F467899

General Info

Members Datasets Scaffolds Average Seq Length
599 328 599 277

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0254947|Ga0466966_0254947_83_1045
Length 320
Sequence VPSSSAQADDPVSAAREGLFRLRRLLDAPLSRGMTEVDESRLMKKWNMIIDVAECTNCNLCTLAAMDEYVDNEWPGYSAPMPKHGHKWINILQKERGQMPMIDIAYVPTMCNHCDDAPCMKADTGGAITKRGDGIVLIDPVKAKGRKELVEACPYGHIWWNDELQLPQHWTFDAHLIDQGWQQTRGQQSCPTGAMRAIKVEDDEMARLASDEKLEVMRPELGSRPRVYYRNLWRYSKCFIGGSVAEEKNGTVDCVEGASVQLLKDGSSVAVTTTDNYGDFKFDKLDEDSGRYTVQIFSSGRSKTIEATLGASINLGEIRL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
98 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 10.35
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1831614 2162886007 Unclassified 1799
2 2214544920 2209111006 Bacteria 20198
3 ARcpr5oldR_c000395 3300000041 Bacteria 6066
4 ARSoilYngRDRAFT_c00032 3300000042 Bacteria 21998
5 ARcpr5yngRDRAFT_c000061 3300000043 Bacteria 17653
6 ARSoilOldRDRAFT_c000136 3300000044 Bacteria 12915
7 ARCol0oldRDRAFT_c00446 3300000045 Unclassified 3929
8 ARCol0yngRDRAFT_1000139 3300000652 Bacteria 12910
9 JGI24752J21851_1012071 3300001976 Bacteria 1130
10 JGI24743J22301_10007812 3300001991 Bacteria 1863
11 JGI24744J21845_10006076 3300002077 Bacteria 2505
12 JGI24034J26672_10009452 3300002239 Bacteria 1439
13 rootH1_10356764 3300003323 Bacteria 2169
14 Ga0065716_1001581 3300005277 Bacteria 5878
15 Ga0065704_10080762 3300005289 Unclassified 3884
16 Ga0065707_10121940 3300005295 Bacteria 2099
17 Ga0070676_10015980 3300005328 Bacteria 4144
18 Ga0070676_10044243 3300005328 Bacteria 2591
19 Ga0070683_100039525 3300005329 Bacteria 4331
20 Ga0070683_100503720 3300005329 Bacteria 1157
21 Ga0070690_100024154 3300005330 Bacteria 3738
22 Ga0070690_100036744 3300005330 Bacteria 3081
23 Ga0070690_100190943 3300005330 Bacteria 1420
24 Ga0070670_100178055 3300005331 Bacteria 1846
25 Ga0070666_10344930 3300005335 Bacteria 1065
26 Ga0070680_100036582 3300005336 Bacteria 3966
27 Ga0070680_100249408 3300005336 Bacteria 1501
28 Ga0070682_100187077 3300005337 Unclassified 1451
29 Ga0068868_100201031 3300005338 Bacteria 1661
30 Ga0070660_100135248 3300005339 Bacteria 1975
31 Ga0070689_100016595 3300005340 Bacteria 5391
32 Ga0070689_100136274 3300005340 Bacteria 1971
33 Ga0070687_100021169 3300005343 Bacteria 3052
34 Ga0070661_100503256 3300005344 Bacteria 970
35 Ga0070692_10044090 3300005345 Bacteria 2297
36 Ga0070668_100137467 3300005347 Bacteria 1966
37 Ga0070668_100262438 3300005347 Bacteria 1437
38 Ga0070669_100163818 3300005353 Bacteria 1730
39 Ga0070675_100230920 3300005354 Bacteria 1614
40 Ga0070674_100099820 3300005356 Bacteria 2113
41 Ga0070673_100024556 3300005364 Bacteria 4422
42 Ga0070659_100037562 3300005366 Bacteria 3776
43 Ga0070659_100220380 3300005366 Bacteria 1565
44 Ga0070667_100297621 3300005367 Bacteria 1452
45 Ga0070709_10051784 3300005434 Bacteria 2578
46 Ga0070709_10228144 3300005434 Bacteria 1331
47 Ga0070701_10037485 3300005438 Bacteria 2448
48 Ga0070701_10083067 3300005438 Bacteria 1738
49 Ga0070711_100036661 3300005439 Bacteria 3286
50 Ga0070711_100196436 3300005439 Bacteria 1554
51 Ga0070700_100045009 3300005441 Unclassified 2721
52 Ga0070663_100191118 3300005455 Bacteria 1593
53 Ga0070678_100241562 3300005456 Unclassified 1510
54 Ga0070662_100055926 3300005457 Unclassified 2864
55 Ga0070662_100132786 3300005457 Unclassified 1921
56 Ga0070681_10000708 3300005458 Bacteria 27710
57 Ga0068867_100065507 3300005459 Unclassified 2704
58 Ga0068867_100110735 3300005459 Bacteria 2109
59 Ga0070685_10041462 3300005466 Bacteria 2622
60 Ga0070685_10062402 3300005466 Unclassified 2185
61 Ga0070685_10385623 3300005466 Bacteria 967
62 Ga0070699_100012813 3300005518 Bacteria 7228
63 Ga0070699_100185807 3300005518 Bacteria 1845
64 Ga0070679_100206770 3300005530 Bacteria 1927
65 Ga0068853_100199266 3300005539 Bacteria 1821
66 Ga0070672_100407901 3300005543 Unclassified 1165
67 Ga0070686_100149468 3300005544 Bacteria 1634
68 Ga0070686_100347079 3300005544 Bacteria 1114
69 Ga0070686_100524080 3300005544 Bacteria 923
70 Ga0070665_100549906 3300005548 Bacteria 1167
71 Ga0070704_100064974 3300005549 Bacteria 2625
72 Ga0070704_100101533 3300005549 Bacteria 2168
73 Ga0070704_100194567 3300005549 Bacteria 1633
74 Ga0070664_100148659 3300005564 Bacteria 2067
75 Ga0068857_100281175 3300005577 Bacteria 1531
76 Ga0068854_100390104 3300005578 Bacteria 1149
77 Ga0068856_100114199 3300005614 Bacteria 2700
78 Ga0070702_100457015 3300005615 Bacteria 928
79 Ga0068859_100080058 3300005617 Unclassified 3307
80 Ga0068859_100295304 3300005617 Bacteria 1714
81 Ga0068859_100802394 3300005617 Unclassified 1029
82 Ga0068864_100084336 3300005618 Bacteria 2791
83 Ga0068851_10121712 3300005834 Unclassified 1403
84 Ga0068863_100156520 3300005841 Unclassified 2182
85 Ga0068863_100439796 3300005841 Bacteria 1279
86 Ga0068858_100036593 3300005842 Bacteria 4550
87 Ga0068858_100092607 3300005842 Unclassified 2813
88 Ga0068858_100123637 3300005842 Unclassified 2421
89 Ga0068860_100181946 3300005843 Bacteria 2031
90 Ga0068862_100074065 3300005844 Unclassified 2943
91 Ga0081455_10001860 3300005937 Bacteria 25395
92 Ga0081455_10010994 3300005937 Bacteria 9123
93 Ga0081455_10080462 3300005937 Bacteria 2671
94 Ga0081455_10187941 3300005937 Bacteria 1559
95 Ga0081455_10342494 3300005937 Bacteria 1057
96 Ga0081538_10005698 3300005981 Bacteria 11139
97 Ga0081538_10166423 3300005981 Bacteria 970
98 Ga0081540_1000183 3300005983 Bacteria 65356
99 Ga0081540_1005670 3300005983 Bacteria 9277
100 Ga0081540_1009789 3300005983 Bacteria 6562
101 Ga0081540_1033395 3300005983 Bacteria 2795
102 Ga0081540_1120576 3300005983 Bacteria 1089
103 Ga0070717_10294861 3300006028 Bacteria 1441
104 Ga0075365_10011942 3300006038 Bacteria 5131
105 Ga0075365_10038703 3300006038 Bacteria 3102
106 Ga0075365_10104603 3300006038 Bacteria 1941
107 Ga0070715_10058674 3300006163 Bacteria 1681
108 Ga0070715_10109261 3300006163 Bacteria 1302
109 Ga0070712_100025865 3300006175 Bacteria 3905
110 Ga0070712_100203881 3300006175 Bacteria 1555
111 Ga0075362_10066258 3300006177 Bacteria 1641
112 Ga0075367_10055853 3300006178 Bacteria 2344
113 Ga0075367_10148416 3300006178 Bacteria 1454
114 Ga0097621_100059768 3300006237 Bacteria 3122
115 Ga0075428_100030815 3300006844 Bacteria 5931
116 Ga0075428_100051979 3300006844 Bacteria 4493
117 Ga0075430_100000311 3300006846 Bacteria 34566
118 Ga0075430_100128605 3300006846 Bacteria 2111
119 Ga0075430_100246339 3300006846 Bacteria 1481
120 Ga0075431_100045787 3300006847 Bacteria 4509
121 Ga0075431_100170064 3300006847 Bacteria 2239
122 Ga0075431_100207312 3300006847 Bacteria 2004
123 Ga0075431_100793293 3300006847 Bacteria 921
124 Ga0075433_10117018 3300006852 Unclassified 2365
125 Ga0075433_10450788 3300006852 Unclassified 1134
126 Ga0075434_100005301 3300006871 Bacteria 11729
127 Ga0075434_100220232 3300006871 Bacteria 1917
128 Ga0075429_100070188 3300006880 Bacteria 3050
129 Ga0075429_100169660 3300006880 Bacteria 1911
130 Ga0075436_100064018 3300006914 Bacteria 2542
131 Ga0075436_100131530 3300006914 Bacteria 1755
132 Ga0097620_100080058 3300006931 Unclassified 3307
133 Ga0097620_100295304 3300006931 Bacteria 1714
134 Ga0097620_100802480 3300006931 Unclassified 1029
135 Ga0099794_10007525 3300007265 Bacteria 4480
136 Ga0099794_10084631 3300007265 Bacteria 1568
137 Ga0099795_10008849 3300007788 Bacteria 2895
138 Ga0105240_10118655 3300009093 Bacteria 3188
139 Ga0111539_10005693 3300009094 Bacteria 16124
140 Ga0111539_10609068 3300009094 Bacteria 1272
141 Ga0111539_11377508 3300009094 Bacteria 818
142 Ga0105245_10074900 3300009098 Bacteria 3081
143 Ga0114129_10009721 3300009147 Bacteria 13721
144 Ga0114129_10024961 3300009147 Bacteria 8474
145 Ga0114129_10128924 3300009147 Bacteria 3476
146 Ga0114129_10191202 3300009147 Bacteria 2779
147 Ga0114129_10218131 3300009147 Bacteria 2575
148 Ga0114129_10357825 3300009147 Bacteria 1932
149 Ga0114129_10388389 3300009147 Bacteria 1842
150 Ga0105241_10321271 3300009174 Bacteria 1335
151 Ga0105242_10186229 3300009176 Bacteria 1835
152 Ga0105248_10097526 3300009177 Bacteria 3312
153 Ga0105248_10183124 3300009177 Bacteria 2360
154 Ga0105248_10456875 3300009177 Bacteria 1439
155 Ga0105237_10080387 3300009545 Bacteria 3250
156 Ga0105238_10327002 3300009551 Unclassified 1519
157 Ga0105249_10158485 3300009553 Unclassified 2185
158 Ga0105249_10537932 3300009553 Bacteria 1218
159 Ga0105246_10103964 3300011119 Bacteria 2074
160 Ga0157344_1000470 3300012476 Bacteria 1578
161 Ga0157323_1003505 3300012495 Bacteria 950
162 Ga0157373_10238475 3300013100 Bacteria 1285
163 Ga0157370_10005113 3300013104 Bacteria 14793
164 Ga0157374_10567377 3300013296 Unclassified 1143
165 Ga0157378_10167721 3300013297 Bacteria 2058
166 Ga0163162_10166546 3300013306 Bacteria 2328
167 Ga0163162_10316386 3300013306 Bacteria 1693
168 Ga0163162_10510694 3300013306 Bacteria 1332
169 Ga0157372_10035808 3300013307 Bacteria 5466
170 Ga0157372_10296489 3300013307 Bacteria 1881
171 Ga0157372_10625198 3300013307 Bacteria 1255
172 Ga0157375_10148696 3300013308 Bacteria 2476
173 Ga0157375_10276789 3300013308 Bacteria 1841
174 Ga0163163_10039201 3300014325 Bacteria 4622
175 Ga0163163_10188340 3300014325 Unclassified 2112
176 Ga0157380_10221660 3300014326 Bacteria 1692
177 Ga0182008_10113814 3300014497 Unclassified 1341
178 Ga0157377_10061450 3300014745 Bacteria 2147
179 Ga0157376_10040052 3300014969 Bacteria 3827
180 Ga0157376_10097644 3300014969 Bacteria 2559
181 Ga0163161_10093783 3300017792 Bacteria 2224
182 Ga0207656_10017789 3300025321 Unclassified 2789
183 Ga0207682_10045090 3300025893 Bacteria 1809
184 Ga0207692_10315850 3300025898 Bacteria 955
185 Ga0207710_10106633 3300025900 Bacteria 1327
186 Ga0207688_10022504 3300025901 Bacteria 3449
187 Ga0207680_10105409 3300025903 Bacteria 1819
188 Ga0207647_10014286 3300025904 Bacteria 5477
189 Ga0207685_10061019 3300025905 Bacteria 1493
190 Ga0207685_10067547 3300025905 Bacteria 1438
191 Ga0207699_10012929 3300025906 Bacteria 4256
192 Ga0207645_10019185 3300025907 Bacteria 4488
193 Ga0207643_10000872 3300025908 Bacteria 18178
194 Ga0207684_10158518 3300025910 Bacteria 1948
195 Ga0207707_10023677 3300025912 Bacteria 5370
196 Ga0207707_10179340 3300025912 Bacteria 1849
197 Ga0207693_10008359 3300025915 Bacteria 8471
198 Ga0207693_10038010 3300025915 Bacteria 3792
199 Ga0207693_10040307 3300025915 Bacteria 3678
200 Ga0207693_10077132 3300025915 Bacteria 2609
201 Ga0207663_10115023 3300025916 Bacteria 1832
202 Ga0207660_10004266 3300025917 Bacteria 9319
203 Ga0207662_10007580 3300025918 Bacteria 5912
204 Ga0207657_10023526 3300025919 Bacteria 5735
205 Ga0207652_10010306 3300025921 Bacteria 7524
206 Ga0207659_10291224 3300025926 Bacteria 1338
207 Ga0207687_10396859 3300025927 Bacteria 1134
208 Ga0207700_10142650 3300025928 Bacteria 1970
209 Ga0207644_10035189 3300025931 Bacteria 3508
210 Ga0207690_10242211 3300025932 Unclassified 1389
211 Ga0207706_10056684 3300025933 Unclassified 3454
212 Ga0207706_10272722 3300025933 Unclassified 1476
213 Ga0207686_10135763 3300025934 Bacteria 1693
214 Ga0207709_10320725 3300025935 Unclassified 1159
215 Ga0207670_10002139 3300025936 Bacteria 10336
216 Ga0207670_10189690 3300025936 Bacteria 1555
217 Ga0207670_10416597 3300025936 Bacteria 1077
218 Ga0207669_10020543 3300025937 Bacteria 3467
219 Ga0207669_10046523 3300025937 Bacteria 2564
220 Ga0207704_10092037 3300025938 Bacteria 1994
221 Ga0207665_10006295 3300025939 Bacteria 7873
222 Ga0207665_10157812 3300025939 Bacteria 1629
223 Ga0207691_10007735 3300025940 Bacteria 10345
224 Ga0207711_10003367 3300025941 Bacteria 13852
225 Ga0207711_10390130 3300025941 Bacteria 1293
226 Ga0207661_10346787 3300025944 Bacteria 1339
227 Ga0207679_10167690 3300025945 Bacteria 1804
228 Ga0207668_10028831 3300025972 Bacteria 3634
229 Ga0207658_10166521 3300025986 Bacteria 1811
230 Ga0207703_10210367 3300026035 Bacteria 1734
231 Ga0207703_10612983 3300026035 Bacteria 1030
232 Ga0207639_10049286 3300026041 Bacteria 3193
233 Ga0207678_10005238 3300026067 Bacteria 11614
234 Ga0207708_10005514 3300026075 Bacteria 9339
235 Ga0207708_10059087 3300026075 Unclassified 2926
236 Ga0207641_10284515 3300026088 Bacteria 1556
237 Ga0207648_10028821 3300026089 Bacteria 4922
238 Ga0207648_10117889 3300026089 Unclassified 2333
239 Ga0207676_10034428 3300026095 Bacteria 3835
240 Ga0207674_10058822 3300026116 Bacteria 3892
241 Ga0207675_100035978 3300026118 Bacteria 4618
242 Ga0207683_10051673 3300026121 Bacteria 3601
243 Ga0207698_10130895 3300026142 Unclassified 2143
244 Ga0209179_1008104 3300027512 Bacteria 1760
245 Ga0207428_10004567 3300027907 Bacteria 13120
246 Ga0207428_10173195 3300027907 Bacteria 1633
247 Ga0207428_10343874 3300027907 Bacteria 1098
248 Ga0265357_1000526 3300028023 Bacteria 2290
249 Ga0268266_10341305 3300028379 Unclassified 1406
250 Ga0268266_10623664 3300028379 Bacteria 1037
251 Ga0268265_10070804 3300028380 Unclassified 2713
252 Ga0268265_10280953 3300028380 Bacteria 1489
253 Ga0265337_1001529 3300028556 Bacteria 11350
254 Ga0265338_10010460 3300028800 Bacteria 10872
255 Ga0265770_1020447 3300030878 Bacteria 1046
256 Ga0265760_10029890 3300031090 Unclassified 1603
257 Ga0265330_10024010 3300031235 Unclassified 2766
258 Ga0265332_10001364 3300031238 Bacteria 13853
259 Ga0265325_10035404 3300031241 Bacteria 2652
260 Ga0265325_10058454 3300031241 Bacteria 1964
261 Ga0265340_10009578 3300031247 Bacteria 5194
262 Ga0265340_10143968 3300031247 Unclassified 1089
263 Ga0265339_10000133 3300031249 Bacteria 60726
264 Ga0265331_10010346 3300031250 Bacteria 5167
265 Ga0265316_10191371 3300031344 Bacteria 1520
266 Ga0265313_10000491 3300031595 Bacteria 41687
267 Ga0265314_10010268 3300031711 Bacteria 7827
268 Ga0265342_10000328 3300031712 Bacteria 53590
269 Ga0316578_10059481 3300031728 Bacteria 2248
270 Ga0373930_0000042 3300034816 Bacteria 11263
271 Ga0373948_0000129 3300034817 Bacteria 7918
272 Ga0373950_0001254 3300034818 Unclassified 3278
273 Ga0373938_0000030 3300034957 Bacteria 18683
274 Ga0373938_0021761 3300034957 Bacteria 1303
275 Ga0373926_0118501 3300035083 Bacteria 997
276 Ga0373928_0000123 3300035084 Bacteria 14455
277 Ga0373928_0021523 3300035084 Bacteria 1361
278 Ga0373929_0000703 3300035085 Bacteria 6477
279 Ga0373934_0017783 3300035086 Bacteria 2716
280 Ga0373934_0039593 3300035086 Bacteria 1859
281 Ga0373940_0000022 3300035088 Bacteria 17194
282 Ga0373944_0006259 3300035089 Bacteria 3154
283 Ga0373949_0000438 3300035090 Bacteria 14335
284 Ga0373951_0004506 3300035091 Unclassified 3301
285 Ga0373952_0000180 3300035092 Bacteria 9797
286 Ga0373923_0032815 3300035111 Bacteria 2099
287 Ga0373923_0121884 3300035111 Bacteria 1166
288 Ga0373932_0000683 3300035112 Bacteria 10253
289 Ga0373932_0014144 3300035112 Bacteria 2001
290 Ga0373936_0001692 3300035113 Bacteria 8090
291 Ga0373939_0000329 3300035114 Bacteria 12192
292 Ga0373941_0000049 3300035115 Bacteria 17770
293 Ga0373945_0005566 3300035116 Unclassified 4037
294 Ga0373945_0008967 3300035116 Bacteria 3270
295 Ga0373953_0161825 3300035117 Bacteria 962
296 Ga0373954_0013000 3300035118 Bacteria 3706
297 Ga0373954_0065137 3300035118 Bacteria 1724
298 Ga0373954_0089043 3300035118 Bacteria 1481
299 Ga0373954_0094761 3300035118 Bacteria 1437
300 Ga0373956_0003856 3300035119 Bacteria 6027
301 Ga0373956_0149576 3300035119 Bacteria 1098
302 Ga0373957_0017204 3300035120 Bacteria 2514
303 Ga0373960_0000240 3300035121 Bacteria 10234
304 Ga0373943_0005937 3300035170 Bacteria 5479
305 Ga0373943_0074089 3300035170 Bacteria 1730
306 Ga0373943_0094098 3300035170 Bacteria 1556
307 Ga0373946_0010660 3300035171 Bacteria 3408
308 Ga0373946_0040899 3300035171 Unclassified 1899
309 Ga0373955_0357529 3300035172 Unclassified 885
310 Ga0373961_0001448 3300035241 Bacteria 6991
311 Ga0373962_0000637 3300035242 Bacteria 7969
312 Ga0316574_0000202 3300035398 Bacteria 20869
313 Ga0373924_0002618 3300035410 Bacteria 6074
314 Ga0373924_0003107 3300035410 Bacteria 5667
315 Ga0373924_0038587 3300035410 Bacteria 1949
316 Ga0373931_0002197 3300035691 Bacteria 8618
317 Ga0373931_0014415 3300035691 Unclassified 3863
318 Ga0373931_0161493 3300035691 Bacteria 1314
319 Ga0373935_0000337 3300035692 Bacteria 23756
320 Ga0373935_0025186 3300035692 Bacteria 3666
321 Ga0373935_0043417 3300035692 Bacteria 2829
322 Ga0373935_0045529 3300035692 Bacteria 2769
323 Ga0373935_0318938 3300035692 Bacteria 1102
324 Ga0373927_0010461 3300035695 Bacteria 6184
325 Ga0373927_0017168 3300035695 Bacteria 4769
326 Ga0373927_0017198 3300035695 Bacteria 4763
327 Ga0373927_0048991 3300035695 Bacteria 2732
328 Ga0373927_0122483 3300035695 Bacteria 1697
329 Ga0373927_0205603 3300035695 Unclassified 1293
330 Ga0373927_0229033 3300035695 Bacteria 1221
331 Ga0373933_0001345 3300035724 Bacteria 14486
332 Ga0373933_0008931 3300035724 Bacteria 5466
333 Ga0373933_0124154 3300035724 Bacteria 1619
334 Ga0373947_0009229 3300035725 Bacteria 5669
335 Ga0373947_0020264 3300035725 Bacteria 3838
336 Ga0373947_0074759 3300035725 Bacteria 2086
337 Ga0373947_0101560 3300035725 Bacteria 1808
338 Ga0373947_0138367 3300035725 Bacteria 1560
339 Ga0373947_0163332 3300035725 Bacteria 1441
340 Ga0373947_0181537 3300035725 Bacteria 1370
341 Ga0373937_0000597 3300036401 Bacteria 31969
342 Ga0373937_0000934 3300036401 Bacteria 24791
343 Ga0373937_0008587 3300036401 Bacteria 8872
344 Ga0373937_0031848 3300036401 Bacteria 4780
345 Ga0373937_0229462 3300036401 Bacteria 1748
346 Ga0316584_0108806 3300036712 Bacteria 2074
347 Ga0373925_0000741 3300037068 Bacteria 29997
348 Ga0373925_0019319 3300037068 Bacteria 4955
349 Ga0373925_0040893 3300037068 Bacteria 3434
350 Ga0373925_0099428 3300037068 Bacteria 2234
351 Ga0373925_0110476 3300037068 Bacteria 2123
352 Ga0373925_0164119 3300037068 Bacteria 1751
353 Ga0373925_0182167 3300037068 Bacteria 1663
354 Ga0373925_0463873 3300037068 Unclassified 1038
355 Ga0373925_0500799 3300037068 Bacteria 997
356 Ga0436364_1223108 3300037853 Bacteria 3679
357 Ga0395901_0367919 3300038443 Bacteria 1481
358 Ga0436365_1676454 3300039437 Unclassified 2576
359 Ga0436360_0330917 3300039438 Bacteria 2392
360 Ga0436361_1044138 3300039447 Bacteria 5868
361 Ga0436363_1667002 3300039450 Bacteria 1536
362 Ga0466966_0254947 3300044684 Bacteria 1057
363 Ga0466963_0161058 3300044694 Bacteria 1562
364 Ga0453684_0106785 3300044712 Unclassified 3411
365 Ga0466957_0043673 3300044842 Bacteria 2715
366 Ga0466959_0125017 3300045049 Bacteria 1826
367 Ga0451576_0066990 3300045051 Unclassified 3737
368 Ga0495592_0000188 3300046454 Bacteria 54485
369 Ga0495592_0082174 3300046454 Bacteria 2329
370 Ga0495603_0018977 3300046455 Bacteria 4162
371 Ga0495629_0046228 3300046459 Bacteria 3053
372 Ga0495629_0092404 3300046459 Bacteria 2112
373 Ga0495629_0103854 3300046459 Bacteria 1982
374 Ga0495651_0012463 3300046462 Bacteria 6557
375 Ga0495651_0014205 3300046462 Bacteria 6155
376 Ga0495653_0000198 3300046463 Bacteria 49009
377 Ga0495653_0047651 3300046463 Bacteria 3314
378 Ga0495582_0058040 3300046473 Bacteria 2134
379 Ga0495582_0089684 3300046473 Bacteria 1714
380 Ga0495582_0091039 3300046473 Bacteria 1701
381 Ga0495605_0076281 3300046474 Bacteria 1575
382 Ga0495662_0000720 3300046476 Bacteria 15794
383 Ga0495662_0004951 3300046476 Bacteria 6665
384 Ga0495664_0000002 3300046477 Bacteria 625183
385 Ga0495664_0000375 3300046477 Bacteria 21707
386 Ga0495584_0000293 3300046491 Bacteria 35341
387 Ga0495584_0018615 3300046491 Bacteria 3530
388 Ga0495585_0138323 3300046492 Bacteria 1277
389 Ga0495608_0000009 3300046511 Bacteria 266614
390 Ga0495618_0000005 3300046514 Bacteria 230421
391 Ga0495618_0004650 3300046514 Bacteria 8399
392 Ga0495628_0000002 3300046516 Bacteria 589399
393 Ga0495628_0080850 3300046516 Bacteria 2525
394 Ga0495630_0000614 3300046517 Bacteria 25848
395 Ga0495630_0017955 3300046517 Bacteria 5190
396 Ga0495630_0036987 3300046517 Bacteria 3650
397 Ga0495644_0092159 3300046523 Bacteria 1144
398 Ga0495644_0155522 3300046523 Bacteria 876
399 Ga0495663_0041205 3300046525 Unclassified 1404
400 Ga0495666_0091424 3300046526 Bacteria 1436
401 Ga0495652_0000004 3300046529 Bacteria 588877
402 Ga0495652_0040209 3300046529 Bacteria 4041
403 Ga0495665_0107591 3300046531 Bacteria 1463
404 Ga0495640_0000005 3300046533 Bacteria 318271
405 Ga0495640_0006783 3300046533 Bacteria 9035
406 Ga0495640_0158241 3300046533 Bacteria 1453
407 Ga0495640_0159682 3300046533 Bacteria 1445
408 Ga0495586_0084897 3300046535 Bacteria 1743
409 Ga0495586_0177770 3300046535 Bacteria 1203
410 Ga0495587_0000007 3300046536 Bacteria 290788
411 Ga0495587_0196043 3300046536 Bacteria 1143
412 Ga0495609_0145750 3300046538 Bacteria 1009
413 Ga0495645_0000003 3300046543 Bacteria 570133
414 Ga0495645_0012230 3300046543 Bacteria 6044
415 Ga0495633_0059262 3300046558 Bacteria 1796
416 Ga0495633_0214064 3300046558 Bacteria 883
417 Ga0495667_0000002 3300046559 Bacteria 437535
418 Ga0495667_0060226 3300046559 Bacteria 2490
419 Ga0495667_0179533 3300046559 Unclassified 1359
420 Ga0495668_0166948 3300046616 Bacteria 1206
421 Ga0495634_0000129 3300046642 Bacteria 65082
422 Ga0495634_0094839 3300046642 Unclassified 1933
423 Ga0495634_0224304 3300046642 Bacteria 1159
424 Ga0495635_0000289 3300046663 Bacteria 32189
425 Ga0495635_0022667 3300046663 Bacteria 4377
426 Ga0495635_0024750 3300046663 Bacteria 4184
427 Ga0495657_0000781 3300046675 Bacteria 28299
428 Ga0495657_0015918 3300046675 Bacteria 5489
429 Ga0495599_0000001 3300046678 Bacteria 537563
430 Ga0495623_0000001 3300046679 Bacteria 313861
431 Ga0495623_0025557 3300046679 Bacteria 3804
432 Ga0495646_0000013 3300046680 Bacteria 159700
433 Ga0495646_0122495 3300046680 Bacteria 1470
434 Ga0495647_0030190 3300046681 Bacteria 2010
435 Ga0495658_0106054 3300046683 Bacteria 1684
436 Ga0495658_0114725 3300046683 Bacteria 1623
437 Ga0495658_0192531 3300046683 Bacteria 1268
438 Ga0495669_0135910 3300046684 Bacteria 1159
439 Ga0495613_0073747 3300046689 Bacteria 2486
440 Ga0495613_0183065 3300046689 Unclassified 1483
441 Ga0495624_0034192 3300046690 Bacteria 3289
442 Ga0495624_0068235 3300046690 Bacteria 2217
443 Ga0495670_0065940 3300046691 Bacteria 1826
444 Ga0495649_0058802 3300046694 Bacteria 2071
445 Ga0495600_0000233 3300046809 Bacteria 30755
446 Ga0495600_0414162 3300046809 Bacteria 837
447 Ga0495581_0014853 3300047315 Bacteria 4517
448 Ga0495581_0057301 3300047315 Bacteria 2249
449 Ga0495581_0061810 3300047315 Bacteria 2164
450 Ga0495581_0174679 3300047315 Bacteria 1256
451 Ga0495604_0000005 3300047317 Bacteria 424516
452 Ga0495604_0238484 3300047317 Bacteria 1245
453 Ga0495674_0000003 3300047319 Bacteria 562126
454 Ga0495674_0026624 3300047319 Bacteria 5291
455 Ga0495674_0138498 3300047319 Bacteria 2047
456 Ga0495674_0205843 3300047319 Bacteria 1631
457 Ga0495674_0234323 3300047319 Bacteria 1514
458 Ga0495676_0059847 3300047321 Bacteria 2988
459 Ga0495676_0144694 3300047321 Bacteria 1699
460 Ga0495680_0000002 3300047322 Bacteria 197533
461 Ga0495680_0292774 3300047322 Bacteria 1145
462 Ga0495675_0000437 3300047444 Bacteria 27820
463 Ga0495684_0000020 3300047471 Bacteria 148507
464 Ga0495684_0002950 3300047471 Bacteria 13397
465 Ga0495684_0025573 3300047471 Bacteria 4535
466 Ga0495593_0020549 3300047673 Bacteria 3697
467 Ga0495602_0000027 3300048088 Bacteria 145010
468 Ga0495602_0006017 3300048088 Bacteria 12738
469 Ga0495602_0114719 3300048088 Bacteria 2181
470 Ga0496100_0001551 3300048903 Bacteria 11289
471 Ga0496100_0058396 3300048903 Bacteria 2531
472 Ga0496101_0001012 3300048904 Bacteria 16558
473 Ga0496101_0033510 3300048904 Bacteria 3623
474 Ga0496101_0325923 3300048904 Bacteria 1205
475 Ga0496101_0391724 3300048904 Bacteria 1093
476 Ga0496102_0033538 3300048905 Bacteria 4614
477 Ga0496102_0062761 3300048905 Unclassified 3402
478 Ga0496102_0073679 3300048905 Bacteria 3138
479 Ga0496102_0094133 3300048905 Unclassified 2776
480 Ga0496102_0146468 3300048905 Bacteria 2217
481 Ga0496102_0173890 3300048905 Bacteria 2027
482 Ga0496102_0641566 3300048905 Bacteria 985
483 Ga0496103_0091513 3300048906 Bacteria 1919
484 Ga0496103_0363260 3300048906 Bacteria 931
485 Ga0496104_0000629 3300048907 Bacteria 30223
486 Ga0496104_0001130 3300048907 Bacteria 22846
487 Ga0496104_0001756 3300048907 Bacteria 18725
488 Ga0496104_0098229 3300048907 Bacteria 2803
489 Ga0496105_0001322 3300048908 Bacteria 17343
490 Ga0496105_0019711 3300048908 Bacteria 5441
491 Ga0496105_0040140 3300048908 Bacteria 3858
492 Ga0496105_0124346 3300048908 Bacteria 2126
493 Ga0496105_0192272 3300048908 Unclassified 1668
494 Ga0496105_0335131 3300048908 Bacteria 1210
495 Ga0496106_0014871 3300048909 Bacteria 5757
496 Ga0496106_0022634 3300048909 Bacteria 4670
497 Ga0496106_0077696 3300048909 Bacteria 2546
498 Ga0496106_0099112 3300048909 Bacteria 2259
499 Ga0496106_0297069 3300048909 Unclassified 1295
500 Ga0496106_0662152 3300048909 Bacteria 834
501 Ga0496107_0065946 3300048910 Bacteria 2624
502 Ga0496107_0244389 3300048910 Bacteria 1335
503 Ga0496108_0002891 3300048911 Bacteria 13786
504 Ga0496108_0009174 3300048911 Bacteria 8006
505 Ga0496108_0211421 3300048911 Bacteria 1684
506 Ga0496109_0002809 3300048912 Bacteria 14583
507 Ga0496109_0036314 3300048912 Bacteria 4447
508 Ga0496109_0145202 3300048912 Bacteria 2219
509 Ga0496109_0269106 3300048912 Unclassified 1605
510 Ga0496110_0024942 3300048913 Bacteria 5103
511 Ga0496110_0042460 3300048913 Bacteria 3969
512 Ga0496110_0131951 3300048913 Bacteria 2256
513 Ga0496110_0623954 3300048913 Bacteria 977
514 Ga0496111_0030271 3300048914 Unclassified 3849
515 Ga0496111_0096207 3300048914 Bacteria 2173
516 Ga0496111_0149255 3300048914 Bacteria 1734
517 Ga0496112_0009460 3300048915 Bacteria 8783
518 Ga0496112_0102058 3300048915 Bacteria 2838
519 Ga0496112_0154440 3300048915 Bacteria 2262
520 Ga0496112_0165948 3300048915 Bacteria 2174
521 Ga0496113_0072484 3300048916 Bacteria 2621
522 Ga0496113_0175849 3300048916 Bacteria 1696
523 Ga0496114_0032157 3300048917 Bacteria 4317
524 Ga0496114_0075244 3300048917 Unclassified 2844
525 Ga0496114_0088863 3300048917 Bacteria 2621
526 Ga0496115_0022900 3300048918 Bacteria 4846
527 Ga0496115_0025523 3300048918 Bacteria 4601
528 Ga0496115_0054644 3300048918 Bacteria 3207
529 Ga0496115_0072173 3300048918 Bacteria 2800
530 Ga0496115_0100877 3300048918 Bacteria 2366
531 Ga0496115_0293449 3300048918 Bacteria 1333
532 Ga0501036_0476081 3300049572 Bacteria 1040
533 Ga0501037_0420029 3300049573 Bacteria 915
534 Ga0501047_0140762 3300049581 Bacteria 2291
535 Ga0501048_0206598 3300049582 Bacteria 1393
536 Ga0501070_0050832 3300049586 Bacteria 3440
537 Ga0501072_0120885 3300049588 Bacteria 2087
538 Ga0501072_0251235 3300049588 Bacteria 1408
539 Ga0501073_0288328 3300049589 Bacteria 1133
540 Ga0501075_0023405 3300049591 Unclassified 4523
541 Ga0501075_0657910 3300049591 Bacteria 799
542 Ga0501077_0014216 3300049593 Bacteria 4998
543 Ga0501079_0283763 3300049741 Bacteria 1295
544 Ga0501079_0355756 3300049741 Bacteria 1147
545 Ga0501081_0003438 3300049743 Bacteria 10104
546 Ga0501044_0389579 3300049823 Bacteria 1307
547 nmdc:mga03683_40001_c1 3300050489 Unclassified 1921
548 nmdc:mga0yw44_918_c1 3300050492 Bacteria 11147
549 nmdc:mga06z11_309953_c1 3300050494 Bacteria 940
550 nmdc:mga06z11_38348_c1 3300050494 Bacteria 2379
551 nmdc:mga05p37_130171_c1 3300050507 Bacteria 1949
552 nmdc:mga05p37_137391_c1 3300050507 Bacteria 2996
553 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
554 nmdc:mga05p37_64007_c1 3300050507 Bacteria 4525
555 nmdc:mga05p37_9175_c1 3300050507 Bacteria 11692
556 nmdc:mga09592_118300_c1 3300050508 Unclassified 2274
557 nmdc:mga09592_253335_c1 3300050508 Bacteria 1526
558 nmdc:mga0qj67_111_c1 3300050509 Bacteria 53806
559 nmdc:mga0qj67_29143_c1 3300050509 Bacteria 4287
560 nmdc:mga06r32_165598_c2 3300050510 Bacteria 1632
561 nmdc:mga06r32_70468_c1 3300050510 Bacteria 3381
562 nmdc:mga08y16_120737_c1 3300050511 Bacteria 2727
563 nmdc:mga08y16_15633_c1 3300050511 Bacteria 7982
564 nmdc:mga08y16_299076_c1 3300050511 Bacteria 1659
565 nmdc:mga08y16_36613_c1 3300050511 Bacteria 5153
566 nmdc:mga0n895_215308_c1 3300050512 Bacteria 1950
567 nmdc:mga0n895_512431_c1 3300050512 Bacteria 1208
568 nmdc:mga0rr50_440609_c1 3300050513 Bacteria 1103
569 nmdc:mga08x19_159289_c1 3300050514 Bacteria 1532
570 nmdc:mga08x19_80903_c1 3300050514 Bacteria 2133
571 nmdc:mga0a205_317162_c1 3300050515 Bacteria 1430
572 nmdc:mga0a205_31909_c1 3300050515 Bacteria 5049
573 nmdc:mga0a205_81197_c1 3300050515 Bacteria 3132
574 Ga0495601_0000010 3300053077 Bacteria 266222
575 Ga0495601_0008245 3300053077 Bacteria 6148
576 Ga0495601_0024234 3300053077 Bacteria 3737
577 Ga0495601_0121364 3300053077 Bacteria 1697
578 Ga0495612_0000002 3300053078 Bacteria 310466
579 Ga0495612_0000697 3300053078 Bacteria 13585
580 Ga0495612_0009258 3300053078 Bacteria 3996
581 Ga0495612_0168114 3300053078 Bacteria 959
582 Ga0495595_0000184 3300053084 Bacteria 25097
583 Ga0495595_0000714 3300053084 Bacteria 12676
584 Ga0495595_0063414 3300053084 Unclassified 1735
585 Ga0495619_0000002 3300053085 Bacteria 530226
586 Ga0495619_0009180 3300053085 Bacteria 6245
587 Ga0495619_0018329 3300053085 Bacteria 4441
588 Ga0495619_0055176 3300053085 Bacteria 2631
589 Ga0495619_0057164 3300053085 Unclassified 2588
590 Ga0495619_0061884 3300053085 Bacteria 2491
591 Ga0495619_0187824 3300053085 Bacteria 1430
592 Ga0495619_0274712 3300053085 Bacteria 1168
593 Ga0501084_0032380 3300054114 Unclassified 4373
594 Ga0501084_0056755 3300054114 Bacteria 3276
595 Ga0501082_0150963 3300060353 Bacteria 2018
596 Ga0501082_0262109 3300060353 Bacteria 1504
597 Ga0501082_0309010 3300060353 Bacteria 1377
598 Ga0501082_0325657 3300060353 Bacteria 1339
599 Ga0530510_0210498 3300061734 Bacteria 1445

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0414162 Ga0495600_0414162_15_734 238
2 3300048905 Ga0496102_0641566 Ga0496102_0641566_16_735 238
3 3300035171 Ga0373946_0010660 Ga0373946_0010660_20_742 239
4 3300035695 Ga0373927_0122483 Ga0373927_0122483_949_1671 239
5 3300035725 Ga0373947_0074759 Ga0373947_0074759_1354_2076 239
6 3300046459 Ga0495629_0092404 Ga0495629_0092404_29_751 239
7 3300047321 Ga0495676_0144694 Ga0495676_0144694_14_736 239
8 3300048903 Ga0496100_0058396 Ga0496100_0058396_1794_2516 239
9 3300049591 Ga0501075_0657910 Ga0501075_0657910_29_751 239
10 3300054114 Ga0501084_0056755 Ga0501084_0056755_2534_3256 239
11 3300046558 Ga0495633_0214064 Ga0495633_0214064_28_795 244
12 3300009094 Ga0111539_11377508 Ga0111539_113775081 253
13 3300048913 Ga0496110_0623954 Ga0496110_0623954_186_950 253
14 3300035118 Ga0373954_0094761 Ga0373954_0094761_125_892 254
15 3300036401 Ga0373937_0229462 Ga0373937_0229462_840_1607 254
16 3300046455 Ga0495603_0018977 Ga0495603_0018977_3369_4136 254
17 3300046523 Ga0495644_0155522 Ga0495644_0155522_83_850 254
18 3300048909 Ga0496106_0662152 Ga0496106_0662152_60_824 254
19 3300049741 Ga0501079_0283763 Ga0501079_0283763_494_1261 254
20 3300049741 Ga0501079_0355756 Ga0501079_0355756_35_802 254
21 3300006844 Ga0075428_100051979 Ga0075428_1000519792 258
22 3300006847 Ga0075431_100045787 Ga0075431_1000457872 258
23 3300046523 Ga0495644_0092159 Ga0495644_0092159_285_1121 258
24 3300050507 nmdc:mga05p37_137391_c1 nmdc:mga05p37_137391_c1_819_1655 258
25 3300046491 Ga0495584_0000293 Ga0495584_0000293_19377_20243 259
26 3300035724 Ga0373933_0124154 Ga0373933_0124154_575_1360 260
27 3300031711 Ga0265314_10010268 Ga0265314_100102684 261
28 3300035118 Ga0373954_0065137 Ga0373954_0065137_894_1712 262
29 3300035117 Ga0373953_0161825 Ga0373953_0161825_50_874 263
30 3300038443 Ga0395901_0367919 Ga0395901_0367919_579_1400 263
31 3300006880 Ga0075429_100070188 Ga0075429_1000701882 264
32 3300009147 Ga0114129_10388389 Ga0114129_103883892 264
33 3300050508 nmdc:mga09592_253335_c1 nmdc:mga09592_253335_c1_75_908 264
34 3300050515 nmdc:mga0a205_317162_c1 nmdc:mga0a205_317162_c1_186_1031 266
35 3300005937 Ga0081455_10342494 Ga0081455_103424942 267
36 3300005983 Ga0081540_1005670 Ga0081540_10056708 267
37 3300006177 Ga0075362_10066258 Ga0075362_100662582 267
38 3300006852 Ga0075433_10450788 Ga0075433_104507881 267
39 3300025936 Ga0207670_10416597 Ga0207670_104165971 267
40 3300035086 Ga0373934_0039593 Ga0373934_0039593_179_1012 267
41 3300035410 Ga0373924_0038587 Ga0373924_0038587_830_1663 267
42 3300035692 Ga0373935_0318938 Ga0373935_0318938_135_968 267
43 3300036401 Ga0373937_0000934 Ga0373937_0000934_22588_23421 267
44 3300047319 Ga0495674_0138498 Ga0495674_0138498_856_1689 267
45 3300005330 Ga0070690_100190943 Ga0070690_1001909432 268
46 3300005336 Ga0070680_100036582 Ga0070680_1000365822 268
47 3300005458 Ga0070681_10000708 Ga0070681_1000070828 268
48 3300005530 Ga0070679_100206770 Ga0070679_1002067702 268
49 3300005544 Ga0070686_100524080 Ga0070686_1005240801 268
50 3300005549 Ga0070704_100064974 Ga0070704_1000649741 268
51 3300005981 Ga0081538_10166423 Ga0081538_101664231 268
52 3300005983 Ga0081540_1000183 Ga0081540_10001835 268
53 3300006846 Ga0075430_100000311 Ga0075430_1000003112 268
54 3300006847 Ga0075431_100793293 Ga0075431_1007932931 268
55 3300006914 Ga0075436_100064018 Ga0075436_1000640183 268
56 3300009093 Ga0105240_10118655 Ga0105240_101186552 268
57 3300009094 Ga0111539_10609068 Ga0111539_106090681 268
58 3300009147 Ga0114129_10009721 Ga0114129_1000972111 268
59 3300009147 Ga0114129_10357825 Ga0114129_103578253 268
60 3300013104 Ga0157370_10005113 Ga0157370_1000511312 268
61 3300013307 Ga0157372_10035808 Ga0157372_100358085 268
62 3300025912 Ga0207707_10023677 Ga0207707_100236772 268
63 3300025917 Ga0207660_10004266 Ga0207660_100042666 268
64 3300025921 Ga0207652_10010306 Ga0207652_100103065 268
65 3300027907 Ga0207428_10343874 Ga0207428_103438741 268
66 3300031238 Ga0265332_10001364 Ga0265332_100013646 268
67 3300031241 Ga0265325_10035404 Ga0265325_100354043 268
68 3300031250 Ga0265331_10010346 Ga0265331_100103463 268
69 3300031712 Ga0265342_10000328 Ga0265342_100003287 268
70 3300035118 Ga0373954_0089043 Ga0373954_0089043_434_1273 268
71 3300035692 Ga0373935_0043417 Ga0373935_0043417_1919_2758 268
72 3300036401 Ga0373937_0031848 Ga0373937_0031848_2078_2914 268
73 3300037068 Ga0373925_0110476 Ga0373925_0110476_1181_2020 268
74 3300047317 Ga0495604_0238484 Ga0495604_0238484_385_1224 268
75 3300048088 Ga0495602_0114719 Ga0495602_0114719_587_1426 268
76 3300049572 Ga0501036_0476081 Ga0501036_0476081_102_938 268
77 3300049582 Ga0501048_0206598 Ga0501048_0206598_513_1349 268
78 3300049588 Ga0501072_0120885 Ga0501072_0120885_519_1355 268
79 3300050507 nmdc:mga05p37_130171_c1 nmdc:mga05p37_130171_c1_907_1743 268
80 3300050507 nmdc:mga05p37_9175_c1 nmdc:mga05p37_9175_c1_9920_10840 268
81 3300050509 nmdc:mga0qj67_111_c1 nmdc:mga0qj67_111_c1_20847_21695 268
82 3300050511 nmdc:mga08y16_120737_c1 nmdc:mga08y16_120737_c1_1659_2507 268
83 3300050511 nmdc:mga08y16_299076_c1 nmdc:mga08y16_299076_c1_593_1429 268
84 3300050512 nmdc:mga0n895_215308_c1 nmdc:mga0n895_215308_c1_39_875 268
85 3300050514 nmdc:mga08x19_159289_c1 nmdc:mga08x19_159289_c1_168_1004 268
86 3300050514 nmdc:mga08x19_80903_c1 nmdc:mga08x19_80903_c1_1079_1918 268
87 3300053084 Ga0495595_0063414 Ga0495595_0063414_126_962 268
88 3300053085 Ga0495619_0057164 Ga0495619_0057164_115_951 268
89 3300053085 Ga0495619_0187824 Ga0495619_0187824_382_1218 268
90 3300060353 Ga0501082_0325657 Ga0501082_0325657_465_1301 268
91 3300061734 Ga0530510_0210498 Ga0530510_0210498_215_1051 268
92 3300005336 Ga0070680_100249408 Ga0070680_1002494082 271
93 3300006846 Ga0075430_100246339 Ga0075430_1002463392 271
94 3300050509 nmdc:mga0qj67_29143_c1 nmdc:mga0qj67_29143_c1_2657_3493 271
95 3300035111 Ga0373923_0032815 Ga0373923_0032815_747_1571 272
96 3300035113 Ga0373936_0001692 Ga0373936_0001692_2396_3220 272
97 3300035116 Ga0373945_0008967 Ga0373945_0008967_89_913 272
98 3300035118 Ga0373954_0013000 Ga0373954_0013000_272_1096 272
99 3300035119 Ga0373956_0149576 Ga0373956_0149576_168_992 272
100 3300035170 Ga0373943_0005937 Ga0373943_0005937_672_1496 272
101 3300035172 Ga0373955_0357529 Ga0373955_0357529_49_870 272
102 3300035410 Ga0373924_0002618 Ga0373924_0002618_1463_2287 272
103 3300035692 Ga0373935_0000337 Ga0373935_0000337_4907_5731 272
104 3300035724 Ga0373933_0008931 Ga0373933_0008931_3135_3959 272
105 3300035725 Ga0373947_0009229 Ga0373947_0009229_2036_2860 272
106 3300035725 Ga0373947_0163332 Ga0373947_0163332_490_1314 272
107 3300036401 Ga0373937_0000597 Ga0373937_0000597_23554_24378 272
108 3300037068 Ga0373925_0000741 Ga0373925_0000741_4904_5728 272
109 3300046454 Ga0495592_0000188 Ga0495592_0000188_23527_24351 272
110 3300046459 Ga0495629_0046228 Ga0495629_0046228_482_1306 272
111 3300046462 Ga0495651_0012463 Ga0495651_0012463_4902_5726 272
112 3300046463 Ga0495653_0000198 Ga0495653_0000198_29800_30624 272
113 3300046473 Ga0495582_0058040 Ga0495582_0058040_760_1584 272
114 3300046476 Ga0495662_0000720 Ga0495662_0000720_14436_15260 272
115 3300046477 Ga0495664_0000002 Ga0495664_0000002_428724_429548 272
116 3300046511 Ga0495608_0000009 Ga0495608_0000009_50887_51711 272
117 3300046514 Ga0495618_0000005 Ga0495618_0000005_206083_206907 272
118 3300046516 Ga0495628_0000002 Ga0495628_0000002_393109_393933 272
119 3300046517 Ga0495630_0000614 Ga0495630_0000614_34_858 272
120 3300046529 Ga0495652_0000004 Ga0495652_0000004_194950_195774 272
121 3300046533 Ga0495640_0000005 Ga0495640_0000005_50902_51726 272
122 3300046535 Ga0495586_0177770 Ga0495586_0177770_313_1137 272
123 3300046536 Ga0495587_0000007 Ga0495587_0000007_266516_267340 272
124 3300046543 Ga0495645_0000003 Ga0495645_0000003_374360_375184 272
125 3300046559 Ga0495667_0000002 Ga0495667_0000002_43790_44614 272
126 3300046642 Ga0495634_0000129 Ga0495634_0000129_59355_60179 272
127 3300046663 Ga0495635_0000289 Ga0495635_0000289_12916_13740 272
128 3300046675 Ga0495657_0000781 Ga0495657_0000781_15314_16138 272
129 3300046678 Ga0495599_0000001 Ga0495599_0000001_531787_532611 272
130 3300046679 Ga0495623_0000001 Ga0495623_0000001_300732_301556 272
131 3300046680 Ga0495646_0000013 Ga0495646_0000013_151365_152189 272
132 3300046690 Ga0495624_0068235 Ga0495624_0068235_613_1437 272
133 3300046809 Ga0495600_0000233 Ga0495600_0000233_25013_25837 272
134 3300047315 Ga0495581_0014853 Ga0495581_0014853_448_1272 272
135 3300047317 Ga0495604_0000005 Ga0495604_0000005_418753_419577 272
136 3300047319 Ga0495674_0000003 Ga0495674_0000003_168193_169017 272
137 3300047322 Ga0495680_0000002 Ga0495680_0000002_196176_197000 272
138 3300047444 Ga0495675_0000437 Ga0495675_0000437_2154_2978 272
139 3300047471 Ga0495684_0000020 Ga0495684_0000020_142778_143602 272
140 3300047673 Ga0495593_0020549 Ga0495593_0020549_2859_3683 272
141 3300048088 Ga0495602_0000027 Ga0495602_0000027_120669_121493 272
142 3300048904 Ga0496101_0325923 Ga0496101_0325923_305_1126 272
143 3300048907 Ga0496104_0001130 Ga0496104_0001130_1221_2042 272
144 3300048908 Ga0496105_0124346 Ga0496105_0124346_670_1491 272
145 3300048912 Ga0496109_0269106 Ga0496109_0269106_485_1306 272
146 3300048918 Ga0496115_0022900 Ga0496115_0022900_2243_3064 272
147 3300053077 Ga0495601_0000010 Ga0495601_0000010_194904_195728 272
148 3300053078 Ga0495612_0000002 Ga0495612_0000002_304705_305529 272
149 3300053084 Ga0495595_0000184 Ga0495595_0000184_15276_16100 272
150 3300053085 Ga0495619_0000002 Ga0495619_0000002_393112_393936 272
151 3300031235 Ga0265330_10024010 Ga0265330_100240103 275
152 3300031247 Ga0265340_10143968 Ga0265340_101439682 275
153 3300005328 Ga0070676_10015980 Ga0070676_100159805 276
154 3300005329 Ga0070683_100503720 Ga0070683_1005037201 276
155 3300005330 Ga0070690_100024154 Ga0070690_1000241542 276
156 3300005335 Ga0070666_10344930 Ga0070666_103449302 276
157 3300005340 Ga0070689_100016595 Ga0070689_1000165952 276
158 3300005344 Ga0070661_100503256 Ga0070661_1005032561 276
159 3300005347 Ga0070668_100262438 Ga0070668_1002624382 276
160 3300005356 Ga0070674_100099820 Ga0070674_1000998202 276
161 3300005438 Ga0070701_10037485 Ga0070701_100374852 276
162 3300005544 Ga0070686_100347079 Ga0070686_1003470792 276
163 3300005548 Ga0070665_100549906 Ga0070665_1005499062 276
164 3300005615 Ga0070702_100457015 Ga0070702_1004570151 276
165 3300005617 Ga0068859_100295304 Ga0068859_1002953042 276
166 3300005617 Ga0068859_100802394 Ga0068859_1008023941 276
167 3300005841 Ga0068863_100439796 Ga0068863_1004397962 276
168 3300005937 Ga0081455_10080462 Ga0081455_100804623 276
169 3300005981 Ga0081538_10005698 Ga0081538_100056989 276
170 3300005983 Ga0081540_1033395 Ga0081540_10333954 276
171 3300005983 Ga0081540_1120576 Ga0081540_11205761 276
172 3300006028 Ga0070717_10294861 Ga0070717_102948612 276
173 3300006163 Ga0070715_10058674 Ga0070715_100586742 276
174 3300006237 Ga0097621_100059768 Ga0097621_1000597682 276
175 3300006871 Ga0075434_100220232 Ga0075434_1002202322 276
176 3300006931 Ga0097620_100295304 Ga0097620_1002953041 276
177 3300006931 Ga0097620_100802480 Ga0097620_1008024801 276
178 3300007788 Ga0099795_10008849 Ga0099795_100088492 276
179 3300009147 Ga0114129_10128924 Ga0114129_101289242 276
180 3300009147 Ga0114129_10218131 Ga0114129_102181314 276
181 3300009177 Ga0105248_10097526 Ga0105248_100975262 276
182 3300009177 Ga0105248_10456875 Ga0105248_104568752 276
183 3300011119 Ga0105246_10103964 Ga0105246_101039642 276
184 3300013297 Ga0157378_10167721 Ga0157378_101677211 276
185 3300013306 Ga0163162_10166546 Ga0163162_101665462 276
186 3300013306 Ga0163162_10316386 Ga0163162_103163862 276
187 3300013308 Ga0157375_10148696 Ga0157375_101486962 276
188 3300013308 Ga0157375_10276789 Ga0157375_102767892 276
189 3300014325 Ga0163163_10039201 Ga0163163_100392014 276
190 3300014497 Ga0182008_10113814 Ga0182008_101138141 276
191 3300014969 Ga0157376_10097644 Ga0157376_100976442 276
192 3300025893 Ga0207682_10045090 Ga0207682_100450902 276
193 3300025903 Ga0207680_10105409 Ga0207680_101054092 276
194 3300025905 Ga0207685_10061019 Ga0207685_100610192 276
195 3300025907 Ga0207645_10019185 Ga0207645_100191855 276
196 3300025915 Ga0207693_10008359 Ga0207693_100083597 276
197 3300025926 Ga0207659_10291224 Ga0207659_102912241 276
198 3300025931 Ga0207644_10035189 Ga0207644_100351892 276
199 3300025936 Ga0207670_10002139 Ga0207670_100021396 276
200 3300025937 Ga0207669_10020543 Ga0207669_100205432 276
201 3300025941 Ga0207711_10003367 Ga0207711_100033674 276
202 3300025941 Ga0207711_10390130 Ga0207711_103901302 276
203 3300025944 Ga0207661_10346787 Ga0207661_103467872 276
204 3300026035 Ga0207703_10612983 Ga0207703_106129831 276
205 3300026088 Ga0207641_10284515 Ga0207641_102845152 276
206 3300026095 Ga0207676_10034428 Ga0207676_100344282 276
207 3300028023 Ga0265357_1000526 Ga0265357_10005262 276
208 3300028379 Ga0268266_10623664 Ga0268266_106236641 276
209 3300028800 Ga0265338_10010460 Ga0265338_100104605 276
210 3300030878 Ga0265770_1020447 Ga0265770_10204471 276
211 3300031090 Ga0265760_10029890 Ga0265760_100298902 276
212 3300031247 Ga0265340_10009578 Ga0265340_100095782 276
213 3300031249 Ga0265339_10000133 Ga0265339_1000013333 276
214 3300031595 Ga0265313_10000491 Ga0265313_1000049123 276
215 3300034957 Ga0373938_0021761 Ga0373938_0021761_330_1163 276
216 3300035084 Ga0373928_0021523 Ga0373928_0021523_376_1209 276
217 3300035112 Ga0373932_0014144 Ga0373932_0014144_866_1699 276
218 3300035170 Ga0373943_0074089 Ga0373943_0074089_581_1417 276
219 3300035691 Ga0373931_0002197 Ga0373931_0002197_5799_6632 276
220 3300035691 Ga0373931_0161493 Ga0373931_0161493_204_1037 276
221 3300035692 Ga0373935_0045529 Ga0373935_0045529_73_909 276
222 3300035695 Ga0373927_0010461 Ga0373927_0010461_5041_5877 276
223 3300035695 Ga0373927_0017168 Ga0373927_0017168_2655_3488 276
224 3300035695 Ga0373927_0017198 Ga0373927_0017198_2323_3159 276
225 3300035695 Ga0373927_0205603 Ga0373927_0205603_205_1041 276
226 3300035695 Ga0373927_0229033 Ga0373927_0229033_143_976 276
227 3300035725 Ga0373947_0101560 Ga0373947_0101560_930_1766 276
228 3300035725 Ga0373947_0138367 Ga0373947_0138367_363_1196 276
229 3300037068 Ga0373925_0040893 Ga0373925_0040893_535_1371 276
230 3300037068 Ga0373925_0164119 Ga0373925_0164119_806_1639 276
231 3300037068 Ga0373925_0182167 Ga0373925_0182167_583_1416 276
232 3300044684 Ga0466966_0254947 Ga0466966_0254947_83_1045 276
233 3300044694 Ga0466963_0161058 Ga0466963_0161058_521_1483 276
234 3300044842 Ga0466957_0043673 Ga0466957_0043673_530_1492 276
235 3300045049 Ga0466959_0125017 Ga0466959_0125017_129_1091 276
236 3300046454 Ga0495592_0082174 Ga0495592_0082174_541_1374 276
237 3300046459 Ga0495629_0103854 Ga0495629_0103854_1045_1881 276
238 3300046463 Ga0495653_0047651 Ga0495653_0047651_1098_1934 276
239 3300046476 Ga0495662_0004951 Ga0495662_0004951_4306_5142 276
240 3300046477 Ga0495664_0000375 Ga0495664_0000375_16830_17666 276
241 3300046514 Ga0495618_0004650 Ga0495618_0004650_776_1612 276
242 3300046516 Ga0495628_0080850 Ga0495628_0080850_319_1152 276
243 3300046517 Ga0495630_0017955 Ga0495630_0017955_1934_2770 276
244 3300046526 Ga0495666_0091424 Ga0495666_0091424_458_1291 276
245 3300046529 Ga0495652_0040209 Ga0495652_0040209_1858_2694 276
246 3300046531 Ga0495665_0107591 Ga0495665_0107591_566_1399 276
247 3300046533 Ga0495640_0006783 Ga0495640_0006783_5662_6498 276
248 3300046533 Ga0495640_0158241 Ga0495640_0158241_328_1164 276
249 3300046535 Ga0495586_0084897 Ga0495586_0084897_177_1013 276
250 3300046536 Ga0495587_0196043 Ga0495587_0196043_286_1119 276
251 3300046543 Ga0495645_0012230 Ga0495645_0012230_2277_3113 276
252 3300046663 Ga0495635_0022667 Ga0495635_0022667_2846_3682 276
253 3300046663 Ga0495635_0024750 Ga0495635_0024750_2389_3225 276
254 3300046680 Ga0495646_0122495 Ga0495646_0122495_285_1121 276
255 3300046683 Ga0495658_0114725 Ga0495658_0114725_170_1003 276
256 3300046689 Ga0495613_0073747 Ga0495613_0073747_1604_2440 276
257 3300046690 Ga0495624_0034192 Ga0495624_0034192_1539_2375 276
258 3300047315 Ga0495581_0061810 Ga0495581_0061810_572_1408 276
259 3300047315 Ga0495581_0174679 Ga0495581_0174679_348_1241 276
260 3300047319 Ga0495674_0026624 Ga0495674_0026624_3585_4421 276
261 3300047319 Ga0495674_0234323 Ga0495674_0234323_373_1209 276
262 3300047471 Ga0495684_0002950 Ga0495684_0002950_2886_3722 276
263 3300047471 Ga0495684_0025573 Ga0495684_0025573_1381_2274 276
264 3300048903 Ga0496100_0001551 Ga0496100_0001551_1260_2093 276
265 3300048904 Ga0496101_0001012 Ga0496101_0001012_12551_13384 276
266 3300048904 Ga0496101_0033510 Ga0496101_0033510_1761_2594 276
267 3300048905 Ga0496102_0033538 Ga0496102_0033538_2401_3234 276
268 3300048905 Ga0496102_0073679 Ga0496102_0073679_49_882 276
269 3300048907 Ga0496104_0001756 Ga0496104_0001756_15660_16493 276
270 3300048907 Ga0496104_0098229 Ga0496104_0098229_235_1068 276
271 3300048908 Ga0496105_0019711 Ga0496105_0019711_1649_2482 276
272 3300048908 Ga0496105_0192272 Ga0496105_0192272_258_1091 276
273 3300048909 Ga0496106_0014871 Ga0496106_0014871_651_1484 276
274 3300048910 Ga0496107_0065946 Ga0496107_0065946_1215_2048 276
275 3300048911 Ga0496108_0002891 Ga0496108_0002891_11675_12508 276
276 3300048912 Ga0496109_0036314 Ga0496109_0036314_1958_2791 276
277 3300048913 Ga0496110_0024942 Ga0496110_0024942_4169_5002 276
278 3300048913 Ga0496110_0131951 Ga0496110_0131951_934_1770 276
279 3300048914 Ga0496111_0096207 Ga0496111_0096207_243_1076 276
280 3300048914 Ga0496111_0149255 Ga0496111_0149255_265_1098 276
281 3300048915 Ga0496112_0102058 Ga0496112_0102058_560_1393 276
282 3300048915 Ga0496112_0165948 Ga0496112_0165948_183_1016 276
283 3300048916 Ga0496113_0175849 Ga0496113_0175849_716_1549 276
284 3300048917 Ga0496114_0032157 Ga0496114_0032157_320_1153 276
285 3300048918 Ga0496115_0054644 Ga0496115_0054644_886_1734 276
286 3300048918 Ga0496115_0072173 Ga0496115_0072173_479_1312 276
287 3300049573 Ga0501037_0420029 Ga0501037_0420029_52_903 276
288 3300049581 Ga0501047_0140762 Ga0501047_0140762_74_925 276
289 3300049586 Ga0501070_0050832 Ga0501070_0050832_2310_3161 276
290 3300049589 Ga0501073_0288328 Ga0501073_0288328_37_885 276
291 3300049823 Ga0501044_0389579 Ga0501044_0389579_237_1088 276
292 3300050494 nmdc:mga06z11_309953_c1 nmdc:mga06z11_309953_c1_93_926 276
293 3300050511 nmdc:mga08y16_36613_c1 nmdc:mga08y16_36613_c1_2359_3192 276
294 3300050512 nmdc:mga0n895_512431_c1 nmdc:mga0n895_512431_c1_259_1092 276
295 3300050515 nmdc:mga0a205_81197_c1 nmdc:mga0a205_81197_c1_1509_2342 276
296 3300053077 Ga0495601_0024234 Ga0495601_0024234_1711_2544 276
297 3300053078 Ga0495612_0000697 Ga0495612_0000697_6065_6901 276
298 3300053085 Ga0495619_0018329 Ga0495619_0018329_2496_3332 276
299 3300053085 Ga0495619_0055176 Ga0495619_0055176_107_940 276
300 3300053085 Ga0495619_0061884 Ga0495619_0061884_226_1119 276
301 3300053085 Ga0495619_0274712 Ga0495619_0274712_164_1000 276
302 2162886007 SwRhRL2b_contig_1831614 SwRhRL2b_0257.00004640 277
303 2209111006 2214544920 2213593397 277
304 3300000041 ARcpr5oldR_c000395 ARcpr5oldR_0003953 277
305 3300000042 ARSoilYngRDRAFT_c00032 ARSoilYngRDRAFT_0003212 277
306 3300000043 ARcpr5yngRDRAFT_c000061 ARcpr5yngRDRAFT_0000614 277
307 3300000044 ARSoilOldRDRAFT_c000136 ARSoilOldRDRAFT_00013612 277
308 3300000045 ARCol0oldRDRAFT_c00446 ARCol0oldRDRAFT_004464 277
309 3300000652 ARCol0yngRDRAFT_1000139 ARCol0yngRDRAFT_100013912 277
310 3300001976 JGI24752J21851_1012071 JGI24752J21851_10120712 277
311 3300001991 JGI24743J22301_10007812 JGI24743J22301_100078123 277
312 3300002077 JGI24744J21845_10006076 JGI24744J21845_100060762 277
313 3300002239 JGI24034J26672_10009452 JGI24034J26672_100094521 277
314 3300003323 rootH1_10356764 rootH1_103567642 277
315 3300005277 Ga0065716_1001581 Ga0065716_10015813 277
316 3300005289 Ga0065704_10080762 Ga0065704_100807624 277
317 3300005295 Ga0065707_10121940 Ga0065707_101219401 277
318 3300005328 Ga0070676_10044243 Ga0070676_100442431 277
319 3300005329 Ga0070683_100039525 Ga0070683_1000395251 277
320 3300005330 Ga0070690_100036744 Ga0070690_1000367443 277
321 3300005331 Ga0070670_100178055 Ga0070670_1001780552 277
322 3300005337 Ga0070682_100187077 Ga0070682_1001870771 277
323 3300005338 Ga0068868_100201031 Ga0068868_1002010311 277
324 3300005339 Ga0070660_100135248 Ga0070660_1001352482 277
325 3300005340 Ga0070689_100136274 Ga0070689_1001362742 277
326 3300005343 Ga0070687_100021169 Ga0070687_1000211692 277
327 3300005345 Ga0070692_10044090 Ga0070692_100440902 277
328 3300005347 Ga0070668_100137467 Ga0070668_1001374672 277
329 3300005353 Ga0070669_100163818 Ga0070669_1001638182 277
330 3300005354 Ga0070675_100230920 Ga0070675_1002309202 277
331 3300005364 Ga0070673_100024556 Ga0070673_1000245561 277
332 3300005366 Ga0070659_100037562 Ga0070659_1000375622 277
333 3300005366 Ga0070659_100220380 Ga0070659_1002203802 277
334 3300005367 Ga0070667_100297621 Ga0070667_1002976212 277
335 3300005434 Ga0070709_10051784 Ga0070709_100517843 277
336 3300005434 Ga0070709_10228144 Ga0070709_102281442 277
337 3300005438 Ga0070701_10083067 Ga0070701_100830671 277
338 3300005439 Ga0070711_100036661 Ga0070711_1000366612 277
339 3300005439 Ga0070711_100196436 Ga0070711_1001964362 277
340 3300005441 Ga0070700_100045009 Ga0070700_1000450092 277
341 3300005455 Ga0070663_100191118 Ga0070663_1001911182 277
342 3300005456 Ga0070678_100241562 Ga0070678_1002415622 277
343 3300005457 Ga0070662_100055926 Ga0070662_1000559264 277
344 3300005457 Ga0070662_100132786 Ga0070662_1001327862 277
345 3300005459 Ga0068867_100065507 Ga0068867_1000655072 277
346 3300005459 Ga0068867_100110735 Ga0068867_1001107352 277
347 3300005466 Ga0070685_10041462 Ga0070685_100414622 277
348 3300005466 Ga0070685_10062402 Ga0070685_100624023 277
349 3300005466 Ga0070685_10385623 Ga0070685_103856231 277
350 3300005518 Ga0070699_100012813 Ga0070699_1000128132 277
351 3300005518 Ga0070699_100185807 Ga0070699_1001858072 277
352 3300005539 Ga0068853_100199266 Ga0068853_1001992662 277
353 3300005543 Ga0070672_100407901 Ga0070672_1004079012 277
354 3300005544 Ga0070686_100149468 Ga0070686_1001494682 277
355 3300005549 Ga0070704_100101533 Ga0070704_1001015333 277
356 3300005549 Ga0070704_100194567 Ga0070704_1001945671 277
357 3300005564 Ga0070664_100148659 Ga0070664_1001486592 277
358 3300005577 Ga0068857_100281175 Ga0068857_1002811752 277
359 3300005578 Ga0068854_100390104 Ga0068854_1003901041 277
360 3300005614 Ga0068856_100114199 Ga0068856_1001141991 277
361 3300005617 Ga0068859_100080058 Ga0068859_1000800585 277
362 3300005618 Ga0068864_100084336 Ga0068864_1000843362 277
363 3300005834 Ga0068851_10121712 Ga0068851_101217121 277
364 3300005841 Ga0068863_100156520 Ga0068863_1001565202 277
365 3300005842 Ga0068858_100036593 Ga0068858_1000365933 277
366 3300005842 Ga0068858_100092607 Ga0068858_1000926073 277
367 3300005842 Ga0068858_100123637 Ga0068858_1001236372 277
368 3300005843 Ga0068860_100181946 Ga0068860_1001819463 277
369 3300005844 Ga0068862_100074065 Ga0068862_1000740653 277
370 3300005937 Ga0081455_10001860 Ga0081455_100018602 277
371 3300005937 Ga0081455_10010994 Ga0081455_100109944 277
372 3300005937 Ga0081455_10187941 Ga0081455_101879412 277
373 3300005983 Ga0081540_1009789 Ga0081540_10097898 277
374 3300006038 Ga0075365_10011942 Ga0075365_100119422 277
375 3300006038 Ga0075365_10038703 Ga0075365_100387034 277
376 3300006038 Ga0075365_10104603 Ga0075365_101046032 277
377 3300006163 Ga0070715_10109261 Ga0070715_101092612 277
378 3300006175 Ga0070712_100025865 Ga0070712_1000258652 277
379 3300006175 Ga0070712_100203881 Ga0070712_1002038812 277
380 3300006178 Ga0075367_10055853 Ga0075367_100558531 277
381 3300006178 Ga0075367_10148416 Ga0075367_101484162 277
382 3300006844 Ga0075428_100030815 Ga0075428_1000308154 277
383 3300006846 Ga0075430_100128605 Ga0075430_1001286052 277
384 3300006847 Ga0075431_100170064 Ga0075431_1001700643 277
385 3300006847 Ga0075431_100207312 Ga0075431_1002073121 277
386 3300006852 Ga0075433_10117018 Ga0075433_101170181 277
387 3300006871 Ga0075434_100005301 Ga0075434_1000053011 277
388 3300006880 Ga0075429_100169660 Ga0075429_1001696602 277
389 3300006914 Ga0075436_100131530 Ga0075436_1001315302 277
390 3300006931 Ga0097620_100080058 Ga0097620_1000800582 277
391 3300007265 Ga0099794_10007525 Ga0099794_100075253 277
392 3300007265 Ga0099794_10084631 Ga0099794_100846311 277
393 3300009094 Ga0111539_10005693 Ga0111539_100056933 277
394 3300009098 Ga0105245_10074900 Ga0105245_100749002 277
395 3300009147 Ga0114129_10024961 Ga0114129_100249614 277
396 3300009147 Ga0114129_10191202 Ga0114129_101912021 277
397 3300009174 Ga0105241_10321271 Ga0105241_103212711 277
398 3300009176 Ga0105242_10186229 Ga0105242_101862292 277
399 3300009177 Ga0105248_10183124 Ga0105248_101831242 277
400 3300009545 Ga0105237_10080387 Ga0105237_100803872 277
401 3300009551 Ga0105238_10327002 Ga0105238_103270022 277
402 3300009553 Ga0105249_10158485 Ga0105249_101584853 277
403 3300009553 Ga0105249_10537932 Ga0105249_105379322 277
404 3300012476 Ga0157344_1000470 Ga0157344_10004703 277
405 3300012495 Ga0157323_1003505 Ga0157323_10035051 277
406 3300013100 Ga0157373_10238475 Ga0157373_102384751 277
407 3300013296 Ga0157374_10567377 Ga0157374_105673772 277
408 3300013306 Ga0163162_10510694 Ga0163162_105106942 277
409 3300013307 Ga0157372_10296489 Ga0157372_102964891 277
410 3300013307 Ga0157372_10625198 Ga0157372_106251982 277
411 3300014325 Ga0163163_10188340 Ga0163163_101883403 277
412 3300014326 Ga0157380_10221660 Ga0157380_102216602 277
413 3300014745 Ga0157377_10061450 Ga0157377_100614502 277
414 3300014969 Ga0157376_10040052 Ga0157376_100400521 277
415 3300017792 Ga0163161_10093783 Ga0163161_100937832 277
416 3300025321 Ga0207656_10017789 Ga0207656_100177892 277
417 3300025898 Ga0207692_10315850 Ga0207692_103158501 277
418 3300025900 Ga0207710_10106633 Ga0207710_101066331 277
419 3300025901 Ga0207688_10022504 Ga0207688_100225042 277
420 3300025904 Ga0207647_10014286 Ga0207647_100142862 277
421 3300025905 Ga0207685_10067547 Ga0207685_100675471 277
422 3300025906 Ga0207699_10012929 Ga0207699_100129293 277
423 3300025908 Ga0207643_10000872 Ga0207643_1000087213 277
424 3300025910 Ga0207684_10158518 Ga0207684_101585182 277
425 3300025912 Ga0207707_10179340 Ga0207707_101793402 277
426 3300025915 Ga0207693_10038010 Ga0207693_100380105 277
427 3300025915 Ga0207693_10040307 Ga0207693_100403075 277
428 3300025915 Ga0207693_10077132 Ga0207693_100771322 277
429 3300025916 Ga0207663_10115023 Ga0207663_101150232 277
430 3300025918 Ga0207662_10007580 Ga0207662_100075802 277
431 3300025919 Ga0207657_10023526 Ga0207657_100235264 277
432 3300025927 Ga0207687_10396859 Ga0207687_103968591 277
433 3300025928 Ga0207700_10142650 Ga0207700_101426502 277
434 3300025932 Ga0207690_10242211 Ga0207690_102422112 277
435 3300025933 Ga0207706_10056684 Ga0207706_100566845 277
436 3300025933 Ga0207706_10272722 Ga0207706_102727222 277
437 3300025934 Ga0207686_10135763 Ga0207686_101357632 277
438 3300025935 Ga0207709_10320725 Ga0207709_103207252 277
439 3300025936 Ga0207670_10189690 Ga0207670_101896902 277
440 3300025937 Ga0207669_10046523 Ga0207669_100465232 277
441 3300025938 Ga0207704_10092037 Ga0207704_100920372 277
442 3300025939 Ga0207665_10006295 Ga0207665_100062958 277
443 3300025939 Ga0207665_10157812 Ga0207665_101578122 277
444 3300025940 Ga0207691_10007735 Ga0207691_100077356 277
445 3300025945 Ga0207679_10167690 Ga0207679_101676902 277
446 3300025972 Ga0207668_10028831 Ga0207668_100288312 277
447 3300025986 Ga0207658_10166521 Ga0207658_101665212 277
448 3300026035 Ga0207703_10210367 Ga0207703_102103671 277
449 3300026041 Ga0207639_10049286 Ga0207639_100492862 277
450 3300026067 Ga0207678_10005238 Ga0207678_100052382 277
451 3300026075 Ga0207708_10005514 Ga0207708_100055146 277
452 3300026075 Ga0207708_10059087 Ga0207708_100590874 277
453 3300026089 Ga0207648_10028821 Ga0207648_100288212 277
454 3300026089 Ga0207648_10117889 Ga0207648_101178894 277
455 3300026116 Ga0207674_10058822 Ga0207674_100588225 277
456 3300026118 Ga0207675_100035978 Ga0207675_1000359783 277
457 3300026121 Ga0207683_10051673 Ga0207683_100516732 277
458 3300026142 Ga0207698_10130895 Ga0207698_101308952 277
459 3300027512 Ga0209179_1008104 Ga0209179_10081042 277
460 3300027907 Ga0207428_10004567 Ga0207428_100045673 277
461 3300027907 Ga0207428_10173195 Ga0207428_101731952 277
462 3300028379 Ga0268266_10341305 Ga0268266_103413052 277
463 3300028380 Ga0268265_10070804 Ga0268265_100708044 277
464 3300028380 Ga0268265_10280953 Ga0268265_102809531 277
465 3300028556 Ga0265337_1001529 Ga0265337_100152912 277
466 3300031241 Ga0265325_10058454 Ga0265325_100584543 277
467 3300031344 Ga0265316_10191371 Ga0265316_101913712 277
468 3300031728 Ga0316578_10059481 Ga0316578_100594812 277
469 3300034816 Ga0373930_0000042 Ga0373930_0000042_2735_3568 277
470 3300034817 Ga0373948_0000129 Ga0373948_0000129_624_1457 277
471 3300034818 Ga0373950_0001254 Ga0373950_0001254_675_1508 277
472 3300034957 Ga0373938_0000030 Ga0373938_0000030_663_1496 277
473 3300035083 Ga0373926_0118501 Ga0373926_0118501_46_882 277
474 3300035084 Ga0373928_0000123 Ga0373928_0000123_12954_13787 277
475 3300035085 Ga0373929_0000703 Ga0373929_0000703_108_941 277
476 3300035086 Ga0373934_0017783 Ga0373934_0017783_191_1027 277
477 3300035088 Ga0373940_0000022 Ga0373940_0000022_15675_16508 277
478 3300035089 Ga0373944_0006259 Ga0373944_0006259_1735_2571 277
479 3300035090 Ga0373949_0000438 Ga0373949_0000438_12816_13649 277
480 3300035091 Ga0373951_0004506 Ga0373951_0004506_1806_2639 277
481 3300035092 Ga0373952_0000180 Ga0373952_0000180_671_1504 277
482 3300035111 Ga0373923_0121884 Ga0373923_0121884_11_847 277
483 3300035112 Ga0373932_0000683 Ga0373932_0000683_8734_9567 277
484 3300035114 Ga0373939_0000329 Ga0373939_0000329_687_1520 277
485 3300035115 Ga0373941_0000049 Ga0373941_0000049_637_1470 277
486 3300035116 Ga0373945_0005566 Ga0373945_0005566_2253_3089 277
487 3300035119 Ga0373956_0003856 Ga0373956_0003856_2429_3265 277
488 3300035120 Ga0373957_0017204 Ga0373957_0017204_223_1059 277
489 3300035121 Ga0373960_0000240 Ga0373960_0000240_8715_9548 277
490 3300035170 Ga0373943_0094098 Ga0373943_0094098_680_1516 277
491 3300035171 Ga0373946_0040899 Ga0373946_0040899_960_1799 277
492 3300035241 Ga0373961_0001448 Ga0373961_0001448_687_1520 277
493 3300035242 Ga0373962_0000637 Ga0373962_0000637_674_1507 277
494 3300035398 Ga0316574_0000202 Ga0316574_0000202_6731_7570 277
495 3300035410 Ga0373924_0003107 Ga0373924_0003107_1007_1843 277
496 3300035691 Ga0373931_0014415 Ga0373931_0014415_2344_3177 277
497 3300035692 Ga0373935_0025186 Ga0373935_0025186_676_1512 277
498 3300035695 Ga0373927_0048991 Ga0373927_0048991_1189_2028 277
499 3300035724 Ga0373933_0001345 Ga0373933_0001345_5864_6700 277
500 3300035725 Ga0373947_0020264 Ga0373947_0020264_781_1617 277
501 3300035725 Ga0373947_0181537 Ga0373947_0181537_434_1273 277
502 3300036401 Ga0373937_0008587 Ga0373937_0008587_2574_3410 277
503 3300036712 Ga0316584_0108806 Ga0316584_0108806_776_1615 277
504 3300037068 Ga0373925_0019319 Ga0373925_0019319_3452_4288 277
505 3300037068 Ga0373925_0099428 Ga0373925_0099428_830_1666 277
506 3300037068 Ga0373925_0463873 Ga0373925_0463873_175_1011 277
507 3300037068 Ga0373925_0500799 Ga0373925_0500799_60_899 277
508 3300037853 Ga0436364_1223108 Ga0436364_1223108_2422_3264 277
509 3300039437 Ga0436365_1676454 Ga0436365_1676454_1341_2183 277
510 3300039438 Ga0436360_0330917 Ga0436360_0330917_1523_2368 277
511 3300039447 Ga0436361_1044138 Ga0436361_1044138_1603_2475 277
512 3300039450 Ga0436363_1667002 Ga0436363_1667002_75_923 277
513 3300044712 Ga0453684_0106785 Ga0453684_0106785_146_979 277
514 3300045051 Ga0451576_0066990 Ga0451576_0066990_687_1520 277
515 3300046462 Ga0495651_0014205 Ga0495651_0014205_1340_2176 277
516 3300046473 Ga0495582_0089684 Ga0495582_0089684_83_919 277
517 3300046473 Ga0495582_0091039 Ga0495582_0091039_24_860 277
518 3300046474 Ga0495605_0076281 Ga0495605_0076281_107_943 277
519 3300046491 Ga0495584_0018615 Ga0495584_0018615_40_876 277
520 3300046492 Ga0495585_0138323 Ga0495585_0138323_358_1254 277
521 3300046517 Ga0495630_0036987 Ga0495630_0036987_2799_3635 277
522 3300046525 Ga0495663_0041205 Ga0495663_0041205_14_850 277
523 3300046533 Ga0495640_0159682 Ga0495640_0159682_521_1360 277
524 3300046538 Ga0495609_0145750 Ga0495609_0145750_89_925 277
525 3300046558 Ga0495633_0059262 Ga0495633_0059262_941_1777 277
526 3300046559 Ga0495667_0060226 Ga0495667_0060226_463_1299 277
527 3300046559 Ga0495667_0179533 Ga0495667_0179533_102_938 277
528 3300046616 Ga0495668_0166948 Ga0495668_0166948_53_949 277
529 3300046642 Ga0495634_0094839 Ga0495634_0094839_1048_1884 277
530 3300046642 Ga0495634_0224304 Ga0495634_0224304_308_1147 277
531 3300046675 Ga0495657_0015918 Ga0495657_0015918_3640_4476 277
532 3300046679 Ga0495623_0025557 Ga0495623_0025557_2798_3634 277
533 3300046681 Ga0495647_0030190 Ga0495647_0030190_990_1826 277
534 3300046683 Ga0495658_0106054 Ga0495658_0106054_828_1664 277
535 3300046683 Ga0495658_0192531 Ga0495658_0192531_46_882 277
536 3300046684 Ga0495669_0135910 Ga0495669_0135910_292_1146 277
537 3300046689 Ga0495613_0183065 Ga0495613_0183065_44_880 277
538 3300046691 Ga0495670_0065940 Ga0495670_0065940_252_1088 277
539 3300046694 Ga0495649_0058802 Ga0495649_0058802_234_1130 277
540 3300047315 Ga0495581_0057301 Ga0495581_0057301_504_1340 277
541 3300047319 Ga0495674_0205843 Ga0495674_0205843_235_1071 277
542 3300047321 Ga0495676_0059847 Ga0495676_0059847_493_1329 277
543 3300047322 Ga0495680_0292774 Ga0495680_0292774_286_1122 277
544 3300048088 Ga0495602_0006017 Ga0495602_0006017_3977_4813 277
545 3300048904 Ga0496101_0391724 Ga0496101_0391724_238_1074 277
546 3300048905 Ga0496102_0062761 Ga0496102_0062761_1769_2605 277
547 3300048905 Ga0496102_0094133 Ga0496102_0094133_613_1446 277
548 3300048905 Ga0496102_0146468 Ga0496102_0146468_250_1086 277
549 3300048905 Ga0496102_0173890 Ga0496102_0173890_313_1167 277
550 3300048906 Ga0496103_0091513 Ga0496103_0091513_799_1695 277
551 3300048906 Ga0496103_0363260 Ga0496103_0363260_24_860 277
552 3300048907 Ga0496104_0000629 Ga0496104_0000629_20138_20983 277
553 3300048908 Ga0496105_0001322 Ga0496105_0001322_2249_3085 277
554 3300048908 Ga0496105_0040140 Ga0496105_0040140_731_1627 277
555 3300048908 Ga0496105_0335131 Ga0496105_0335131_304_1149 277
556 3300048909 Ga0496106_0022634 Ga0496106_0022634_902_1798 277
557 3300048909 Ga0496106_0077696 Ga0496106_0077696_1089_1934 277
558 3300048909 Ga0496106_0099112 Ga0496106_0099112_689_1525 277
559 3300048909 Ga0496106_0297069 Ga0496106_0297069_365_1204 277
560 3300048910 Ga0496107_0244389 Ga0496107_0244389_206_1102 277
561 3300048911 Ga0496108_0009174 Ga0496108_0009174_3057_3893 277
562 3300048911 Ga0496108_0211421 Ga0496108_0211421_421_1260 277
563 3300048912 Ga0496109_0002809 Ga0496109_0002809_5511_6347 277
564 3300048912 Ga0496109_0145202 Ga0496109_0145202_727_1623 277
565 3300048913 Ga0496110_0042460 Ga0496110_0042460_156_998 277
566 3300048914 Ga0496111_0030271 Ga0496111_0030271_2370_3206 277
567 3300048915 Ga0496112_0009460 Ga0496112_0009460_2437_3273 277
568 3300048915 Ga0496112_0154440 Ga0496112_0154440_445_1341 277
569 3300048916 Ga0496113_0072484 Ga0496113_0072484_784_1680 277
570 3300048917 Ga0496114_0075244 Ga0496114_0075244_900_1742 277
571 3300048917 Ga0496114_0088863 Ga0496114_0088863_1183_2079 277
572 3300048918 Ga0496115_0025523 Ga0496115_0025523_704_1600 277
573 3300048918 Ga0496115_0100877 Ga0496115_0100877_865_1701 277
574 3300048918 Ga0496115_0293449 Ga0496115_0293449_432_1277 277
575 3300049588 Ga0501072_0251235 Ga0501072_0251235_445_1284 277
576 3300049591 Ga0501075_0023405 Ga0501075_0023405_1714_2553 277
577 3300049593 Ga0501077_0014216 Ga0501077_0014216_2882_3721 277
578 3300049743 Ga0501081_0003438 Ga0501081_0003438_984_1823 277
579 3300050489 nmdc:mga03683_40001_c1 nmdc:mga03683_40001_c1_80_916 277
580 3300050492 nmdc:mga0yw44_918_c1 nmdc:mga0yw44_918_c1_6151_6987 277
581 3300050494 nmdc:mga06z11_38348_c1 nmdc:mga06z11_38348_c1_941_1777 277
582 3300050507 nmdc:mga05p37_25897_c1 nmdc:mga05p37_25897_c1_853_1689 277
583 3300050507 nmdc:mga05p37_64007_c1 nmdc:mga05p37_64007_c1_1155_1991 277
584 3300050508 nmdc:mga09592_118300_c1 nmdc:mga09592_118300_c1_1156_1992 277
585 3300050510 nmdc:mga06r32_165598_c2 nmdc:mga06r32_165598_c2_621_1457 277
586 3300050510 nmdc:mga06r32_70468_c1 nmdc:mga06r32_70468_c1_416_1252 277
587 3300050511 nmdc:mga08y16_15633_c1 nmdc:mga08y16_15633_c1_6463_7296 277
588 3300050513 nmdc:mga0rr50_440609_c1 nmdc:mga0rr50_440609_c1_73_909 277
589 3300050515 nmdc:mga0a205_31909_c1 nmdc:mga0a205_31909_c1_37_870 277
590 3300053077 Ga0495601_0008245 Ga0495601_0008245_444_1337 277
591 3300053077 Ga0495601_0121364 Ga0495601_0121364_682_1518 277
592 3300053078 Ga0495612_0009258 Ga0495612_0009258_1711_2547 277
593 3300053078 Ga0495612_0168114 Ga0495612_0168114_39_932 277
594 3300053084 Ga0495595_0000714 Ga0495595_0000714_11777_12613 277
595 3300053085 Ga0495619_0009180 Ga0495619_0009180_969_1805 277
596 3300054114 Ga0501084_0032380 Ga0501084_0032380_352_1191 277
597 3300060353 Ga0501082_0150963 Ga0501082_0150963_540_1379 277
598 3300060353 Ga0501082_0262109 Ga0501082_0262109_24_860 277
599 3300060353 Ga0501082_0309010 Ga0501082_0309010_375_1211 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13247

Fer4_11

4Fe-4S dicluster domain

102

200

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.9583 1 277
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.9549 1 277
2vpw-assembly1.cif.gz_F polysulfide reductase with bound menaquinone 0.8773 1 188
4zjh-assembly1.cif.gz_A crystal structure of native alpha-2-macroglobulin from escherichia coli spanning domains nie-mg1. 0.8669 210 262
5ch7-assembly1.cif.gz_B crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps 0.8434 2 186
ID Description Score Start End Superfamily
1vldX02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9662 71 127 3.30.70.20
1vldX02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9502 71 127 3.30.70.20
1ti2D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9442 1 188 3.30.70.20
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9433 189 277 2.60.40.10
1ti2D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9374 1 188 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A244DU35-F1-model_v4 deleted 0.9905 194 277
AF-A0A7C7BRX5-F1-model_v4 Oxidoreductase 0.9853 1 277 GO:0051539
AF-A0A524HNG6-F1-model_v4 Oxidoreductase 0.9851 1 187 GO:0051539
AF-A0A7C7Y7J7-F1-model_v4 Oxidoreductase 0.985 1 277 GO:0051539
AF-A0A2S6TBT0-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9848 24 277 GO:0051539

Feature Viewer

pLDDT pTM Quality
95.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map