc:mga00v17_497382_c1_60_707 208
310 3300050493 nmdc:mga0k408_1427_c1 nmdc:mga0k408_1427_c1_630_1280 208
311 3300050493 nmdc:mga0k408_18_c1 nmdc:mga0k408_18_c1_98245_98892 208
312 3300050496 nmdc:mga07m45_19_c1 nmdc:mga07m45_19_c1_33878_34525 208
313 3300050516 nmdc:mga0sz30_1125_c2 nmdc:mga0sz30_1125_c2_538_1185 208
314 3300053119 Ga0500595_105371 Ga0500595_105371_73_708 208
315 iso_pu_bacteria 2599185354 2600201775 208
316 iso_pu_bacteria 2643221560 2643820103 208
317 iso_pu_bacteria 2643221563 2643834471 208
318 iso_pu_bacteria 2643221608 2644055397 208
319 iso_pu_bacteria 2751185897 2753767850 208
320 iso_pu_bacteria 2852653556 2852656355 208
321 iso_pu_bacteria 2852680915 2852683466 208
322 3300005327 Ga0070658_10000068 Ga0070658_1000006819 209
323 3300005366 Ga0070659_100002377 Ga0070659_10000237712 209
324 3300005539 Ga0068853_100157427 Ga0068853_1001574273 209
325 3300005563 Ga0068855_100057353 Ga0068855_1000573537 209
326 3300005563 Ga0068855_100064206 Ga0068855_1000642066 209
327 3300005564 Ga0070664_100029564 Ga0070664_1000295645 209
328 3300005577 Ga0068857_100489168 Ga0068857_1004891682 209
329 3300005614 Ga0068856_100007324 Ga0068856_1000073243 209
330 3300005616 Ga0068852_100000358 Ga0068852_1000003587 209
331 3300005616 Ga0068852_100041790 Ga0068852_1000417905 209
332 3300009093 Ga0105240_10002141 Ga0105240_100021419 209
333 3300009545 Ga0105237_10202735 Ga0105237_102027352 209
334 3300009551 Ga0105238_10010117 Ga0105238_100101177 209
335 3300013100 Ga0157373_10002927 Ga0157373_100029279 209
336 3300013100 Ga0157373_10004669 Ga0157373_100046697 209
337 3300013102 Ga0157371_10052635 Ga0157371_100526354 209
338 3300014325 Ga0163163_10601791 Ga0163163_106017911 209
339 3300021384 Ga0213876_10099446 Ga0213876_100994461 209
340 3300025904 Ga0207647_10006567 Ga0207647_100065676 209
341 3300025909 Ga0207705_10000124 Ga0207705_1000012426 209
342 3300025913 Ga0207695_10001916 Ga0207695_100019169 209
343 3300025924 Ga0207694_10013918 Ga0207694_100139182 209
344 3300025932 Ga0207690_10011268 Ga0207690_100112686 209
345 3300025945 Ga0207679_10527075 Ga0207679_105270752 209
346 3300025949 Ga0207667_10078092 Ga0207667_100780922 209
347 3300025949 Ga0207667_10317943 Ga0207667_103179432 209
348 3300026078 Ga0207702_10004893 Ga0207702_100048935 209
349 3300026142 Ga0207698_10000067 Ga0207698_1000006726 209
350 3300026142 Ga0207698_10002681 Ga0207698_100026818 209
351 3300028558 Ga0265326_10071181 Ga0265326_100711812 209
352 3300028573 Ga0265334_10049056 Ga0265334_100490562 209
353 3300028800 Ga0265338_10096777 Ga0265338_100967772 209
354 3300028800 Ga0265338_10328361 Ga0265338_103283612 209
355 3300031456 Ga0307513_10000082 Ga0307513_10000082105 209
356 3300031456 Ga0307513_10001006 Ga0307513_1000100632 209
357 3300031711 Ga0265314_10164351 Ga0265314_101643512 209
358 3300031824 Ga0307413_10416133 Ga0307413_104161331 209
359 3300031901 Ga0307406_10475171 Ga0307406_104751712 209
360 3300031911 Ga0307412_10258545 Ga0307412_102585452 209
361 3300031911 Ga0307412_10429171 Ga0307412_104291711 209
362 3300039437 Ga0436365_1180580 Ga0436365_1180580_99_743 209
363 3300042116 Ga0450912_004242 Ga0450912_004242_303_950 209
364 3300045051 Ga0451576_0000041 Ga0451576_0000041_28762_29415 209
365 3300047320 Ga0495672_0171018 Ga0495672_0171018_117_764 209
366 3300047443 Ga0495687_117385 Ga0495687_117385_99_752 209
367 3300048918 Ga0496115_0352992 Ga0496115_0352992_40_684 209
368 3300053091 Ga0500647_0033753 Ga0500647_0033753_1100_1753 209
369 3300053118 Ga0500594_0023343 Ga0500594_0023343_813_1466 209
370 3300053121 Ga0500607_000395 Ga0500607_000395_38741_39403 209
371 3300053122 Ga0500608_001181 Ga0500608_001181_6079_6732 209
372 3300053123 Ga0500614_088357 Ga0500614_088357_142_795 209
373 3300053136 Ga0500559_0001264 Ga0500559_0001264_2457_3119 209
374 3300053138 Ga0500564_004287 Ga0500564_004287_2468_3121 209
375 3300053140 Ga0500573_0095506 Ga0500573_0095506_962_1615 209
376 3300053148 Ga0500590_067366 Ga0500590_067366_1025_1666 209
377 3300053159 Ga0500630_127388 Ga0500630_127388_422_1075 209
378 3300053178 Ga0500637_0021573 Ga0500637_0021573_789_1451 209
379 3300053723 Ga0500567_008334 Ga0500567_008334_2468_3121 209
380 3300053729 Ga0500625_000009 Ga0500625_000009_140593_141246 209
381 3300001989 JGI24739J22299_10061409 JGI24739J22299_100614092 210
382 3300005295 Ga0065707_10096811 Ga0065707_100968112 210
383 3300005329 Ga0070683_100244796 Ga0070683_1002447962 210
384 3300005336 Ga0070680_100001399 Ga0070680_1000013994 210
385 3300005338 Ga0068868_100000184 Ga0068868_10000018414 210
386 3300005339 Ga0070660_100001498 Ga0070660_10000149811 210
387 3300005339 Ga0070660_100003201 Ga0070660_1000032015 210
388 3300005339 Ga0070660_100065395 Ga0070660_1000653953 210
389 3300005344 Ga0070661_100000009 Ga0070661_10000000955 210
390 3300005347 Ga0070668_100849010 Ga0070668_1008490101 210
391 3300005353 Ga0070669_100691377 Ga0070669_1006913771 210
392 3300005354 Ga0070675_100007629 Ga0070675_10000762910 210
393 3300005366 Ga0070659_100000009 Ga0070659_10000000942 210
394 3300005366 Ga0070659_100000979 Ga0070659_10000097923 210
395 3300005366 Ga0070659_100004263 Ga0070659_1000042631 210
396 3300005530 Ga0070679_100000031 Ga0070679_10000003198 210
397 3300005544 Ga0070686_100001770 Ga0070686_10000177016 210
398 3300005548 Ga0070665_100000145 Ga0070665_10000014561 210
399 3300005548 Ga0070665_100088206 Ga0070665_1000882062 210
400 3300005617 Ga0068859_100058571 Ga0068859_1000585712 210
401 3300005617 Ga0068859_100250968 Ga0068859_1002509682 210
402 3300005719 Ga0068861_100495016 Ga0068861_1004950162 210
403 3300005843 Ga0068860_100111640 Ga0068860_1001116402 210
404 3300005981 Ga0081538_10125636 Ga0081538_101256362 210
405 3300006042 Ga0075368_10000154 Ga0075368_1000015423 210
406 3300006051 Ga0075364_10114330 Ga0075364_101143301 210
407 3300006177 Ga0075362_10004729 Ga0075362_100047293 210
408 3300006186 Ga0075369_10065933 Ga0075369_100659331 210
409 3300006931 Ga0097620_100058572 Ga0097620_1000585722 210
410 3300006931 Ga0097620_100250968 Ga0097620_1002509683 210
411 3300009094 Ga0111539_10360572 Ga0111539_103605723 210
412 3300009551 Ga0105238_10462754 Ga0105238_104627542 210
413 3300009553 Ga0105249_10046691 Ga0105249_100466916 210
414 3300013105 Ga0157369_10005499 Ga0157369_1000549910 210
415 3300013105 Ga0157369_10451425 Ga0157369_104514252 210
416 3300013306 Ga0163162_10021427 Ga0163162_100214276 210
417 3300014326 Ga0157380_10106324 Ga0157380_101063242 210
418 3300020070 Ga0206356_11230827 Ga0206356_112308273 210
419 3300020081 Ga0206354_11303983 Ga0206354_113039835 210
420 3300020082 Ga0206353_11106162 Ga0206353_111061621 210
421 3300021358 Ga0213873_10000065 Ga0213873_1000006528 210
422 3300021384 Ga0213876_10000005 Ga0213876_1000000528 210
423 3300021384 Ga0213876_10016540 Ga0213876_100165404 210
424 3300025893 Ga0207682_10000110 Ga0207682_1000011031 210
425 3300025909 Ga0207705_10000002 Ga0207705_10000002417 210
426 3300025912 Ga0207707_10208518 Ga0207707_102085183 210
427 3300025917 Ga0207660_10001170 Ga0207660_100011705 210
428 3300025918 Ga0207662_10326025 Ga0207662_103260252 210
429 3300025919 Ga0207657_10001047 Ga0207657_1000104718 210
430 3300025919 Ga0207657_10006540 Ga0207657_100065407 210
431 3300025919 Ga0207657_10075234 Ga0207657_100752343 210
432 3300025920 Ga0207649_10000035 Ga0207649_10000035118 210
433 3300025921 Ga0207652_10000003 Ga0207652_10000003458 210
434 3300025923 Ga0207681_10130551 Ga0207681_101305512 210
435 3300025924 Ga0207694_10212342 Ga0207694_102123422 210
436 3300025926 Ga0207659_10014093 Ga0207659_100140935 210
437 3300025926 Ga0207659_10504123 Ga0207659_105041232 210
438 3300025927 Ga0207687_10017850 Ga0207687_100178503 210
439 3300025931 Ga0207644_10013457 Ga0207644_100134573 210
440 3300025932 Ga0207690_10000022 Ga0207690_10000022203 210
441 3300025932 Ga0207690_10000522 Ga0207690_1000052234 210
442 3300025932 Ga0207690_10006068 Ga0207690_1000606810 210
443 3300025935 Ga0207709_10152572 Ga0207709_101525722 210
444 3300025942 Ga0207689_10556882 Ga0207689_105568822 210
445 3300025944 Ga0207661_10171190 Ga0207661_101711902 210
446 3300025960 Ga0207651_10765668 Ga0207651_107656681 210
447 3300025981 Ga0207640_10235677 Ga0207640_102356771 210
448 3300025986 Ga0207658_10662154 Ga0207658_106621541 210
449 3300026023 Ga0207677_10000051 Ga0207677_1000005197 210
450 3300026041 Ga0207639_10278785 Ga0207639_102787852 210
451 3300026075 Ga0207708_10221399 Ga0207708_102213992 210
452 3300027665 Ga0209983_1007699 Ga0209983_10076991 210
453 3300028379 Ga0268266_10000173 Ga0268266_1000017386 210
454 3300028381 Ga0268264_10618457 Ga0268264_106184572 210
455 3300031456 Ga0307513_10394843 Ga0307513_103948432 210
456 3300031548 Ga0307408_100047436 Ga0307408_1000474362 210
457 3300031731 Ga0307405_10169729 Ga0307405_101697292 210
458 3300031852 Ga0307410_10280063 Ga0307410_102800632 210
459 3300031852 Ga0307410_10320929 Ga0307410_103209292 210
460 3300031911 Ga0307412_10252537 Ga0307412_102525372 210
461 3300031911 Ga0307412_10423302 Ga0307412_104233022 210
462 3300032002 Ga0307416_100412784 Ga0307416_1004127841 210
463 3300032002 Ga0307416_100620087 Ga0307416_1006200871 210
464 3300032004 Ga0307414_10086509 Ga0307414_100865091 210
465 3300032004 Ga0307414_10472896 Ga0307414_104728962 210
466 3300032005 Ga0307411_10233615 Ga0307411_102336152 210
467 3300039437 Ga0436365_0591960 Ga0436365_0591960_1720_2352 210
468 3300039437 Ga0436365_1369819 Ga0436365_1369819_17290_17922 210
469 3300039453 Ga0436362_0037733 Ga0436362_0037733_17440_18072 210
470 3300041443 Ga0451789_0484133 Ga0451789_0484133_258_893 210
471 3300046537 Ga0495598_0060091 Ga0495598_0060091_383_1015 210
472 3300046616 Ga0495668_0092470 Ga0495668_0092470_105_779 210
473 3300047472 Ga0495686_0072656 Ga0495686_0072656_674_1306 210
474 3300048917 Ga0496114_0038363 Ga0496114_0038363_901_1533 210
475 3300048929 Ga0496126_0410699 Ga0496126_0410699_229_888 210
476 3300049571 Ga0501034_0095274 Ga0501034_0095274_310_942 210
477 3300049571 Ga0501034_0142260 Ga0501034_0142260_1330_1962 210
478 3300049571 Ga0501034_0273929 Ga0501034_0273929_192_845 210
479 3300049579 Ga0501043_0352023 Ga0501043_0352023_67_699 210
480 3300049579 Ga0501043_0472285 Ga0501043_0472285_50_700 210
481 3300049580 Ga0501046_0573486 Ga0501046_0573486_140_772 210
482 3300049581 Ga0501047_0090006 Ga0501047_0090006_2226_2879 210
483 3300049581 Ga0501047_0568972 Ga0501047_0568972_267_899 210
484 3300049585 Ga0501069_0018158 Ga0501069_0018158_793_1425 210
485 3300049586 Ga0501070_0091157 Ga0501070_0091157_55_687 210
486 3300049742 Ga0501080_0141159 Ga0501080_0141159_871_1524 210
487 3300049744 Ga0501083_0179044 Ga0501083_0179044_10_663 210
488 3300049823 Ga0501044_0000730 Ga0501044_0000730_33587_34237 210
489 3300050489 nmdc:mga03683_11679_c1 nmdc:mga03683_11679_c1_870_1538 210
490 3300050490 nmdc:mga03n38_3692_c1 nmdc:mga03n38_3692_c1_2142_2795 210
491 3300050491 nmdc:mga00v17_13083_c1 nmdc:mga00v17_13083_c1_3341_4009 210
492 3300050493 nmdc:mga0k408_13523_c1 nmdc:mga0k408_13523_c1_2799_3452 210
493 3300050495 nmdc:mga04h51_641_c1 nmdc:mga04h51_641_c1_3604_4257 210
494 3300050496 nmdc:mga07m45_299961_c1 nmdc:mga07m45_299961_c1_97_765 210
495 3300050496 nmdc:mga07m45_7_c1 nmdc:mga07m45_7_c1_105471_106124 210
496 3300050516 nmdc:mga0sz30_14312_c1 nmdc:mga0sz30_14312_c1_554_1222 210
497 3300050516 nmdc:mga0sz30_4304_c1 nmdc:mga0sz30_4304_c1_3452_4105 210
498 3300053121 Ga0500607_000854 Ga0500607_000854_7247_7906 210
499 3300053139 Ga0500568_0056679 Ga0500568_0056679_214_882 210
500 3300053142 Ga0500577_0103196 Ga0500577_0103196_216_860 210
501 3300053148 Ga0500590_000464 Ga0500590_000464_11277_11948 210
502 3300053178 Ga0500637_0185373 Ga0500637_0185373_403_1074 210
503 3300053730 Ga0500645_011510 Ga0500645_011510_1029_1682 210
504 3300048904 Ga0496101_0067094 Ga0496101_0067094_1151_1897 211
505 3300048924 Ga0496121_0000070 Ga0496121_0000070_145552_146223 211
506 3300003781 Ga0055536_1006407 Ga0055536_10064073 212
507 3300003784 Ga0055534_1003173 Ga0055534_10031734 212
508 3300003791 Ga0055530_10000710 Ga0055530_1000071014 212
509 3300003794 Ga0055531_10000900 Ga0055531_1000090011 212
510 3300003794 Ga0055531_10009818 Ga0055531_100098186 212
511 3300005456 Ga0070678_100469301 Ga0070678_1004693012 212
512 3300005457 Ga0070662_100248859 Ga0070662_1002488592 212
513 3300005548 Ga0070665_100000541 Ga0070665_10000054130 212
514 3300005618 Ga0068864_100033644 Ga0068864_1000336443 212
515 3300005842 Ga0068858_100000771 Ga0068858_10000077137 212
516 3300009177 Ga0105248_10027636 Ga0105248_100276362 212
517 3300013308 Ga0157375_10885116 Ga0157375_108851161 212
518 3300014325 Ga0163163_10446799 Ga0163163_104467992 212
519 3300021384 Ga0213876_10005473 Ga0213876_100054737 212
520 3300025291 Ga0209675_1001522 Ga0209675_100152212 212
521 3300025292 Ga0209676_1000273 Ga0209676_1000273106 212
522 3300025292 Ga0209676_1000402 Ga0209676_10004028 212
523 3300025292 Ga0209676_1000667 Ga0209676_100066730 212
524 3300025292 Ga0209676_1031770 Ga0209676_10317704 212
525 3300025294 Ga0209025_1023201 Ga0209025_10232014 212
526 3300025298 Ga0209050_1000637 Ga0209050_100063716 212
527 3300025298 Ga0209050_1003693 Ga0209050_10036933 212
528 3300025304 Ga0209257_1000248 Ga0209257_1000248112 212
529 3300025304 Ga0209257_1000435 Ga0209257_100043536 212
530 3300025304 Ga0209257_1038844 Ga0209257_10388441 212
531 3300025315 Ga0207697_10046240 Ga0207697_100462403 212
532 3300025933 Ga0207706_10250049 Ga0207706_102500492 212
533 3300025941 Ga0207711_10008830 Ga0207711_100088308 212
534 3300025961 Ga0207712_10192312 Ga0207712_101923122 212
535 3300026035 Ga0207703_10001689 Ga0207703_100016893 212
536 3300026095 Ga0207676_10001553 Ga0207676_1000155317 212
537 3300026121 Ga0207683_10167776 Ga0207683_101677764 212
538 3300028379 Ga0268266_10001687 Ga0268266_1000168721 212
539 3300031548 Ga0307408_100151379 Ga0307408_1001513792 212
540 3300031731 Ga0307405_10304888 Ga0307405_103048882 212
541 3300031731 Ga0307405_10643660 Ga0307405_106436601 212
542 3300031901 Ga0307406_10138865 Ga0307406_101388651 212
543 3300031901 Ga0307406_10576199 Ga0307406_105761991 212
544 3300031911 Ga0307412_10016837 Ga0307412_100168374 212
545 3300031911 Ga0307412_10038066 Ga0307412_100380662 212
546 3300031911 Ga0307412_10042957 Ga0307412_100429573 212
547 3300031911 Ga0307412_10130868 Ga0307412_101308682 212
548 3300032004 Ga0307414_10001014 Ga0307414_1000101411 212
549 3300032004 Ga0307414_10123950 Ga0307414_101239503 212
550 3300032004 Ga0307414_10132494 Ga0307414_101324942 212
551 3300032004 Ga0307414_10485509 Ga0307414_104855092 212
552 3300036401 Ga0373937_0506291 Ga0373937_0506291_211_864 212
553 3300039437 Ga0436365_0058666 Ga0436365_0058666_5886_6545 212
554 3300041453 Ga0451797_0437705 Ga0451797_0437705_184_846 212
555 3300041509 Ga0451843_0412542 Ga0451843_0412542_184_846 212
556 3300046522 Ga0495643_0068442 Ga0495643_0068442_546_1208 212
557 3300046616 Ga0495668_0000087 Ga0495668_0000087_118817_119479 212
558 3300046660 Ga0495625_0000726 Ga0495625_0000726_7451_8113 212
559 3300046660 Ga0495625_0062479 Ga0495625_0062479_1698_2336 212
560 3300048921 Ga0496118_0221949 Ga0496118_0221949_190_840 212
561 3300048924 Ga0496121_0000201 Ga0496121_0000201_117423_118073 212
562 3300049568 Ga0501031_0206951 Ga0501031_0206951_532_1194 212
563 3300049569 Ga0501032_0033845 Ga0501032_0033845_1323_1985 212
564 3300049570 Ga0501033_0026706 Ga0501033_0026706_1600_2262 212
565 3300049571 Ga0501034_0042149 Ga0501034_0042149_3737_4399 212
566 3300049572 Ga0501036_0122570 Ga0501036_0122570_105_767 212
567 3300049573 Ga0501037_0103407 Ga0501037_0103407_490_1152 212
568 3300049574 Ga0501038_0302257 Ga0501038_0302257_540_1202 212
569 3300049575 Ga0501039_0080056 Ga0501039_0080056_1383_2045 212
570 3300049579 Ga0501043_0077104 Ga0501043_0077104_544_1206 212
571 3300049581 Ga0501047_0114509 Ga0501047_0114509_1834_2484 212
572 3300049581 Ga0501047_0147683 Ga0501047_0147683_917_1579 212
573 3300049581 Ga0501047_0530800 Ga0501047_0530800_94_744 212
574 3300049822 Ga0501035_0341658 Ga0501035_0341658_373_1023 212
575 3300049823 Ga0501044_0219726 Ga0501044_0219726_189_839 212
576 3300049824 Ga0501045_0097025 Ga0501045_0097025_174_836 212
577 3300053116 Ga0500592_015481 Ga0500592_015481_361_1023 212
578 3300053139 Ga0500568_0000814 Ga0500568_0000814_5033_5695 212
579 3300053139 Ga0500568_0014556 Ga0500568_0014556_2771_3409 212
580 3300053140 Ga0500573_0207981 Ga0500573_0207981_218_859 212
581 3300053151 Ga0500604_0000007 Ga0500604_0000007_94704_95342 212
582 3300053151 Ga0500604_0037163 Ga0500604_0037163_473_1135 212
583 3300053153 Ga0500616_0000080 Ga0500616_0000080_175141_175779 212
584 3300053158 Ga0500627_0000035 Ga0500627_0000035_35825_36487 212
585 3300053739 Ga0500587_000415 Ga0500587_000415_663_1301 212
586 3300013307 Ga0157372_10771293 Ga0157372_107712932 213
587 3300028786 Ga0307517_10138615 Ga0307517_101386152 213
588 3300033180 Ga0307510_10004202 Ga0307510_1000420219 213
589 3300039450 Ga0436363_0049765 Ga0436363_0049765_619_1293 213
590 3300042004 Ga0439445_0017912 Ga0439445_0017912_383_1069 213
591 3300044694 Ga0466963_0123449 Ga0466963_0123449_361_1071 213
592 3300046691 Ga0495670_0006827 Ga0495670_0006827_4317_4982 213
593 3300046694 Ga0495649_0067010 Ga0495649_0067010_342_1049 213
594 3300053087 Ga0500643_005450 Ga0500643_005450_2567_3226 213
595 3300053136 Ga0500559_0038539 Ga0500559_0038539_999_1658 213
596 3300000549 LJQas_1006349 LJQas_10063492 215
597 3300017792 Ga0163161_10241234 Ga0163161_102412342 215
598 3300031824 Ga0307413_10608309 Ga0307413_106083091 215
599 3300039437 Ga0436365_1229924 Ga0436365_1229924_468_1136 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

46

228

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9665 44 94
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9415 11 215
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.932 11 215
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9256 11 215
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9168 11 215
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9951 46 92 3.30.63.10
2qorA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9878 46 101 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9796 46 94 3.30.63.10
1s4qA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9565 46 100 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9499 44 94 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A7V0IFV5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9807 11 202 GO:0004385
GO:0005524
GO:0005829
AF-A0A2K9P5S6-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9737 13 195 GO:0004385
GO:0005524
GO:0005829
AF-A1VKF2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9712 11 198 GO:0004385
GO:0005524
GO:0005829
AF-A0A2E0NG25-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9695 11 196 GO:0004385
GO:0005524
GO:0005829
AF-A0A3C1YTT2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9676 12 197 GO:0004385
GO:0005524
GO:0005829

Feature Viewer

pLDDT pTM Quality
88.79 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map