F467899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 599 | 328 | 599 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0254947|Ga0466966_0254947_83_1045 |
| Length | 320 |
| Sequence | VPSSSAQADDPVSAAREGLFRLRRLLDAPLSRGMTEVDESRLMKKWNMIIDVAECTNCNLCTLAAMDEYVDNEWPGYSAPMPKHGHKWINILQKERGQMPMIDIAYVPTMCNHCDDAPCMKADTGGAITKRGDGIVLIDPVKAKGRKELVEACPYGHIWWNDELQLPQHWTFDAHLIDQGWQQTRGQQSCPTGAMRAIKVEDDEMARLASDEKLEVMRPELGSRPRVYYRNLWRYSKCFIGGSVAEEKNGTVDCVEGASVQLLKDGSSVAVTTTDNYGDFKFDKLDEDSGRYTVQIFSSGRSKTIEATLGASINLGEIRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 98 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 182 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.67 |
| Nodule | 0 |
| Rhizoplane | 10.35 |
| Rhizosphere | 87.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1831614 | 2162886007 | Unclassified | 1799 |
| 2 | 2214544920 | 2209111006 | Bacteria | 20198 |
| 3 | ARcpr5oldR_c000395 | 3300000041 | Bacteria | 6066 |
| 4 | ARSoilYngRDRAFT_c00032 | 3300000042 | Bacteria | 21998 |
| 5 | ARcpr5yngRDRAFT_c000061 | 3300000043 | Bacteria | 17653 |
| 6 | ARSoilOldRDRAFT_c000136 | 3300000044 | Bacteria | 12915 |
| 7 | ARCol0oldRDRAFT_c00446 | 3300000045 | Unclassified | 3929 |
| 8 | ARCol0yngRDRAFT_1000139 | 3300000652 | Bacteria | 12910 |
| 9 | JGI24752J21851_1012071 | 3300001976 | Bacteria | 1130 |
| 10 | JGI24743J22301_10007812 | 3300001991 | Bacteria | 1863 |
| 11 | JGI24744J21845_10006076 | 3300002077 | Bacteria | 2505 |
| 12 | JGI24034J26672_10009452 | 3300002239 | Bacteria | 1439 |
| 13 | rootH1_10356764 | 3300003323 | Bacteria | 2169 |
| 14 | Ga0065716_1001581 | 3300005277 | Bacteria | 5878 |
| 15 | Ga0065704_10080762 | 3300005289 | Unclassified | 3884 |
| 16 | Ga0065707_10121940 | 3300005295 | Bacteria | 2099 |
| 17 | Ga0070676_10015980 | 3300005328 | Bacteria | 4144 |
| 18 | Ga0070676_10044243 | 3300005328 | Bacteria | 2591 |
| 19 | Ga0070683_100039525 | 3300005329 | Bacteria | 4331 |
| 20 | Ga0070683_100503720 | 3300005329 | Bacteria | 1157 |
| 21 | Ga0070690_100024154 | 3300005330 | Bacteria | 3738 |
| 22 | Ga0070690_100036744 | 3300005330 | Bacteria | 3081 |
| 23 | Ga0070690_100190943 | 3300005330 | Bacteria | 1420 |
| 24 | Ga0070670_100178055 | 3300005331 | Bacteria | 1846 |
| 25 | Ga0070666_10344930 | 3300005335 | Bacteria | 1065 |
| 26 | Ga0070680_100036582 | 3300005336 | Bacteria | 3966 |
| 27 | Ga0070680_100249408 | 3300005336 | Bacteria | 1501 |
| 28 | Ga0070682_100187077 | 3300005337 | Unclassified | 1451 |
| 29 | Ga0068868_100201031 | 3300005338 | Bacteria | 1661 |
| 30 | Ga0070660_100135248 | 3300005339 | Bacteria | 1975 |
| 31 | Ga0070689_100016595 | 3300005340 | Bacteria | 5391 |
| 32 | Ga0070689_100136274 | 3300005340 | Bacteria | 1971 |
| 33 | Ga0070687_100021169 | 3300005343 | Bacteria | 3052 |
| 34 | Ga0070661_100503256 | 3300005344 | Bacteria | 970 |
| 35 | Ga0070692_10044090 | 3300005345 | Bacteria | 2297 |
| 36 | Ga0070668_100137467 | 3300005347 | Bacteria | 1966 |
| 37 | Ga0070668_100262438 | 3300005347 | Bacteria | 1437 |
| 38 | Ga0070669_100163818 | 3300005353 | Bacteria | 1730 |
| 39 | Ga0070675_100230920 | 3300005354 | Bacteria | 1614 |
| 40 | Ga0070674_100099820 | 3300005356 | Bacteria | 2113 |
| 41 | Ga0070673_100024556 | 3300005364 | Bacteria | 4422 |
| 42 | Ga0070659_100037562 | 3300005366 | Bacteria | 3776 |
| 43 | Ga0070659_100220380 | 3300005366 | Bacteria | 1565 |
| 44 | Ga0070667_100297621 | 3300005367 | Bacteria | 1452 |
| 45 | Ga0070709_10051784 | 3300005434 | Bacteria | 2578 |
| 46 | Ga0070709_10228144 | 3300005434 | Bacteria | 1331 |
| 47 | Ga0070701_10037485 | 3300005438 | Bacteria | 2448 |
| 48 | Ga0070701_10083067 | 3300005438 | Bacteria | 1738 |
| 49 | Ga0070711_100036661 | 3300005439 | Bacteria | 3286 |
| 50 | Ga0070711_100196436 | 3300005439 | Bacteria | 1554 |
| 51 | Ga0070700_100045009 | 3300005441 | Unclassified | 2721 |
| 52 | Ga0070663_100191118 | 3300005455 | Bacteria | 1593 |
| 53 | Ga0070678_100241562 | 3300005456 | Unclassified | 1510 |
| 54 | Ga0070662_100055926 | 3300005457 | Unclassified | 2864 |
| 55 | Ga0070662_100132786 | 3300005457 | Unclassified | 1921 |
| 56 | Ga0070681_10000708 | 3300005458 | Bacteria | 27710 |
| 57 | Ga0068867_100065507 | 3300005459 | Unclassified | 2704 |
| 58 | Ga0068867_100110735 | 3300005459 | Bacteria | 2109 |
| 59 | Ga0070685_10041462 | 3300005466 | Bacteria | 2622 |
| 60 | Ga0070685_10062402 | 3300005466 | Unclassified | 2185 |
| 61 | Ga0070685_10385623 | 3300005466 | Bacteria | 967 |
| 62 | Ga0070699_100012813 | 3300005518 | Bacteria | 7228 |
| 63 | Ga0070699_100185807 | 3300005518 | Bacteria | 1845 |
| 64 | Ga0070679_100206770 | 3300005530 | Bacteria | 1927 |
| 65 | Ga0068853_100199266 | 3300005539 | Bacteria | 1821 |
| 66 | Ga0070672_100407901 | 3300005543 | Unclassified | 1165 |
| 67 | Ga0070686_100149468 | 3300005544 | Bacteria | 1634 |
| 68 | Ga0070686_100347079 | 3300005544 | Bacteria | 1114 |
| 69 | Ga0070686_100524080 | 3300005544 | Bacteria | 923 |
| 70 | Ga0070665_100549906 | 3300005548 | Bacteria | 1167 |
| 71 | Ga0070704_100064974 | 3300005549 | Bacteria | 2625 |
| 72 | Ga0070704_100101533 | 3300005549 | Bacteria | 2168 |
| 73 | Ga0070704_100194567 | 3300005549 | Bacteria | 1633 |
| 74 | Ga0070664_100148659 | 3300005564 | Bacteria | 2067 |
| 75 | Ga0068857_100281175 | 3300005577 | Bacteria | 1531 |
| 76 | Ga0068854_100390104 | 3300005578 | Bacteria | 1149 |
| 77 | Ga0068856_100114199 | 3300005614 | Bacteria | 2700 |
| 78 | Ga0070702_100457015 | 3300005615 | Bacteria | 928 |
| 79 | Ga0068859_100080058 | 3300005617 | Unclassified | 3307 |
| 80 | Ga0068859_100295304 | 3300005617 | Bacteria | 1714 |
| 81 | Ga0068859_100802394 | 3300005617 | Unclassified | 1029 |
| 82 | Ga0068864_100084336 | 3300005618 | Bacteria | 2791 |
| 83 | Ga0068851_10121712 | 3300005834 | Unclassified | 1403 |
| 84 | Ga0068863_100156520 | 3300005841 | Unclassified | 2182 |
| 85 | Ga0068863_100439796 | 3300005841 | Bacteria | 1279 |
| 86 | Ga0068858_100036593 | 3300005842 | Bacteria | 4550 |
| 87 | Ga0068858_100092607 | 3300005842 | Unclassified | 2813 |
| 88 | Ga0068858_100123637 | 3300005842 | Unclassified | 2421 |
| 89 | Ga0068860_100181946 | 3300005843 | Bacteria | 2031 |
| 90 | Ga0068862_100074065 | 3300005844 | Unclassified | 2943 |
| 91 | Ga0081455_10001860 | 3300005937 | Bacteria | 25395 |
| 92 | Ga0081455_10010994 | 3300005937 | Bacteria | 9123 |
| 93 | Ga0081455_10080462 | 3300005937 | Bacteria | 2671 |
| 94 | Ga0081455_10187941 | 3300005937 | Bacteria | 1559 |
| 95 | Ga0081455_10342494 | 3300005937 | Bacteria | 1057 |
| 96 | Ga0081538_10005698 | 3300005981 | Bacteria | 11139 |
| 97 | Ga0081538_10166423 | 3300005981 | Bacteria | 970 |
| 98 | Ga0081540_1000183 | 3300005983 | Bacteria | 65356 |
| 99 | Ga0081540_1005670 | 3300005983 | Bacteria | 9277 |
| 100 | Ga0081540_1009789 | 3300005983 | Bacteria | 6562 |
| 101 | Ga0081540_1033395 | 3300005983 | Bacteria | 2795 |
| 102 | Ga0081540_1120576 | 3300005983 | Bacteria | 1089 |
| 103 | Ga0070717_10294861 | 3300006028 | Bacteria | 1441 |
| 104 | Ga0075365_10011942 | 3300006038 | Bacteria | 5131 |
| 105 | Ga0075365_10038703 | 3300006038 | Bacteria | 3102 |
| 106 | Ga0075365_10104603 | 3300006038 | Bacteria | 1941 |
| 107 | Ga0070715_10058674 | 3300006163 | Bacteria | 1681 |
| 108 | Ga0070715_10109261 | 3300006163 | Bacteria | 1302 |
| 109 | Ga0070712_100025865 | 3300006175 | Bacteria | 3905 |
| 110 | Ga0070712_100203881 | 3300006175 | Bacteria | 1555 |
| 111 | Ga0075362_10066258 | 3300006177 | Bacteria | 1641 |
| 112 | Ga0075367_10055853 | 3300006178 | Bacteria | 2344 |
| 113 | Ga0075367_10148416 | 3300006178 | Bacteria | 1454 |
| 114 | Ga0097621_100059768 | 3300006237 | Bacteria | 3122 |
| 115 | Ga0075428_100030815 | 3300006844 | Bacteria | 5931 |
| 116 | Ga0075428_100051979 | 3300006844 | Bacteria | 4493 |
| 117 | Ga0075430_100000311 | 3300006846 | Bacteria | 34566 |
| 118 | Ga0075430_100128605 | 3300006846 | Bacteria | 2111 |
| 119 | Ga0075430_100246339 | 3300006846 | Bacteria | 1481 |
| 120 | Ga0075431_100045787 | 3300006847 | Bacteria | 4509 |
| 121 | Ga0075431_100170064 | 3300006847 | Bacteria | 2239 |
| 122 | Ga0075431_100207312 | 3300006847 | Bacteria | 2004 |
| 123 | Ga0075431_100793293 | 3300006847 | Bacteria | 921 |
| 124 | Ga0075433_10117018 | 3300006852 | Unclassified | 2365 |
| 125 | Ga0075433_10450788 | 3300006852 | Unclassified | 1134 |
| 126 | Ga0075434_100005301 | 3300006871 | Bacteria | 11729 |
| 127 | Ga0075434_100220232 | 3300006871 | Bacteria | 1917 |
| 128 | Ga0075429_100070188 | 3300006880 | Bacteria | 3050 |
| 129 | Ga0075429_100169660 | 3300006880 | Bacteria | 1911 |
| 130 | Ga0075436_100064018 | 3300006914 | Bacteria | 2542 |
| 131 | Ga0075436_100131530 | 3300006914 | Bacteria | 1755 |
| 132 | Ga0097620_100080058 | 3300006931 | Unclassified | 3307 |
| 133 | Ga0097620_100295304 | 3300006931 | Bacteria | 1714 |
| 134 | Ga0097620_100802480 | 3300006931 | Unclassified | 1029 |
| 135 | Ga0099794_10007525 | 3300007265 | Bacteria | 4480 |
| 136 | Ga0099794_10084631 | 3300007265 | Bacteria | 1568 |
| 137 | Ga0099795_10008849 | 3300007788 | Bacteria | 2895 |
| 138 | Ga0105240_10118655 | 3300009093 | Bacteria | 3188 |
| 139 | Ga0111539_10005693 | 3300009094 | Bacteria | 16124 |
| 140 | Ga0111539_10609068 | 3300009094 | Bacteria | 1272 |
| 141 | Ga0111539_11377508 | 3300009094 | Bacteria | 818 |
| 142 | Ga0105245_10074900 | 3300009098 | Bacteria | 3081 |
| 143 | Ga0114129_10009721 | 3300009147 | Bacteria | 13721 |
| 144 | Ga0114129_10024961 | 3300009147 | Bacteria | 8474 |
| 145 | Ga0114129_10128924 | 3300009147 | Bacteria | 3476 |
| 146 | Ga0114129_10191202 | 3300009147 | Bacteria | 2779 |
| 147 | Ga0114129_10218131 | 3300009147 | Bacteria | 2575 |
| 148 | Ga0114129_10357825 | 3300009147 | Bacteria | 1932 |
| 149 | Ga0114129_10388389 | 3300009147 | Bacteria | 1842 |
| 150 | Ga0105241_10321271 | 3300009174 | Bacteria | 1335 |
| 151 | Ga0105242_10186229 | 3300009176 | Bacteria | 1835 |
| 152 | Ga0105248_10097526 | 3300009177 | Bacteria | 3312 |
| 153 | Ga0105248_10183124 | 3300009177 | Bacteria | 2360 |
| 154 | Ga0105248_10456875 | 3300009177 | Bacteria | 1439 |
| 155 | Ga0105237_10080387 | 3300009545 | Bacteria | 3250 |
| 156 | Ga0105238_10327002 | 3300009551 | Unclassified | 1519 |
| 157 | Ga0105249_10158485 | 3300009553 | Unclassified | 2185 |
| 158 | Ga0105249_10537932 | 3300009553 | Bacteria | 1218 |
| 159 | Ga0105246_10103964 | 3300011119 | Bacteria | 2074 |
| 160 | Ga0157344_1000470 | 3300012476 | Bacteria | 1578 |
| 161 | Ga0157323_1003505 | 3300012495 | Bacteria | 950 |
| 162 | Ga0157373_10238475 | 3300013100 | Bacteria | 1285 |
| 163 | Ga0157370_10005113 | 3300013104 | Bacteria | 14793 |
| 164 | Ga0157374_10567377 | 3300013296 | Unclassified | 1143 |
| 165 | Ga0157378_10167721 | 3300013297 | Bacteria | 2058 |
| 166 | Ga0163162_10166546 | 3300013306 | Bacteria | 2328 |
| 167 | Ga0163162_10316386 | 3300013306 | Bacteria | 1693 |
| 168 | Ga0163162_10510694 | 3300013306 | Bacteria | 1332 |
| 169 | Ga0157372_10035808 | 3300013307 | Bacteria | 5466 |
| 170 | Ga0157372_10296489 | 3300013307 | Bacteria | 1881 |
| 171 | Ga0157372_10625198 | 3300013307 | Bacteria | 1255 |
| 172 | Ga0157375_10148696 | 3300013308 | Bacteria | 2476 |
| 173 | Ga0157375_10276789 | 3300013308 | Bacteria | 1841 |
| 174 | Ga0163163_10039201 | 3300014325 | Bacteria | 4622 |
| 175 | Ga0163163_10188340 | 3300014325 | Unclassified | 2112 |
| 176 | Ga0157380_10221660 | 3300014326 | Bacteria | 1692 |
| 177 | Ga0182008_10113814 | 3300014497 | Unclassified | 1341 |
| 178 | Ga0157377_10061450 | 3300014745 | Bacteria | 2147 |
| 179 | Ga0157376_10040052 | 3300014969 | Bacteria | 3827 |
| 180 | Ga0157376_10097644 | 3300014969 | Bacteria | 2559 |
| 181 | Ga0163161_10093783 | 3300017792 | Bacteria | 2224 |
| 182 | Ga0207656_10017789 | 3300025321 | Unclassified | 2789 |
| 183 | Ga0207682_10045090 | 3300025893 | Bacteria | 1809 |
| 184 | Ga0207692_10315850 | 3300025898 | Bacteria | 955 |
| 185 | Ga0207710_10106633 | 3300025900 | Bacteria | 1327 |
| 186 | Ga0207688_10022504 | 3300025901 | Bacteria | 3449 |
| 187 | Ga0207680_10105409 | 3300025903 | Bacteria | 1819 |
| 188 | Ga0207647_10014286 | 3300025904 | Bacteria | 5477 |
| 189 | Ga0207685_10061019 | 3300025905 | Bacteria | 1493 |
| 190 | Ga0207685_10067547 | 3300025905 | Bacteria | 1438 |
| 191 | Ga0207699_10012929 | 3300025906 | Bacteria | 4256 |
| 192 | Ga0207645_10019185 | 3300025907 | Bacteria | 4488 |
| 193 | Ga0207643_10000872 | 3300025908 | Bacteria | 18178 |
| 194 | Ga0207684_10158518 | 3300025910 | Bacteria | 1948 |
| 195 | Ga0207707_10023677 | 3300025912 | Bacteria | 5370 |
| 196 | Ga0207707_10179340 | 3300025912 | Bacteria | 1849 |
| 197 | Ga0207693_10008359 | 3300025915 | Bacteria | 8471 |
| 198 | Ga0207693_10038010 | 3300025915 | Bacteria | 3792 |
| 199 | Ga0207693_10040307 | 3300025915 | Bacteria | 3678 |
| 200 | Ga0207693_10077132 | 3300025915 | Bacteria | 2609 |
| 201 | Ga0207663_10115023 | 3300025916 | Bacteria | 1832 |
| 202 | Ga0207660_10004266 | 3300025917 | Bacteria | 9319 |
| 203 | Ga0207662_10007580 | 3300025918 | Bacteria | 5912 |
| 204 | Ga0207657_10023526 | 3300025919 | Bacteria | 5735 |
| 205 | Ga0207652_10010306 | 3300025921 | Bacteria | 7524 |
| 206 | Ga0207659_10291224 | 3300025926 | Bacteria | 1338 |
| 207 | Ga0207687_10396859 | 3300025927 | Bacteria | 1134 |
| 208 | Ga0207700_10142650 | 3300025928 | Bacteria | 1970 |
| 209 | Ga0207644_10035189 | 3300025931 | Bacteria | 3508 |
| 210 | Ga0207690_10242211 | 3300025932 | Unclassified | 1389 |
| 211 | Ga0207706_10056684 | 3300025933 | Unclassified | 3454 |
| 212 | Ga0207706_10272722 | 3300025933 | Unclassified | 1476 |
| 213 | Ga0207686_10135763 | 3300025934 | Bacteria | 1693 |
| 214 | Ga0207709_10320725 | 3300025935 | Unclassified | 1159 |
| 215 | Ga0207670_10002139 | 3300025936 | Bacteria | 10336 |
| 216 | Ga0207670_10189690 | 3300025936 | Bacteria | 1555 |
| 217 | Ga0207670_10416597 | 3300025936 | Bacteria | 1077 |
| 218 | Ga0207669_10020543 | 3300025937 | Bacteria | 3467 |
| 219 | Ga0207669_10046523 | 3300025937 | Bacteria | 2564 |
| 220 | Ga0207704_10092037 | 3300025938 | Bacteria | 1994 |
| 221 | Ga0207665_10006295 | 3300025939 | Bacteria | 7873 |
| 222 | Ga0207665_10157812 | 3300025939 | Bacteria | 1629 |
| 223 | Ga0207691_10007735 | 3300025940 | Bacteria | 10345 |
| 224 | Ga0207711_10003367 | 3300025941 | Bacteria | 13852 |
| 225 | Ga0207711_10390130 | 3300025941 | Bacteria | 1293 |
| 226 | Ga0207661_10346787 | 3300025944 | Bacteria | 1339 |
| 227 | Ga0207679_10167690 | 3300025945 | Bacteria | 1804 |
| 228 | Ga0207668_10028831 | 3300025972 | Bacteria | 3634 |
| 229 | Ga0207658_10166521 | 3300025986 | Bacteria | 1811 |
| 230 | Ga0207703_10210367 | 3300026035 | Bacteria | 1734 |
| 231 | Ga0207703_10612983 | 3300026035 | Bacteria | 1030 |
| 232 | Ga0207639_10049286 | 3300026041 | Bacteria | 3193 |
| 233 | Ga0207678_10005238 | 3300026067 | Bacteria | 11614 |
| 234 | Ga0207708_10005514 | 3300026075 | Bacteria | 9339 |
| 235 | Ga0207708_10059087 | 3300026075 | Unclassified | 2926 |
| 236 | Ga0207641_10284515 | 3300026088 | Bacteria | 1556 |
| 237 | Ga0207648_10028821 | 3300026089 | Bacteria | 4922 |
| 238 | Ga0207648_10117889 | 3300026089 | Unclassified | 2333 |
| 239 | Ga0207676_10034428 | 3300026095 | Bacteria | 3835 |
| 240 | Ga0207674_10058822 | 3300026116 | Bacteria | 3892 |
| 241 | Ga0207675_100035978 | 3300026118 | Bacteria | 4618 |
| 242 | Ga0207683_10051673 | 3300026121 | Bacteria | 3601 |
| 243 | Ga0207698_10130895 | 3300026142 | Unclassified | 2143 |
| 244 | Ga0209179_1008104 | 3300027512 | Bacteria | 1760 |
| 245 | Ga0207428_10004567 | 3300027907 | Bacteria | 13120 |
| 246 | Ga0207428_10173195 | 3300027907 | Bacteria | 1633 |
| 247 | Ga0207428_10343874 | 3300027907 | Bacteria | 1098 |
| 248 | Ga0265357_1000526 | 3300028023 | Bacteria | 2290 |
| 249 | Ga0268266_10341305 | 3300028379 | Unclassified | 1406 |
| 250 | Ga0268266_10623664 | 3300028379 | Bacteria | 1037 |
| 251 | Ga0268265_10070804 | 3300028380 | Unclassified | 2713 |
| 252 | Ga0268265_10280953 | 3300028380 | Bacteria | 1489 |
| 253 | Ga0265337_1001529 | 3300028556 | Bacteria | 11350 |
| 254 | Ga0265338_10010460 | 3300028800 | Bacteria | 10872 |
| 255 | Ga0265770_1020447 | 3300030878 | Bacteria | 1046 |
| 256 | Ga0265760_10029890 | 3300031090 | Unclassified | 1603 |
| 257 | Ga0265330_10024010 | 3300031235 | Unclassified | 2766 |
| 258 | Ga0265332_10001364 | 3300031238 | Bacteria | 13853 |
| 259 | Ga0265325_10035404 | 3300031241 | Bacteria | 2652 |
| 260 | Ga0265325_10058454 | 3300031241 | Bacteria | 1964 |
| 261 | Ga0265340_10009578 | 3300031247 | Bacteria | 5194 |
| 262 | Ga0265340_10143968 | 3300031247 | Unclassified | 1089 |
| 263 | Ga0265339_10000133 | 3300031249 | Bacteria | 60726 |
| 264 | Ga0265331_10010346 | 3300031250 | Bacteria | 5167 |
| 265 | Ga0265316_10191371 | 3300031344 | Bacteria | 1520 |
| 266 | Ga0265313_10000491 | 3300031595 | Bacteria | 41687 |
| 267 | Ga0265314_10010268 | 3300031711 | Bacteria | 7827 |
| 268 | Ga0265342_10000328 | 3300031712 | Bacteria | 53590 |
| 269 | Ga0316578_10059481 | 3300031728 | Bacteria | 2248 |
| 270 | Ga0373930_0000042 | 3300034816 | Bacteria | 11263 |
| 271 | Ga0373948_0000129 | 3300034817 | Bacteria | 7918 |
| 272 | Ga0373950_0001254 | 3300034818 | Unclassified | 3278 |
| 273 | Ga0373938_0000030 | 3300034957 | Bacteria | 18683 |
| 274 | Ga0373938_0021761 | 3300034957 | Bacteria | 1303 |
| 275 | Ga0373926_0118501 | 3300035083 | Bacteria | 997 |
| 276 | Ga0373928_0000123 | 3300035084 | Bacteria | 14455 |
| 277 | Ga0373928_0021523 | 3300035084 | Bacteria | 1361 |
| 278 | Ga0373929_0000703 | 3300035085 | Bacteria | 6477 |
| 279 | Ga0373934_0017783 | 3300035086 | Bacteria | 2716 |
| 280 | Ga0373934_0039593 | 3300035086 | Bacteria | 1859 |
| 281 | Ga0373940_0000022 | 3300035088 | Bacteria | 17194 |
| 282 | Ga0373944_0006259 | 3300035089 | Bacteria | 3154 |
| 283 | Ga0373949_0000438 | 3300035090 | Bacteria | 14335 |
| 284 | Ga0373951_0004506 | 3300035091 | Unclassified | 3301 |
| 285 | Ga0373952_0000180 | 3300035092 | Bacteria | 9797 |
| 286 | Ga0373923_0032815 | 3300035111 | Bacteria | 2099 |
| 287 | Ga0373923_0121884 | 3300035111 | Bacteria | 1166 |
| 288 | Ga0373932_0000683 | 3300035112 | Bacteria | 10253 |
| 289 | Ga0373932_0014144 | 3300035112 | Bacteria | 2001 |
| 290 | Ga0373936_0001692 | 3300035113 | Bacteria | 8090 |
| 291 | Ga0373939_0000329 | 3300035114 | Bacteria | 12192 |
| 292 | Ga0373941_0000049 | 3300035115 | Bacteria | 17770 |
| 293 | Ga0373945_0005566 | 3300035116 | Unclassified | 4037 |
| 294 | Ga0373945_0008967 | 3300035116 | Bacteria | 3270 |
| 295 | Ga0373953_0161825 | 3300035117 | Bacteria | 962 |
| 296 | Ga0373954_0013000 | 3300035118 | Bacteria | 3706 |
| 297 | Ga0373954_0065137 | 3300035118 | Bacteria | 1724 |
| 298 | Ga0373954_0089043 | 3300035118 | Bacteria | 1481 |
| 299 | Ga0373954_0094761 | 3300035118 | Bacteria | 1437 |
| 300 | Ga0373956_0003856 | 3300035119 | Bacteria | 6027 |
| 301 | Ga0373956_0149576 | 3300035119 | Bacteria | 1098 |
| 302 | Ga0373957_0017204 | 3300035120 | Bacteria | 2514 |
| 303 | Ga0373960_0000240 | 3300035121 | Bacteria | 10234 |
| 304 | Ga0373943_0005937 | 3300035170 | Bacteria | 5479 |
| 305 | Ga0373943_0074089 | 3300035170 | Bacteria | 1730 |
| 306 | Ga0373943_0094098 | 3300035170 | Bacteria | 1556 |
| 307 | Ga0373946_0010660 | 3300035171 | Bacteria | 3408 |
| 308 | Ga0373946_0040899 | 3300035171 | Unclassified | 1899 |
| 309 | Ga0373955_0357529 | 3300035172 | Unclassified | 885 |
| 310 | Ga0373961_0001448 | 3300035241 | Bacteria | 6991 |
| 311 | Ga0373962_0000637 | 3300035242 | Bacteria | 7969 |
| 312 | Ga0316574_0000202 | 3300035398 | Bacteria | 20869 |
| 313 | Ga0373924_0002618 | 3300035410 | Bacteria | 6074 |
| 314 | Ga0373924_0003107 | 3300035410 | Bacteria | 5667 |
| 315 | Ga0373924_0038587 | 3300035410 | Bacteria | 1949 |
| 316 | Ga0373931_0002197 | 3300035691 | Bacteria | 8618 |
| 317 | Ga0373931_0014415 | 3300035691 | Unclassified | 3863 |
| 318 | Ga0373931_0161493 | 3300035691 | Bacteria | 1314 |
| 319 | Ga0373935_0000337 | 3300035692 | Bacteria | 23756 |
| 320 | Ga0373935_0025186 | 3300035692 | Bacteria | 3666 |
| 321 | Ga0373935_0043417 | 3300035692 | Bacteria | 2829 |
| 322 | Ga0373935_0045529 | 3300035692 | Bacteria | 2769 |
| 323 | Ga0373935_0318938 | 3300035692 | Bacteria | 1102 |
| 324 | Ga0373927_0010461 | 3300035695 | Bacteria | 6184 |
| 325 | Ga0373927_0017168 | 3300035695 | Bacteria | 4769 |
| 326 | Ga0373927_0017198 | 3300035695 | Bacteria | 4763 |
| 327 | Ga0373927_0048991 | 3300035695 | Bacteria | 2732 |
| 328 | Ga0373927_0122483 | 3300035695 | Bacteria | 1697 |
| 329 | Ga0373927_0205603 | 3300035695 | Unclassified | 1293 |
| 330 | Ga0373927_0229033 | 3300035695 | Bacteria | 1221 |
| 331 | Ga0373933_0001345 | 3300035724 | Bacteria | 14486 |
| 332 | Ga0373933_0008931 | 3300035724 | Bacteria | 5466 |
| 333 | Ga0373933_0124154 | 3300035724 | Bacteria | 1619 |
| 334 | Ga0373947_0009229 | 3300035725 | Bacteria | 5669 |
| 335 | Ga0373947_0020264 | 3300035725 | Bacteria | 3838 |
| 336 | Ga0373947_0074759 | 3300035725 | Bacteria | 2086 |
| 337 | Ga0373947_0101560 | 3300035725 | Bacteria | 1808 |
| 338 | Ga0373947_0138367 | 3300035725 | Bacteria | 1560 |
| 339 | Ga0373947_0163332 | 3300035725 | Bacteria | 1441 |
| 340 | Ga0373947_0181537 | 3300035725 | Bacteria | 1370 |
| 341 | Ga0373937_0000597 | 3300036401 | Bacteria | 31969 |
| 342 | Ga0373937_0000934 | 3300036401 | Bacteria | 24791 |
| 343 | Ga0373937_0008587 | 3300036401 | Bacteria | 8872 |
| 344 | Ga0373937_0031848 | 3300036401 | Bacteria | 4780 |
| 345 | Ga0373937_0229462 | 3300036401 | Bacteria | 1748 |
| 346 | Ga0316584_0108806 | 3300036712 | Bacteria | 2074 |
| 347 | Ga0373925_0000741 | 3300037068 | Bacteria | 29997 |
| 348 | Ga0373925_0019319 | 3300037068 | Bacteria | 4955 |
| 349 | Ga0373925_0040893 | 3300037068 | Bacteria | 3434 |
| 350 | Ga0373925_0099428 | 3300037068 | Bacteria | 2234 |
| 351 | Ga0373925_0110476 | 3300037068 | Bacteria | 2123 |
| 352 | Ga0373925_0164119 | 3300037068 | Bacteria | 1751 |
| 353 | Ga0373925_0182167 | 3300037068 | Bacteria | 1663 |
| 354 | Ga0373925_0463873 | 3300037068 | Unclassified | 1038 |
| 355 | Ga0373925_0500799 | 3300037068 | Bacteria | 997 |
| 356 | Ga0436364_1223108 | 3300037853 | Bacteria | 3679 |
| 357 | Ga0395901_0367919 | 3300038443 | Bacteria | 1481 |
| 358 | Ga0436365_1676454 | 3300039437 | Unclassified | 2576 |
| 359 | Ga0436360_0330917 | 3300039438 | Bacteria | 2392 |
| 360 | Ga0436361_1044138 | 3300039447 | Bacteria | 5868 |
| 361 | Ga0436363_1667002 | 3300039450 | Bacteria | 1536 |
| 362 | Ga0466966_0254947 | 3300044684 | Bacteria | 1057 |
| 363 | Ga0466963_0161058 | 3300044694 | Bacteria | 1562 |
| 364 | Ga0453684_0106785 | 3300044712 | Unclassified | 3411 |
| 365 | Ga0466957_0043673 | 3300044842 | Bacteria | 2715 |
| 366 | Ga0466959_0125017 | 3300045049 | Bacteria | 1826 |
| 367 | Ga0451576_0066990 | 3300045051 | Unclassified | 3737 |
| 368 | Ga0495592_0000188 | 3300046454 | Bacteria | 54485 |
| 369 | Ga0495592_0082174 | 3300046454 | Bacteria | 2329 |
| 370 | Ga0495603_0018977 | 3300046455 | Bacteria | 4162 |
| 371 | Ga0495629_0046228 | 3300046459 | Bacteria | 3053 |
| 372 | Ga0495629_0092404 | 3300046459 | Bacteria | 2112 |
| 373 | Ga0495629_0103854 | 3300046459 | Bacteria | 1982 |
| 374 | Ga0495651_0012463 | 3300046462 | Bacteria | 6557 |
| 375 | Ga0495651_0014205 | 3300046462 | Bacteria | 6155 |
| 376 | Ga0495653_0000198 | 3300046463 | Bacteria | 49009 |
| 377 | Ga0495653_0047651 | 3300046463 | Bacteria | 3314 |
| 378 | Ga0495582_0058040 | 3300046473 | Bacteria | 2134 |
| 379 | Ga0495582_0089684 | 3300046473 | Bacteria | 1714 |
| 380 | Ga0495582_0091039 | 3300046473 | Bacteria | 1701 |
| 381 | Ga0495605_0076281 | 3300046474 | Bacteria | 1575 |
| 382 | Ga0495662_0000720 | 3300046476 | Bacteria | 15794 |
| 383 | Ga0495662_0004951 | 3300046476 | Bacteria | 6665 |
| 384 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 385 | Ga0495664_0000375 | 3300046477 | Bacteria | 21707 |
| 386 | Ga0495584_0000293 | 3300046491 | Bacteria | 35341 |
| 387 | Ga0495584_0018615 | 3300046491 | Bacteria | 3530 |
| 388 | Ga0495585_0138323 | 3300046492 | Bacteria | 1277 |
| 389 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 390 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 391 | Ga0495618_0004650 | 3300046514 | Bacteria | 8399 |
| 392 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 393 | Ga0495628_0080850 | 3300046516 | Bacteria | 2525 |
| 394 | Ga0495630_0000614 | 3300046517 | Bacteria | 25848 |
| 395 | Ga0495630_0017955 | 3300046517 | Bacteria | 5190 |
| 396 | Ga0495630_0036987 | 3300046517 | Bacteria | 3650 |
| 397 | Ga0495644_0092159 | 3300046523 | Bacteria | 1144 |
| 398 | Ga0495644_0155522 | 3300046523 | Bacteria | 876 |
| 399 | Ga0495663_0041205 | 3300046525 | Unclassified | 1404 |
| 400 | Ga0495666_0091424 | 3300046526 | Bacteria | 1436 |
| 401 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 402 | Ga0495652_0040209 | 3300046529 | Bacteria | 4041 |
| 403 | Ga0495665_0107591 | 3300046531 | Bacteria | 1463 |
| 404 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 405 | Ga0495640_0006783 | 3300046533 | Bacteria | 9035 |
| 406 | Ga0495640_0158241 | 3300046533 | Bacteria | 1453 |
| 407 | Ga0495640_0159682 | 3300046533 | Bacteria | 1445 |
| 408 | Ga0495586_0084897 | 3300046535 | Bacteria | 1743 |
| 409 | Ga0495586_0177770 | 3300046535 | Bacteria | 1203 |
| 410 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 411 | Ga0495587_0196043 | 3300046536 | Bacteria | 1143 |
| 412 | Ga0495609_0145750 | 3300046538 | Bacteria | 1009 |
| 413 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 414 | Ga0495645_0012230 | 3300046543 | Bacteria | 6044 |
| 415 | Ga0495633_0059262 | 3300046558 | Bacteria | 1796 |
| 416 | Ga0495633_0214064 | 3300046558 | Bacteria | 883 |
| 417 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 418 | Ga0495667_0060226 | 3300046559 | Bacteria | 2490 |
| 419 | Ga0495667_0179533 | 3300046559 | Unclassified | 1359 |
| 420 | Ga0495668_0166948 | 3300046616 | Bacteria | 1206 |
| 421 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 422 | Ga0495634_0094839 | 3300046642 | Unclassified | 1933 |
| 423 | Ga0495634_0224304 | 3300046642 | Bacteria | 1159 |
| 424 | Ga0495635_0000289 | 3300046663 | Bacteria | 32189 |
| 425 | Ga0495635_0022667 | 3300046663 | Bacteria | 4377 |
| 426 | Ga0495635_0024750 | 3300046663 | Bacteria | 4184 |
| 427 | Ga0495657_0000781 | 3300046675 | Bacteria | 28299 |
| 428 | Ga0495657_0015918 | 3300046675 | Bacteria | 5489 |
| 429 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 430 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 431 | Ga0495623_0025557 | 3300046679 | Bacteria | 3804 |
| 432 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 433 | Ga0495646_0122495 | 3300046680 | Bacteria | 1470 |
| 434 | Ga0495647_0030190 | 3300046681 | Bacteria | 2010 |
| 435 | Ga0495658_0106054 | 3300046683 | Bacteria | 1684 |
| 436 | Ga0495658_0114725 | 3300046683 | Bacteria | 1623 |
| 437 | Ga0495658_0192531 | 3300046683 | Bacteria | 1268 |
| 438 | Ga0495669_0135910 | 3300046684 | Bacteria | 1159 |
| 439 | Ga0495613_0073747 | 3300046689 | Bacteria | 2486 |
| 440 | Ga0495613_0183065 | 3300046689 | Unclassified | 1483 |
| 441 | Ga0495624_0034192 | 3300046690 | Bacteria | 3289 |
| 442 | Ga0495624_0068235 | 3300046690 | Bacteria | 2217 |
| 443 | Ga0495670_0065940 | 3300046691 | Bacteria | 1826 |
| 444 | Ga0495649_0058802 | 3300046694 | Bacteria | 2071 |
| 445 | Ga0495600_0000233 | 3300046809 | Bacteria | 30755 |
| 446 | Ga0495600_0414162 | 3300046809 | Bacteria | 837 |
| 447 | Ga0495581_0014853 | 3300047315 | Bacteria | 4517 |
| 448 | Ga0495581_0057301 | 3300047315 | Bacteria | 2249 |
| 449 | Ga0495581_0061810 | 3300047315 | Bacteria | 2164 |
| 450 | Ga0495581_0174679 | 3300047315 | Bacteria | 1256 |
| 451 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 452 | Ga0495604_0238484 | 3300047317 | Bacteria | 1245 |
| 453 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 454 | Ga0495674_0026624 | 3300047319 | Bacteria | 5291 |
| 455 | Ga0495674_0138498 | 3300047319 | Bacteria | 2047 |
| 456 | Ga0495674_0205843 | 3300047319 | Bacteria | 1631 |
| 457 | Ga0495674_0234323 | 3300047319 | Bacteria | 1514 |
| 458 | Ga0495676_0059847 | 3300047321 | Bacteria | 2988 |
| 459 | Ga0495676_0144694 | 3300047321 | Bacteria | 1699 |
| 460 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 461 | Ga0495680_0292774 | 3300047322 | Bacteria | 1145 |
| 462 | Ga0495675_0000437 | 3300047444 | Bacteria | 27820 |
| 463 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 464 | Ga0495684_0002950 | 3300047471 | Bacteria | 13397 |
| 465 | Ga0495684_0025573 | 3300047471 | Bacteria | 4535 |
| 466 | Ga0495593_0020549 | 3300047673 | Bacteria | 3697 |
| 467 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 468 | Ga0495602_0006017 | 3300048088 | Bacteria | 12738 |
| 469 | Ga0495602_0114719 | 3300048088 | Bacteria | 2181 |
| 470 | Ga0496100_0001551 | 3300048903 | Bacteria | 11289 |
| 471 | Ga0496100_0058396 | 3300048903 | Bacteria | 2531 |
| 472 | Ga0496101_0001012 | 3300048904 | Bacteria | 16558 |
| 473 | Ga0496101_0033510 | 3300048904 | Bacteria | 3623 |
| 474 | Ga0496101_0325923 | 3300048904 | Bacteria | 1205 |
| 475 | Ga0496101_0391724 | 3300048904 | Bacteria | 1093 |
| 476 | Ga0496102_0033538 | 3300048905 | Bacteria | 4614 |
| 477 | Ga0496102_0062761 | 3300048905 | Unclassified | 3402 |
| 478 | Ga0496102_0073679 | 3300048905 | Bacteria | 3138 |
| 479 | Ga0496102_0094133 | 3300048905 | Unclassified | 2776 |
| 480 | Ga0496102_0146468 | 3300048905 | Bacteria | 2217 |
| 481 | Ga0496102_0173890 | 3300048905 | Bacteria | 2027 |
| 482 | Ga0496102_0641566 | 3300048905 | Bacteria | 985 |
| 483 | Ga0496103_0091513 | 3300048906 | Bacteria | 1919 |
| 484 | Ga0496103_0363260 | 3300048906 | Bacteria | 931 |
| 485 | Ga0496104_0000629 | 3300048907 | Bacteria | 30223 |
| 486 | Ga0496104_0001130 | 3300048907 | Bacteria | 22846 |
| 487 | Ga0496104_0001756 | 3300048907 | Bacteria | 18725 |
| 488 | Ga0496104_0098229 | 3300048907 | Bacteria | 2803 |
| 489 | Ga0496105_0001322 | 3300048908 | Bacteria | 17343 |
| 490 | Ga0496105_0019711 | 3300048908 | Bacteria | 5441 |
| 491 | Ga0496105_0040140 | 3300048908 | Bacteria | 3858 |
| 492 | Ga0496105_0124346 | 3300048908 | Bacteria | 2126 |
| 493 | Ga0496105_0192272 | 3300048908 | Unclassified | 1668 |
| 494 | Ga0496105_0335131 | 3300048908 | Bacteria | 1210 |
| 495 | Ga0496106_0014871 | 3300048909 | Bacteria | 5757 |
| 496 | Ga0496106_0022634 | 3300048909 | Bacteria | 4670 |
| 497 | Ga0496106_0077696 | 3300048909 | Bacteria | 2546 |
| 498 | Ga0496106_0099112 | 3300048909 | Bacteria | 2259 |
| 499 | Ga0496106_0297069 | 3300048909 | Unclassified | 1295 |
| 500 | Ga0496106_0662152 | 3300048909 | Bacteria | 834 |
| 501 | Ga0496107_0065946 | 3300048910 | Bacteria | 2624 |
| 502 | Ga0496107_0244389 | 3300048910 | Bacteria | 1335 |
| 503 | Ga0496108_0002891 | 3300048911 | Bacteria | 13786 |
| 504 | Ga0496108_0009174 | 3300048911 | Bacteria | 8006 |
| 505 | Ga0496108_0211421 | 3300048911 | Bacteria | 1684 |
| 506 | Ga0496109_0002809 | 3300048912 | Bacteria | 14583 |
| 507 | Ga0496109_0036314 | 3300048912 | Bacteria | 4447 |
| 508 | Ga0496109_0145202 | 3300048912 | Bacteria | 2219 |
| 509 | Ga0496109_0269106 | 3300048912 | Unclassified | 1605 |
| 510 | Ga0496110_0024942 | 3300048913 | Bacteria | 5103 |
| 511 | Ga0496110_0042460 | 3300048913 | Bacteria | 3969 |
| 512 | Ga0496110_0131951 | 3300048913 | Bacteria | 2256 |
| 513 | Ga0496110_0623954 | 3300048913 | Bacteria | 977 |
| 514 | Ga0496111_0030271 | 3300048914 | Unclassified | 3849 |
| 515 | Ga0496111_0096207 | 3300048914 | Bacteria | 2173 |
| 516 | Ga0496111_0149255 | 3300048914 | Bacteria | 1734 |
| 517 | Ga0496112_0009460 | 3300048915 | Bacteria | 8783 |
| 518 | Ga0496112_0102058 | 3300048915 | Bacteria | 2838 |
| 519 | Ga0496112_0154440 | 3300048915 | Bacteria | 2262 |
| 520 | Ga0496112_0165948 | 3300048915 | Bacteria | 2174 |
| 521 | Ga0496113_0072484 | 3300048916 | Bacteria | 2621 |
| 522 | Ga0496113_0175849 | 3300048916 | Bacteria | 1696 |
| 523 | Ga0496114_0032157 | 3300048917 | Bacteria | 4317 |
| 524 | Ga0496114_0075244 | 3300048917 | Unclassified | 2844 |
| 525 | Ga0496114_0088863 | 3300048917 | Bacteria | 2621 |
| 526 | Ga0496115_0022900 | 3300048918 | Bacteria | 4846 |
| 527 | Ga0496115_0025523 | 3300048918 | Bacteria | 4601 |
| 528 | Ga0496115_0054644 | 3300048918 | Bacteria | 3207 |
| 529 | Ga0496115_0072173 | 3300048918 | Bacteria | 2800 |
| 530 | Ga0496115_0100877 | 3300048918 | Bacteria | 2366 |
| 531 | Ga0496115_0293449 | 3300048918 | Bacteria | 1333 |
| 532 | Ga0501036_0476081 | 3300049572 | Bacteria | 1040 |
| 533 | Ga0501037_0420029 | 3300049573 | Bacteria | 915 |
| 534 | Ga0501047_0140762 | 3300049581 | Bacteria | 2291 |
| 535 | Ga0501048_0206598 | 3300049582 | Bacteria | 1393 |
| 536 | Ga0501070_0050832 | 3300049586 | Bacteria | 3440 |
| 537 | Ga0501072_0120885 | 3300049588 | Bacteria | 2087 |
| 538 | Ga0501072_0251235 | 3300049588 | Bacteria | 1408 |
| 539 | Ga0501073_0288328 | 3300049589 | Bacteria | 1133 |
| 540 | Ga0501075_0023405 | 3300049591 | Unclassified | 4523 |
| 541 | Ga0501075_0657910 | 3300049591 | Bacteria | 799 |
| 542 | Ga0501077_0014216 | 3300049593 | Bacteria | 4998 |
| 543 | Ga0501079_0283763 | 3300049741 | Bacteria | 1295 |
| 544 | Ga0501079_0355756 | 3300049741 | Bacteria | 1147 |
| 545 | Ga0501081_0003438 | 3300049743 | Bacteria | 10104 |
| 546 | Ga0501044_0389579 | 3300049823 | Bacteria | 1307 |
| 547 | nmdc:mga03683_40001_c1 | 3300050489 | Unclassified | 1921 |
| 548 | nmdc:mga0yw44_918_c1 | 3300050492 | Bacteria | 11147 |
| 549 | nmdc:mga06z11_309953_c1 | 3300050494 | Bacteria | 940 |
| 550 | nmdc:mga06z11_38348_c1 | 3300050494 | Bacteria | 2379 |
| 551 | nmdc:mga05p37_130171_c1 | 3300050507 | Bacteria | 1949 |
| 552 | nmdc:mga05p37_137391_c1 | 3300050507 | Bacteria | 2996 |
| 553 | nmdc:mga05p37_25897_c1 | 3300050507 | Bacteria | 7131 |
| 554 | nmdc:mga05p37_64007_c1 | 3300050507 | Bacteria | 4525 |
| 555 | nmdc:mga05p37_9175_c1 | 3300050507 | Bacteria | 11692 |
| 556 | nmdc:mga09592_118300_c1 | 3300050508 | Unclassified | 2274 |
| 557 | nmdc:mga09592_253335_c1 | 3300050508 | Bacteria | 1526 |
| 558 | nmdc:mga0qj67_111_c1 | 3300050509 | Bacteria | 53806 |
| 559 | nmdc:mga0qj67_29143_c1 | 3300050509 | Bacteria | 4287 |
| 560 | nmdc:mga06r32_165598_c2 | 3300050510 | Bacteria | 1632 |
| 561 | nmdc:mga06r32_70468_c1 | 3300050510 | Bacteria | 3381 |
| 562 | nmdc:mga08y16_120737_c1 | 3300050511 | Bacteria | 2727 |
| 563 | nmdc:mga08y16_15633_c1 | 3300050511 | Bacteria | 7982 |
| 564 | nmdc:mga08y16_299076_c1 | 3300050511 | Bacteria | 1659 |
| 565 | nmdc:mga08y16_36613_c1 | 3300050511 | Bacteria | 5153 |
| 566 | nmdc:mga0n895_215308_c1 | 3300050512 | Bacteria | 1950 |
| 567 | nmdc:mga0n895_512431_c1 | 3300050512 | Bacteria | 1208 |
| 568 | nmdc:mga0rr50_440609_c1 | 3300050513 | Bacteria | 1103 |
| 569 | nmdc:mga08x19_159289_c1 | 3300050514 | Bacteria | 1532 |
| 570 | nmdc:mga08x19_80903_c1 | 3300050514 | Bacteria | 2133 |
| 571 | nmdc:mga0a205_317162_c1 | 3300050515 | Bacteria | 1430 |
| 572 | nmdc:mga0a205_31909_c1 | 3300050515 | Bacteria | 5049 |
| 573 | nmdc:mga0a205_81197_c1 | 3300050515 | Bacteria | 3132 |
| 574 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 575 | Ga0495601_0008245 | 3300053077 | Bacteria | 6148 |
| 576 | Ga0495601_0024234 | 3300053077 | Bacteria | 3737 |
| 577 | Ga0495601_0121364 | 3300053077 | Bacteria | 1697 |
| 578 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 579 | Ga0495612_0000697 | 3300053078 | Bacteria | 13585 |
| 580 | Ga0495612_0009258 | 3300053078 | Bacteria | 3996 |
| 581 | Ga0495612_0168114 | 3300053078 | Bacteria | 959 |
| 582 | Ga0495595_0000184 | 3300053084 | Bacteria | 25097 |
| 583 | Ga0495595_0000714 | 3300053084 | Bacteria | 12676 |
| 584 | Ga0495595_0063414 | 3300053084 | Unclassified | 1735 |
| 585 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 586 | Ga0495619_0009180 | 3300053085 | Bacteria | 6245 |
| 587 | Ga0495619_0018329 | 3300053085 | Bacteria | 4441 |
| 588 | Ga0495619_0055176 | 3300053085 | Bacteria | 2631 |
| 589 | Ga0495619_0057164 | 3300053085 | Unclassified | 2588 |
| 590 | Ga0495619_0061884 | 3300053085 | Bacteria | 2491 |
| 591 | Ga0495619_0187824 | 3300053085 | Bacteria | 1430 |
| 592 | Ga0495619_0274712 | 3300053085 | Bacteria | 1168 |
| 593 | Ga0501084_0032380 | 3300054114 | Unclassified | 4373 |
| 594 | Ga0501084_0056755 | 3300054114 | Bacteria | 3276 |
| 595 | Ga0501082_0150963 | 3300060353 | Bacteria | 2018 |
| 596 | Ga0501082_0262109 | 3300060353 | Bacteria | 1504 |
| 597 | Ga0501082_0309010 | 3300060353 | Bacteria | 1377 |
| 598 | Ga0501082_0325657 | 3300060353 | Bacteria | 1339 |
| 599 | Ga0530510_0210498 | 3300061734 | Bacteria | 1445 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0414162 | Ga0495600_0414162_15_734 | 238 |
| 2 | 3300048905 | Ga0496102_0641566 | Ga0496102_0641566_16_735 | 238 |
| 3 | 3300035171 | Ga0373946_0010660 | Ga0373946_0010660_20_742 | 239 |
| 4 | 3300035695 | Ga0373927_0122483 | Ga0373927_0122483_949_1671 | 239 |
| 5 | 3300035725 | Ga0373947_0074759 | Ga0373947_0074759_1354_2076 | 239 |
| 6 | 3300046459 | Ga0495629_0092404 | Ga0495629_0092404_29_751 | 239 |
| 7 | 3300047321 | Ga0495676_0144694 | Ga0495676_0144694_14_736 | 239 |
| 8 | 3300048903 | Ga0496100_0058396 | Ga0496100_0058396_1794_2516 | 239 |
| 9 | 3300049591 | Ga0501075_0657910 | Ga0501075_0657910_29_751 | 239 |
| 10 | 3300054114 | Ga0501084_0056755 | Ga0501084_0056755_2534_3256 | 239 |
| 11 | 3300046558 | Ga0495633_0214064 | Ga0495633_0214064_28_795 | 244 |
| 12 | 3300009094 | Ga0111539_11377508 | Ga0111539_113775081 | 253 |
| 13 | 3300048913 | Ga0496110_0623954 | Ga0496110_0623954_186_950 | 253 |
| 14 | 3300035118 | Ga0373954_0094761 | Ga0373954_0094761_125_892 | 254 |
| 15 | 3300036401 | Ga0373937_0229462 | Ga0373937_0229462_840_1607 | 254 |
| 16 | 3300046455 | Ga0495603_0018977 | Ga0495603_0018977_3369_4136 | 254 |
| 17 | 3300046523 | Ga0495644_0155522 | Ga0495644_0155522_83_850 | 254 |
| 18 | 3300048909 | Ga0496106_0662152 | Ga0496106_0662152_60_824 | 254 |
| 19 | 3300049741 | Ga0501079_0283763 | Ga0501079_0283763_494_1261 | 254 |
| 20 | 3300049741 | Ga0501079_0355756 | Ga0501079_0355756_35_802 | 254 |
| 21 | 3300006844 | Ga0075428_100051979 | Ga0075428_1000519792 | 258 |
| 22 | 3300006847 | Ga0075431_100045787 | Ga0075431_1000457872 | 258 |
| 23 | 3300046523 | Ga0495644_0092159 | Ga0495644_0092159_285_1121 | 258 |
| 24 | 3300050507 | nmdc:mga05p37_137391_c1 | nmdc:mga05p37_137391_c1_819_1655 | 258 |
| 25 | 3300046491 | Ga0495584_0000293 | Ga0495584_0000293_19377_20243 | 259 |
| 26 | 3300035724 | Ga0373933_0124154 | Ga0373933_0124154_575_1360 | 260 |
| 27 | 3300031711 | Ga0265314_10010268 | Ga0265314_100102684 | 261 |
| 28 | 3300035118 | Ga0373954_0065137 | Ga0373954_0065137_894_1712 | 262 |
| 29 | 3300035117 | Ga0373953_0161825 | Ga0373953_0161825_50_874 | 263 |
| 30 | 3300038443 | Ga0395901_0367919 | Ga0395901_0367919_579_1400 | 263 |
| 31 | 3300006880 | Ga0075429_100070188 | Ga0075429_1000701882 | 264 |
| 32 | 3300009147 | Ga0114129_10388389 | Ga0114129_103883892 | 264 |
| 33 | 3300050508 | nmdc:mga09592_253335_c1 | nmdc:mga09592_253335_c1_75_908 | 264 |
| 34 | 3300050515 | nmdc:mga0a205_317162_c1 | nmdc:mga0a205_317162_c1_186_1031 | 266 |
| 35 | 3300005937 | Ga0081455_10342494 | Ga0081455_103424942 | 267 |
| 36 | 3300005983 | Ga0081540_1005670 | Ga0081540_10056708 | 267 |
| 37 | 3300006177 | Ga0075362_10066258 | Ga0075362_100662582 | 267 |
| 38 | 3300006852 | Ga0075433_10450788 | Ga0075433_104507881 | 267 |
| 39 | 3300025936 | Ga0207670_10416597 | Ga0207670_104165971 | 267 |
| 40 | 3300035086 | Ga0373934_0039593 | Ga0373934_0039593_179_1012 | 267 |
| 41 | 3300035410 | Ga0373924_0038587 | Ga0373924_0038587_830_1663 | 267 |
| 42 | 3300035692 | Ga0373935_0318938 | Ga0373935_0318938_135_968 | 267 |
| 43 | 3300036401 | Ga0373937_0000934 | Ga0373937_0000934_22588_23421 | 267 |
| 44 | 3300047319 | Ga0495674_0138498 | Ga0495674_0138498_856_1689 | 267 |
| 45 | 3300005330 | Ga0070690_100190943 | Ga0070690_1001909432 | 268 |
| 46 | 3300005336 | Ga0070680_100036582 | Ga0070680_1000365822 | 268 |
| 47 | 3300005458 | Ga0070681_10000708 | Ga0070681_1000070828 | 268 |
| 48 | 3300005530 | Ga0070679_100206770 | Ga0070679_1002067702 | 268 |
| 49 | 3300005544 | Ga0070686_100524080 | Ga0070686_1005240801 | 268 |
| 50 | 3300005549 | Ga0070704_100064974 | Ga0070704_1000649741 | 268 |
| 51 | 3300005981 | Ga0081538_10166423 | Ga0081538_101664231 | 268 |
| 52 | 3300005983 | Ga0081540_1000183 | Ga0081540_10001835 | 268 |
| 53 | 3300006846 | Ga0075430_100000311 | Ga0075430_1000003112 | 268 |
| 54 | 3300006847 | Ga0075431_100793293 | Ga0075431_1007932931 | 268 |
| 55 | 3300006914 | Ga0075436_100064018 | Ga0075436_1000640183 | 268 |
| 56 | 3300009093 | Ga0105240_10118655 | Ga0105240_101186552 | 268 |
| 57 | 3300009094 | Ga0111539_10609068 | Ga0111539_106090681 | 268 |
| 58 | 3300009147 | Ga0114129_10009721 | Ga0114129_1000972111 | 268 |
| 59 | 3300009147 | Ga0114129_10357825 | Ga0114129_103578253 | 268 |
| 60 | 3300013104 | Ga0157370_10005113 | Ga0157370_1000511312 | 268 |
| 61 | 3300013307 | Ga0157372_10035808 | Ga0157372_100358085 | 268 |
| 62 | 3300025912 | Ga0207707_10023677 | Ga0207707_100236772 | 268 |
| 63 | 3300025917 | Ga0207660_10004266 | Ga0207660_100042666 | 268 |
| 64 | 3300025921 | Ga0207652_10010306 | Ga0207652_100103065 | 268 |
| 65 | 3300027907 | Ga0207428_10343874 | Ga0207428_103438741 | 268 |
| 66 | 3300031238 | Ga0265332_10001364 | Ga0265332_100013646 | 268 |
| 67 | 3300031241 | Ga0265325_10035404 | Ga0265325_100354043 | 268 |
| 68 | 3300031250 | Ga0265331_10010346 | Ga0265331_100103463 | 268 |
| 69 | 3300031712 | Ga0265342_10000328 | Ga0265342_100003287 | 268 |
| 70 | 3300035118 | Ga0373954_0089043 | Ga0373954_0089043_434_1273 | 268 |
| 71 | 3300035692 | Ga0373935_0043417 | Ga0373935_0043417_1919_2758 | 268 |
| 72 | 3300036401 | Ga0373937_0031848 | Ga0373937_0031848_2078_2914 | 268 |
| 73 | 3300037068 | Ga0373925_0110476 | Ga0373925_0110476_1181_2020 | 268 |
| 74 | 3300047317 | Ga0495604_0238484 | Ga0495604_0238484_385_1224 | 268 |
| 75 | 3300048088 | Ga0495602_0114719 | Ga0495602_0114719_587_1426 | 268 |
| 76 | 3300049572 | Ga0501036_0476081 | Ga0501036_0476081_102_938 | 268 |
| 77 | 3300049582 | Ga0501048_0206598 | Ga0501048_0206598_513_1349 | 268 |
| 78 | 3300049588 | Ga0501072_0120885 | Ga0501072_0120885_519_1355 | 268 |
| 79 | 3300050507 | nmdc:mga05p37_130171_c1 | nmdc:mga05p37_130171_c1_907_1743 | 268 |
| 80 | 3300050507 | nmdc:mga05p37_9175_c1 | nmdc:mga05p37_9175_c1_9920_10840 | 268 |
| 81 | 3300050509 | nmdc:mga0qj67_111_c1 | nmdc:mga0qj67_111_c1_20847_21695 | 268 |
| 82 | 3300050511 | nmdc:mga08y16_120737_c1 | nmdc:mga08y16_120737_c1_1659_2507 | 268 |
| 83 | 3300050511 | nmdc:mga08y16_299076_c1 | nmdc:mga08y16_299076_c1_593_1429 | 268 |
| 84 | 3300050512 | nmdc:mga0n895_215308_c1 | nmdc:mga0n895_215308_c1_39_875 | 268 |
| 85 | 3300050514 | nmdc:mga08x19_159289_c1 | nmdc:mga08x19_159289_c1_168_1004 | 268 |
| 86 | 3300050514 | nmdc:mga08x19_80903_c1 | nmdc:mga08x19_80903_c1_1079_1918 | 268 |
| 87 | 3300053084 | Ga0495595_0063414 | Ga0495595_0063414_126_962 | 268 |
| 88 | 3300053085 | Ga0495619_0057164 | Ga0495619_0057164_115_951 | 268 |
| 89 | 3300053085 | Ga0495619_0187824 | Ga0495619_0187824_382_1218 | 268 |
| 90 | 3300060353 | Ga0501082_0325657 | Ga0501082_0325657_465_1301 | 268 |
| 91 | 3300061734 | Ga0530510_0210498 | Ga0530510_0210498_215_1051 | 268 |
| 92 | 3300005336 | Ga0070680_100249408 | Ga0070680_1002494082 | 271 |
| 93 | 3300006846 | Ga0075430_100246339 | Ga0075430_1002463392 | 271 |
| 94 | 3300050509 | nmdc:mga0qj67_29143_c1 | nmdc:mga0qj67_29143_c1_2657_3493 | 271 |
| 95 | 3300035111 | Ga0373923_0032815 | Ga0373923_0032815_747_1571 | 272 |
| 96 | 3300035113 | Ga0373936_0001692 | Ga0373936_0001692_2396_3220 | 272 |
| 97 | 3300035116 | Ga0373945_0008967 | Ga0373945_0008967_89_913 | 272 |
| 98 | 3300035118 | Ga0373954_0013000 | Ga0373954_0013000_272_1096 | 272 |
| 99 | 3300035119 | Ga0373956_0149576 | Ga0373956_0149576_168_992 | 272 |
| 100 | 3300035170 | Ga0373943_0005937 | Ga0373943_0005937_672_1496 | 272 |
| 101 | 3300035172 | Ga0373955_0357529 | Ga0373955_0357529_49_870 | 272 |
| 102 | 3300035410 | Ga0373924_0002618 | Ga0373924_0002618_1463_2287 | 272 |
| 103 | 3300035692 | Ga0373935_0000337 | Ga0373935_0000337_4907_5731 | 272 |
| 104 | 3300035724 | Ga0373933_0008931 | Ga0373933_0008931_3135_3959 | 272 |
| 105 | 3300035725 | Ga0373947_0009229 | Ga0373947_0009229_2036_2860 | 272 |
| 106 | 3300035725 | Ga0373947_0163332 | Ga0373947_0163332_490_1314 | 272 |
| 107 | 3300036401 | Ga0373937_0000597 | Ga0373937_0000597_23554_24378 | 272 |
| 108 | 3300037068 | Ga0373925_0000741 | Ga0373925_0000741_4904_5728 | 272 |
| 109 | 3300046454 | Ga0495592_0000188 | Ga0495592_0000188_23527_24351 | 272 |
| 110 | 3300046459 | Ga0495629_0046228 | Ga0495629_0046228_482_1306 | 272 |
| 111 | 3300046462 | Ga0495651_0012463 | Ga0495651_0012463_4902_5726 | 272 |
| 112 | 3300046463 | Ga0495653_0000198 | Ga0495653_0000198_29800_30624 | 272 |
| 113 | 3300046473 | Ga0495582_0058040 | Ga0495582_0058040_760_1584 | 272 |
| 114 | 3300046476 | Ga0495662_0000720 | Ga0495662_0000720_14436_15260 | 272 |
| 115 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_428724_429548 | 272 |
| 116 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_50887_51711 | 272 |
| 117 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_206083_206907 | 272 |
| 118 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_393109_393933 | 272 |
| 119 | 3300046517 | Ga0495630_0000614 | Ga0495630_0000614_34_858 | 272 |
| 120 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_194950_195774 | 272 |
| 121 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_50902_51726 | 272 |
| 122 | 3300046535 | Ga0495586_0177770 | Ga0495586_0177770_313_1137 | 272 |
| 123 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_266516_267340 | 272 |
| 124 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_374360_375184 | 272 |
| 125 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_43790_44614 | 272 |
| 126 | 3300046642 | Ga0495634_0000129 | Ga0495634_0000129_59355_60179 | 272 |
| 127 | 3300046663 | Ga0495635_0000289 | Ga0495635_0000289_12916_13740 | 272 |
| 128 | 3300046675 | Ga0495657_0000781 | Ga0495657_0000781_15314_16138 | 272 |
| 129 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_531787_532611 | 272 |
| 130 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_300732_301556 | 272 |
| 131 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_151365_152189 | 272 |
| 132 | 3300046690 | Ga0495624_0068235 | Ga0495624_0068235_613_1437 | 272 |
| 133 | 3300046809 | Ga0495600_0000233 | Ga0495600_0000233_25013_25837 | 272 |
| 134 | 3300047315 | Ga0495581_0014853 | Ga0495581_0014853_448_1272 | 272 |
| 135 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_418753_419577 | 272 |
| 136 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_168193_169017 | 272 |
| 137 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_196176_197000 | 272 |
| 138 | 3300047444 | Ga0495675_0000437 | Ga0495675_0000437_2154_2978 | 272 |
| 139 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_142778_143602 | 272 |
| 140 | 3300047673 | Ga0495593_0020549 | Ga0495593_0020549_2859_3683 | 272 |
| 141 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_120669_121493 | 272 |
| 142 | 3300048904 | Ga0496101_0325923 | Ga0496101_0325923_305_1126 | 272 |
| 143 | 3300048907 | Ga0496104_0001130 | Ga0496104_0001130_1221_2042 | 272 |
| 144 | 3300048908 | Ga0496105_0124346 | Ga0496105_0124346_670_1491 | 272 |
| 145 | 3300048912 | Ga0496109_0269106 | Ga0496109_0269106_485_1306 | 272 |
| 146 | 3300048918 | Ga0496115_0022900 | Ga0496115_0022900_2243_3064 | 272 |
| 147 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_194904_195728 | 272 |
| 148 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_304705_305529 | 272 |
| 149 | 3300053084 | Ga0495595_0000184 | Ga0495595_0000184_15276_16100 | 272 |
| 150 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_393112_393936 | 272 |
| 151 | 3300031235 | Ga0265330_10024010 | Ga0265330_100240103 | 275 |
| 152 | 3300031247 | Ga0265340_10143968 | Ga0265340_101439682 | 275 |
| 153 | 3300005328 | Ga0070676_10015980 | Ga0070676_100159805 | 276 |
| 154 | 3300005329 | Ga0070683_100503720 | Ga0070683_1005037201 | 276 |
| 155 | 3300005330 | Ga0070690_100024154 | Ga0070690_1000241542 | 276 |
| 156 | 3300005335 | Ga0070666_10344930 | Ga0070666_103449302 | 276 |
| 157 | 3300005340 | Ga0070689_100016595 | Ga0070689_1000165952 | 276 |
| 158 | 3300005344 | Ga0070661_100503256 | Ga0070661_1005032561 | 276 |
| 159 | 3300005347 | Ga0070668_100262438 | Ga0070668_1002624382 | 276 |
| 160 | 3300005356 | Ga0070674_100099820 | Ga0070674_1000998202 | 276 |
| 161 | 3300005438 | Ga0070701_10037485 | Ga0070701_100374852 | 276 |
| 162 | 3300005544 | Ga0070686_100347079 | Ga0070686_1003470792 | 276 |
| 163 | 3300005548 | Ga0070665_100549906 | Ga0070665_1005499062 | 276 |
| 164 | 3300005615 | Ga0070702_100457015 | Ga0070702_1004570151 | 276 |
| 165 | 3300005617 | Ga0068859_100295304 | Ga0068859_1002953042 | 276 |
| 166 | 3300005617 | Ga0068859_100802394 | Ga0068859_1008023941 | 276 |
| 167 | 3300005841 | Ga0068863_100439796 | Ga0068863_1004397962 | 276 |
| 168 | 3300005937 | Ga0081455_10080462 | Ga0081455_100804623 | 276 |
| 169 | 3300005981 | Ga0081538_10005698 | Ga0081538_100056989 | 276 |
| 170 | 3300005983 | Ga0081540_1033395 | Ga0081540_10333954 | 276 |
| 171 | 3300005983 | Ga0081540_1120576 | Ga0081540_11205761 | 276 |
| 172 | 3300006028 | Ga0070717_10294861 | Ga0070717_102948612 | 276 |
| 173 | 3300006163 | Ga0070715_10058674 | Ga0070715_100586742 | 276 |
| 174 | 3300006237 | Ga0097621_100059768 | Ga0097621_1000597682 | 276 |
| 175 | 3300006871 | Ga0075434_100220232 | Ga0075434_1002202322 | 276 |
| 176 | 3300006931 | Ga0097620_100295304 | Ga0097620_1002953041 | 276 |
| 177 | 3300006931 | Ga0097620_100802480 | Ga0097620_1008024801 | 276 |
| 178 | 3300007788 | Ga0099795_10008849 | Ga0099795_100088492 | 276 |
| 179 | 3300009147 | Ga0114129_10128924 | Ga0114129_101289242 | 276 |
| 180 | 3300009147 | Ga0114129_10218131 | Ga0114129_102181314 | 276 |
| 181 | 3300009177 | Ga0105248_10097526 | Ga0105248_100975262 | 276 |
| 182 | 3300009177 | Ga0105248_10456875 | Ga0105248_104568752 | 276 |
| 183 | 3300011119 | Ga0105246_10103964 | Ga0105246_101039642 | 276 |
| 184 | 3300013297 | Ga0157378_10167721 | Ga0157378_101677211 | 276 |
| 185 | 3300013306 | Ga0163162_10166546 | Ga0163162_101665462 | 276 |
| 186 | 3300013306 | Ga0163162_10316386 | Ga0163162_103163862 | 276 |
| 187 | 3300013308 | Ga0157375_10148696 | Ga0157375_101486962 | 276 |
| 188 | 3300013308 | Ga0157375_10276789 | Ga0157375_102767892 | 276 |
| 189 | 3300014325 | Ga0163163_10039201 | Ga0163163_100392014 | 276 |
| 190 | 3300014497 | Ga0182008_10113814 | Ga0182008_101138141 | 276 |
| 191 | 3300014969 | Ga0157376_10097644 | Ga0157376_100976442 | 276 |
| 192 | 3300025893 | Ga0207682_10045090 | Ga0207682_100450902 | 276 |
| 193 | 3300025903 | Ga0207680_10105409 | Ga0207680_101054092 | 276 |
| 194 | 3300025905 | Ga0207685_10061019 | Ga0207685_100610192 | 276 |
| 195 | 3300025907 | Ga0207645_10019185 | Ga0207645_100191855 | 276 |
| 196 | 3300025915 | Ga0207693_10008359 | Ga0207693_100083597 | 276 |
| 197 | 3300025926 | Ga0207659_10291224 | Ga0207659_102912241 | 276 |
| 198 | 3300025931 | Ga0207644_10035189 | Ga0207644_100351892 | 276 |
| 199 | 3300025936 | Ga0207670_10002139 | Ga0207670_100021396 | 276 |
| 200 | 3300025937 | Ga0207669_10020543 | Ga0207669_100205432 | 276 |
| 201 | 3300025941 | Ga0207711_10003367 | Ga0207711_100033674 | 276 |
| 202 | 3300025941 | Ga0207711_10390130 | Ga0207711_103901302 | 276 |
| 203 | 3300025944 | Ga0207661_10346787 | Ga0207661_103467872 | 276 |
| 204 | 3300026035 | Ga0207703_10612983 | Ga0207703_106129831 | 276 |
| 205 | 3300026088 | Ga0207641_10284515 | Ga0207641_102845152 | 276 |
| 206 | 3300026095 | Ga0207676_10034428 | Ga0207676_100344282 | 276 |
| 207 | 3300028023 | Ga0265357_1000526 | Ga0265357_10005262 | 276 |
| 208 | 3300028379 | Ga0268266_10623664 | Ga0268266_106236641 | 276 |
| 209 | 3300028800 | Ga0265338_10010460 | Ga0265338_100104605 | 276 |
| 210 | 3300030878 | Ga0265770_1020447 | Ga0265770_10204471 | 276 |
| 211 | 3300031090 | Ga0265760_10029890 | Ga0265760_100298902 | 276 |
| 212 | 3300031247 | Ga0265340_10009578 | Ga0265340_100095782 | 276 |
| 213 | 3300031249 | Ga0265339_10000133 | Ga0265339_1000013333 | 276 |
| 214 | 3300031595 | Ga0265313_10000491 | Ga0265313_1000049123 | 276 |
| 215 | 3300034957 | Ga0373938_0021761 | Ga0373938_0021761_330_1163 | 276 |
| 216 | 3300035084 | Ga0373928_0021523 | Ga0373928_0021523_376_1209 | 276 |
| 217 | 3300035112 | Ga0373932_0014144 | Ga0373932_0014144_866_1699 | 276 |
| 218 | 3300035170 | Ga0373943_0074089 | Ga0373943_0074089_581_1417 | 276 |
| 219 | 3300035691 | Ga0373931_0002197 | Ga0373931_0002197_5799_6632 | 276 |
| 220 | 3300035691 | Ga0373931_0161493 | Ga0373931_0161493_204_1037 | 276 |
| 221 | 3300035692 | Ga0373935_0045529 | Ga0373935_0045529_73_909 | 276 |
| 222 | 3300035695 | Ga0373927_0010461 | Ga0373927_0010461_5041_5877 | 276 |
| 223 | 3300035695 | Ga0373927_0017168 | Ga0373927_0017168_2655_3488 | 276 |
| 224 | 3300035695 | Ga0373927_0017198 | Ga0373927_0017198_2323_3159 | 276 |
| 225 | 3300035695 | Ga0373927_0205603 | Ga0373927_0205603_205_1041 | 276 |
| 226 | 3300035695 | Ga0373927_0229033 | Ga0373927_0229033_143_976 | 276 |
| 227 | 3300035725 | Ga0373947_0101560 | Ga0373947_0101560_930_1766 | 276 |
| 228 | 3300035725 | Ga0373947_0138367 | Ga0373947_0138367_363_1196 | 276 |
| 229 | 3300037068 | Ga0373925_0040893 | Ga0373925_0040893_535_1371 | 276 |
| 230 | 3300037068 | Ga0373925_0164119 | Ga0373925_0164119_806_1639 | 276 |
| 231 | 3300037068 | Ga0373925_0182167 | Ga0373925_0182167_583_1416 | 276 |
| 232 | 3300044684 | Ga0466966_0254947 | Ga0466966_0254947_83_1045 | 276 |
| 233 | 3300044694 | Ga0466963_0161058 | Ga0466963_0161058_521_1483 | 276 |
| 234 | 3300044842 | Ga0466957_0043673 | Ga0466957_0043673_530_1492 | 276 |
| 235 | 3300045049 | Ga0466959_0125017 | Ga0466959_0125017_129_1091 | 276 |
| 236 | 3300046454 | Ga0495592_0082174 | Ga0495592_0082174_541_1374 | 276 |
| 237 | 3300046459 | Ga0495629_0103854 | Ga0495629_0103854_1045_1881 | 276 |
| 238 | 3300046463 | Ga0495653_0047651 | Ga0495653_0047651_1098_1934 | 276 |
| 239 | 3300046476 | Ga0495662_0004951 | Ga0495662_0004951_4306_5142 | 276 |
| 240 | 3300046477 | Ga0495664_0000375 | Ga0495664_0000375_16830_17666 | 276 |
| 241 | 3300046514 | Ga0495618_0004650 | Ga0495618_0004650_776_1612 | 276 |
| 242 | 3300046516 | Ga0495628_0080850 | Ga0495628_0080850_319_1152 | 276 |
| 243 | 3300046517 | Ga0495630_0017955 | Ga0495630_0017955_1934_2770 | 276 |
| 244 | 3300046526 | Ga0495666_0091424 | Ga0495666_0091424_458_1291 | 276 |
| 245 | 3300046529 | Ga0495652_0040209 | Ga0495652_0040209_1858_2694 | 276 |
| 246 | 3300046531 | Ga0495665_0107591 | Ga0495665_0107591_566_1399 | 276 |
| 247 | 3300046533 | Ga0495640_0006783 | Ga0495640_0006783_5662_6498 | 276 |
| 248 | 3300046533 | Ga0495640_0158241 | Ga0495640_0158241_328_1164 | 276 |
| 249 | 3300046535 | Ga0495586_0084897 | Ga0495586_0084897_177_1013 | 276 |
| 250 | 3300046536 | Ga0495587_0196043 | Ga0495587_0196043_286_1119 | 276 |
| 251 | 3300046543 | Ga0495645_0012230 | Ga0495645_0012230_2277_3113 | 276 |
| 252 | 3300046663 | Ga0495635_0022667 | Ga0495635_0022667_2846_3682 | 276 |
| 253 | 3300046663 | Ga0495635_0024750 | Ga0495635_0024750_2389_3225 | 276 |
| 254 | 3300046680 | Ga0495646_0122495 | Ga0495646_0122495_285_1121 | 276 |
| 255 | 3300046683 | Ga0495658_0114725 | Ga0495658_0114725_170_1003 | 276 |
| 256 | 3300046689 | Ga0495613_0073747 | Ga0495613_0073747_1604_2440 | 276 |
| 257 | 3300046690 | Ga0495624_0034192 | Ga0495624_0034192_1539_2375 | 276 |
| 258 | 3300047315 | Ga0495581_0061810 | Ga0495581_0061810_572_1408 | 276 |
| 259 | 3300047315 | Ga0495581_0174679 | Ga0495581_0174679_348_1241 | 276 |
| 260 | 3300047319 | Ga0495674_0026624 | Ga0495674_0026624_3585_4421 | 276 |
| 261 | 3300047319 | Ga0495674_0234323 | Ga0495674_0234323_373_1209 | 276 |
| 262 | 3300047471 | Ga0495684_0002950 | Ga0495684_0002950_2886_3722 | 276 |
| 263 | 3300047471 | Ga0495684_0025573 | Ga0495684_0025573_1381_2274 | 276 |
| 264 | 3300048903 | Ga0496100_0001551 | Ga0496100_0001551_1260_2093 | 276 |
| 265 | 3300048904 | Ga0496101_0001012 | Ga0496101_0001012_12551_13384 | 276 |
| 266 | 3300048904 | Ga0496101_0033510 | Ga0496101_0033510_1761_2594 | 276 |
| 267 | 3300048905 | Ga0496102_0033538 | Ga0496102_0033538_2401_3234 | 276 |
| 268 | 3300048905 | Ga0496102_0073679 | Ga0496102_0073679_49_882 | 276 |
| 269 | 3300048907 | Ga0496104_0001756 | Ga0496104_0001756_15660_16493 | 276 |
| 270 | 3300048907 | Ga0496104_0098229 | Ga0496104_0098229_235_1068 | 276 |
| 271 | 3300048908 | Ga0496105_0019711 | Ga0496105_0019711_1649_2482 | 276 |
| 272 | 3300048908 | Ga0496105_0192272 | Ga0496105_0192272_258_1091 | 276 |
| 273 | 3300048909 | Ga0496106_0014871 | Ga0496106_0014871_651_1484 | 276 |
| 274 | 3300048910 | Ga0496107_0065946 | Ga0496107_0065946_1215_2048 | 276 |
| 275 | 3300048911 | Ga0496108_0002891 | Ga0496108_0002891_11675_12508 | 276 |
| 276 | 3300048912 | Ga0496109_0036314 | Ga0496109_0036314_1958_2791 | 276 |
| 277 | 3300048913 | Ga0496110_0024942 | Ga0496110_0024942_4169_5002 | 276 |
| 278 | 3300048913 | Ga0496110_0131951 | Ga0496110_0131951_934_1770 | 276 |
| 279 | 3300048914 | Ga0496111_0096207 | Ga0496111_0096207_243_1076 | 276 |
| 280 | 3300048914 | Ga0496111_0149255 | Ga0496111_0149255_265_1098 | 276 |
| 281 | 3300048915 | Ga0496112_0102058 | Ga0496112_0102058_560_1393 | 276 |
| 282 | 3300048915 | Ga0496112_0165948 | Ga0496112_0165948_183_1016 | 276 |
| 283 | 3300048916 | Ga0496113_0175849 | Ga0496113_0175849_716_1549 | 276 |
| 284 | 3300048917 | Ga0496114_0032157 | Ga0496114_0032157_320_1153 | 276 |
| 285 | 3300048918 | Ga0496115_0054644 | Ga0496115_0054644_886_1734 | 276 |
| 286 | 3300048918 | Ga0496115_0072173 | Ga0496115_0072173_479_1312 | 276 |
| 287 | 3300049573 | Ga0501037_0420029 | Ga0501037_0420029_52_903 | 276 |
| 288 | 3300049581 | Ga0501047_0140762 | Ga0501047_0140762_74_925 | 276 |
| 289 | 3300049586 | Ga0501070_0050832 | Ga0501070_0050832_2310_3161 | 276 |
| 290 | 3300049589 | Ga0501073_0288328 | Ga0501073_0288328_37_885 | 276 |
| 291 | 3300049823 | Ga0501044_0389579 | Ga0501044_0389579_237_1088 | 276 |
| 292 | 3300050494 | nmdc:mga06z11_309953_c1 | nmdc:mga06z11_309953_c1_93_926 | 276 |
| 293 | 3300050511 | nmdc:mga08y16_36613_c1 | nmdc:mga08y16_36613_c1_2359_3192 | 276 |
| 294 | 3300050512 | nmdc:mga0n895_512431_c1 | nmdc:mga0n895_512431_c1_259_1092 | 276 |
| 295 | 3300050515 | nmdc:mga0a205_81197_c1 | nmdc:mga0a205_81197_c1_1509_2342 | 276 |
| 296 | 3300053077 | Ga0495601_0024234 | Ga0495601_0024234_1711_2544 | 276 |
| 297 | 3300053078 | Ga0495612_0000697 | Ga0495612_0000697_6065_6901 | 276 |
| 298 | 3300053085 | Ga0495619_0018329 | Ga0495619_0018329_2496_3332 | 276 |
| 299 | 3300053085 | Ga0495619_0055176 | Ga0495619_0055176_107_940 | 276 |
| 300 | 3300053085 | Ga0495619_0061884 | Ga0495619_0061884_226_1119 | 276 |
| 301 | 3300053085 | Ga0495619_0274712 | Ga0495619_0274712_164_1000 | 276 |
| 302 | 2162886007 | SwRhRL2b_contig_1831614 | SwRhRL2b_0257.00004640 | 277 |
| 303 | 2209111006 | 2214544920 | 2213593397 | 277 |
| 304 | 3300000041 | ARcpr5oldR_c000395 | ARcpr5oldR_0003953 | 277 |
| 305 | 3300000042 | ARSoilYngRDRAFT_c00032 | ARSoilYngRDRAFT_0003212 | 277 |
| 306 | 3300000043 | ARcpr5yngRDRAFT_c000061 | ARcpr5yngRDRAFT_0000614 | 277 |
| 307 | 3300000044 | ARSoilOldRDRAFT_c000136 | ARSoilOldRDRAFT_00013612 | 277 |
| 308 | 3300000045 | ARCol0oldRDRAFT_c00446 | ARCol0oldRDRAFT_004464 | 277 |
| 309 | 3300000652 | ARCol0yngRDRAFT_1000139 | ARCol0yngRDRAFT_100013912 | 277 |
| 310 | 3300001976 | JGI24752J21851_1012071 | JGI24752J21851_10120712 | 277 |
| 311 | 3300001991 | JGI24743J22301_10007812 | JGI24743J22301_100078123 | 277 |
| 312 | 3300002077 | JGI24744J21845_10006076 | JGI24744J21845_100060762 | 277 |
| 313 | 3300002239 | JGI24034J26672_10009452 | JGI24034J26672_100094521 | 277 |
| 314 | 3300003323 | rootH1_10356764 | rootH1_103567642 | 277 |
| 315 | 3300005277 | Ga0065716_1001581 | Ga0065716_10015813 | 277 |
| 316 | 3300005289 | Ga0065704_10080762 | Ga0065704_100807624 | 277 |
| 317 | 3300005295 | Ga0065707_10121940 | Ga0065707_101219401 | 277 |
| 318 | 3300005328 | Ga0070676_10044243 | Ga0070676_100442431 | 277 |
| 319 | 3300005329 | Ga0070683_100039525 | Ga0070683_1000395251 | 277 |
| 320 | 3300005330 | Ga0070690_100036744 | Ga0070690_1000367443 | 277 |
| 321 | 3300005331 | Ga0070670_100178055 | Ga0070670_1001780552 | 277 |
| 322 | 3300005337 | Ga0070682_100187077 | Ga0070682_1001870771 | 277 |
| 323 | 3300005338 | Ga0068868_100201031 | Ga0068868_1002010311 | 277 |
| 324 | 3300005339 | Ga0070660_100135248 | Ga0070660_1001352482 | 277 |
| 325 | 3300005340 | Ga0070689_100136274 | Ga0070689_1001362742 | 277 |
| 326 | 3300005343 | Ga0070687_100021169 | Ga0070687_1000211692 | 277 |
| 327 | 3300005345 | Ga0070692_10044090 | Ga0070692_100440902 | 277 |
| 328 | 3300005347 | Ga0070668_100137467 | Ga0070668_1001374672 | 277 |
| 329 | 3300005353 | Ga0070669_100163818 | Ga0070669_1001638182 | 277 |
| 330 | 3300005354 | Ga0070675_100230920 | Ga0070675_1002309202 | 277 |
| 331 | 3300005364 | Ga0070673_100024556 | Ga0070673_1000245561 | 277 |
| 332 | 3300005366 | Ga0070659_100037562 | Ga0070659_1000375622 | 277 |
| 333 | 3300005366 | Ga0070659_100220380 | Ga0070659_1002203802 | 277 |
| 334 | 3300005367 | Ga0070667_100297621 | Ga0070667_1002976212 | 277 |
| 335 | 3300005434 | Ga0070709_10051784 | Ga0070709_100517843 | 277 |
| 336 | 3300005434 | Ga0070709_10228144 | Ga0070709_102281442 | 277 |
| 337 | 3300005438 | Ga0070701_10083067 | Ga0070701_100830671 | 277 |
| 338 | 3300005439 | Ga0070711_100036661 | Ga0070711_1000366612 | 277 |
| 339 | 3300005439 | Ga0070711_100196436 | Ga0070711_1001964362 | 277 |
| 340 | 3300005441 | Ga0070700_100045009 | Ga0070700_1000450092 | 277 |
| 341 | 3300005455 | Ga0070663_100191118 | Ga0070663_1001911182 | 277 |
| 342 | 3300005456 | Ga0070678_100241562 | Ga0070678_1002415622 | 277 |
| 343 | 3300005457 | Ga0070662_100055926 | Ga0070662_1000559264 | 277 |
| 344 | 3300005457 | Ga0070662_100132786 | Ga0070662_1001327862 | 277 |
| 345 | 3300005459 | Ga0068867_100065507 | Ga0068867_1000655072 | 277 |
| 346 | 3300005459 | Ga0068867_100110735 | Ga0068867_1001107352 | 277 |
| 347 | 3300005466 | Ga0070685_10041462 | Ga0070685_100414622 | 277 |
| 348 | 3300005466 | Ga0070685_10062402 | Ga0070685_100624023 | 277 |
| 349 | 3300005466 | Ga0070685_10385623 | Ga0070685_103856231 | 277 |
| 350 | 3300005518 | Ga0070699_100012813 | Ga0070699_1000128132 | 277 |
| 351 | 3300005518 | Ga0070699_100185807 | Ga0070699_1001858072 | 277 |
| 352 | 3300005539 | Ga0068853_100199266 | Ga0068853_1001992662 | 277 |
| 353 | 3300005543 | Ga0070672_100407901 | Ga0070672_1004079012 | 277 |
| 354 | 3300005544 | Ga0070686_100149468 | Ga0070686_1001494682 | 277 |
| 355 | 3300005549 | Ga0070704_100101533 | Ga0070704_1001015333 | 277 |
| 356 | 3300005549 | Ga0070704_100194567 | Ga0070704_1001945671 | 277 |
| 357 | 3300005564 | Ga0070664_100148659 | Ga0070664_1001486592 | 277 |
| 358 | 3300005577 | Ga0068857_100281175 | Ga0068857_1002811752 | 277 |
| 359 | 3300005578 | Ga0068854_100390104 | Ga0068854_1003901041 | 277 |
| 360 | 3300005614 | Ga0068856_100114199 | Ga0068856_1001141991 | 277 |
| 361 | 3300005617 | Ga0068859_100080058 | Ga0068859_1000800585 | 277 |
| 362 | 3300005618 | Ga0068864_100084336 | Ga0068864_1000843362 | 277 |
| 363 | 3300005834 | Ga0068851_10121712 | Ga0068851_101217121 | 277 |
| 364 | 3300005841 | Ga0068863_100156520 | Ga0068863_1001565202 | 277 |
| 365 | 3300005842 | Ga0068858_100036593 | Ga0068858_1000365933 | 277 |
| 366 | 3300005842 | Ga0068858_100092607 | Ga0068858_1000926073 | 277 |
| 367 | 3300005842 | Ga0068858_100123637 | Ga0068858_1001236372 | 277 |
| 368 | 3300005843 | Ga0068860_100181946 | Ga0068860_1001819463 | 277 |
| 369 | 3300005844 | Ga0068862_100074065 | Ga0068862_1000740653 | 277 |
| 370 | 3300005937 | Ga0081455_10001860 | Ga0081455_100018602 | 277 |
| 371 | 3300005937 | Ga0081455_10010994 | Ga0081455_100109944 | 277 |
| 372 | 3300005937 | Ga0081455_10187941 | Ga0081455_101879412 | 277 |
| 373 | 3300005983 | Ga0081540_1009789 | Ga0081540_10097898 | 277 |
| 374 | 3300006038 | Ga0075365_10011942 | Ga0075365_100119422 | 277 |
| 375 | 3300006038 | Ga0075365_10038703 | Ga0075365_100387034 | 277 |
| 376 | 3300006038 | Ga0075365_10104603 | Ga0075365_101046032 | 277 |
| 377 | 3300006163 | Ga0070715_10109261 | Ga0070715_101092612 | 277 |
| 378 | 3300006175 | Ga0070712_100025865 | Ga0070712_1000258652 | 277 |
| 379 | 3300006175 | Ga0070712_100203881 | Ga0070712_1002038812 | 277 |
| 380 | 3300006178 | Ga0075367_10055853 | Ga0075367_100558531 | 277 |
| 381 | 3300006178 | Ga0075367_10148416 | Ga0075367_101484162 | 277 |
| 382 | 3300006844 | Ga0075428_100030815 | Ga0075428_1000308154 | 277 |
| 383 | 3300006846 | Ga0075430_100128605 | Ga0075430_1001286052 | 277 |
| 384 | 3300006847 | Ga0075431_100170064 | Ga0075431_1001700643 | 277 |
| 385 | 3300006847 | Ga0075431_100207312 | Ga0075431_1002073121 | 277 |
| 386 | 3300006852 | Ga0075433_10117018 | Ga0075433_101170181 | 277 |
| 387 | 3300006871 | Ga0075434_100005301 | Ga0075434_1000053011 | 277 |
| 388 | 3300006880 | Ga0075429_100169660 | Ga0075429_1001696602 | 277 |
| 389 | 3300006914 | Ga0075436_100131530 | Ga0075436_1001315302 | 277 |
| 390 | 3300006931 | Ga0097620_100080058 | Ga0097620_1000800582 | 277 |
| 391 | 3300007265 | Ga0099794_10007525 | Ga0099794_100075253 | 277 |
| 392 | 3300007265 | Ga0099794_10084631 | Ga0099794_100846311 | 277 |
| 393 | 3300009094 | Ga0111539_10005693 | Ga0111539_100056933 | 277 |
| 394 | 3300009098 | Ga0105245_10074900 | Ga0105245_100749002 | 277 |
| 395 | 3300009147 | Ga0114129_10024961 | Ga0114129_100249614 | 277 |
| 396 | 3300009147 | Ga0114129_10191202 | Ga0114129_101912021 | 277 |
| 397 | 3300009174 | Ga0105241_10321271 | Ga0105241_103212711 | 277 |
| 398 | 3300009176 | Ga0105242_10186229 | Ga0105242_101862292 | 277 |
| 399 | 3300009177 | Ga0105248_10183124 | Ga0105248_101831242 | 277 |
| 400 | 3300009545 | Ga0105237_10080387 | Ga0105237_100803872 | 277 |
| 401 | 3300009551 | Ga0105238_10327002 | Ga0105238_103270022 | 277 |
| 402 | 3300009553 | Ga0105249_10158485 | Ga0105249_101584853 | 277 |
| 403 | 3300009553 | Ga0105249_10537932 | Ga0105249_105379322 | 277 |
| 404 | 3300012476 | Ga0157344_1000470 | Ga0157344_10004703 | 277 |
| 405 | 3300012495 | Ga0157323_1003505 | Ga0157323_10035051 | 277 |
| 406 | 3300013100 | Ga0157373_10238475 | Ga0157373_102384751 | 277 |
| 407 | 3300013296 | Ga0157374_10567377 | Ga0157374_105673772 | 277 |
| 408 | 3300013306 | Ga0163162_10510694 | Ga0163162_105106942 | 277 |
| 409 | 3300013307 | Ga0157372_10296489 | Ga0157372_102964891 | 277 |
| 410 | 3300013307 | Ga0157372_10625198 | Ga0157372_106251982 | 277 |
| 411 | 3300014325 | Ga0163163_10188340 | Ga0163163_101883403 | 277 |
| 412 | 3300014326 | Ga0157380_10221660 | Ga0157380_102216602 | 277 |
| 413 | 3300014745 | Ga0157377_10061450 | Ga0157377_100614502 | 277 |
| 414 | 3300014969 | Ga0157376_10040052 | Ga0157376_100400521 | 277 |
| 415 | 3300017792 | Ga0163161_10093783 | Ga0163161_100937832 | 277 |
| 416 | 3300025321 | Ga0207656_10017789 | Ga0207656_100177892 | 277 |
| 417 | 3300025898 | Ga0207692_10315850 | Ga0207692_103158501 | 277 |
| 418 | 3300025900 | Ga0207710_10106633 | Ga0207710_101066331 | 277 |
| 419 | 3300025901 | Ga0207688_10022504 | Ga0207688_100225042 | 277 |
| 420 | 3300025904 | Ga0207647_10014286 | Ga0207647_100142862 | 277 |
| 421 | 3300025905 | Ga0207685_10067547 | Ga0207685_100675471 | 277 |
| 422 | 3300025906 | Ga0207699_10012929 | Ga0207699_100129293 | 277 |
| 423 | 3300025908 | Ga0207643_10000872 | Ga0207643_1000087213 | 277 |
| 424 | 3300025910 | Ga0207684_10158518 | Ga0207684_101585182 | 277 |
| 425 | 3300025912 | Ga0207707_10179340 | Ga0207707_101793402 | 277 |
| 426 | 3300025915 | Ga0207693_10038010 | Ga0207693_100380105 | 277 |
| 427 | 3300025915 | Ga0207693_10040307 | Ga0207693_100403075 | 277 |
| 428 | 3300025915 | Ga0207693_10077132 | Ga0207693_100771322 | 277 |
| 429 | 3300025916 | Ga0207663_10115023 | Ga0207663_101150232 | 277 |
| 430 | 3300025918 | Ga0207662_10007580 | Ga0207662_100075802 | 277 |
| 431 | 3300025919 | Ga0207657_10023526 | Ga0207657_100235264 | 277 |
| 432 | 3300025927 | Ga0207687_10396859 | Ga0207687_103968591 | 277 |
| 433 | 3300025928 | Ga0207700_10142650 | Ga0207700_101426502 | 277 |
| 434 | 3300025932 | Ga0207690_10242211 | Ga0207690_102422112 | 277 |
| 435 | 3300025933 | Ga0207706_10056684 | Ga0207706_100566845 | 277 |
| 436 | 3300025933 | Ga0207706_10272722 | Ga0207706_102727222 | 277 |
| 437 | 3300025934 | Ga0207686_10135763 | Ga0207686_101357632 | 277 |
| 438 | 3300025935 | Ga0207709_10320725 | Ga0207709_103207252 | 277 |
| 439 | 3300025936 | Ga0207670_10189690 | Ga0207670_101896902 | 277 |
| 440 | 3300025937 | Ga0207669_10046523 | Ga0207669_100465232 | 277 |
| 441 | 3300025938 | Ga0207704_10092037 | Ga0207704_100920372 | 277 |
| 442 | 3300025939 | Ga0207665_10006295 | Ga0207665_100062958 | 277 |
| 443 | 3300025939 | Ga0207665_10157812 | Ga0207665_101578122 | 277 |
| 444 | 3300025940 | Ga0207691_10007735 | Ga0207691_100077356 | 277 |
| 445 | 3300025945 | Ga0207679_10167690 | Ga0207679_101676902 | 277 |
| 446 | 3300025972 | Ga0207668_10028831 | Ga0207668_100288312 | 277 |
| 447 | 3300025986 | Ga0207658_10166521 | Ga0207658_101665212 | 277 |
| 448 | 3300026035 | Ga0207703_10210367 | Ga0207703_102103671 | 277 |
| 449 | 3300026041 | Ga0207639_10049286 | Ga0207639_100492862 | 277 |
| 450 | 3300026067 | Ga0207678_10005238 | Ga0207678_100052382 | 277 |
| 451 | 3300026075 | Ga0207708_10005514 | Ga0207708_100055146 | 277 |
| 452 | 3300026075 | Ga0207708_10059087 | Ga0207708_100590874 | 277 |
| 453 | 3300026089 | Ga0207648_10028821 | Ga0207648_100288212 | 277 |
| 454 | 3300026089 | Ga0207648_10117889 | Ga0207648_101178894 | 277 |
| 455 | 3300026116 | Ga0207674_10058822 | Ga0207674_100588225 | 277 |
| 456 | 3300026118 | Ga0207675_100035978 | Ga0207675_1000359783 | 277 |
| 457 | 3300026121 | Ga0207683_10051673 | Ga0207683_100516732 | 277 |
| 458 | 3300026142 | Ga0207698_10130895 | Ga0207698_101308952 | 277 |
| 459 | 3300027512 | Ga0209179_1008104 | Ga0209179_10081042 | 277 |
| 460 | 3300027907 | Ga0207428_10004567 | Ga0207428_100045673 | 277 |
| 461 | 3300027907 | Ga0207428_10173195 | Ga0207428_101731952 | 277 |
| 462 | 3300028379 | Ga0268266_10341305 | Ga0268266_103413052 | 277 |
| 463 | 3300028380 | Ga0268265_10070804 | Ga0268265_100708044 | 277 |
| 464 | 3300028380 | Ga0268265_10280953 | Ga0268265_102809531 | 277 |
| 465 | 3300028556 | Ga0265337_1001529 | Ga0265337_100152912 | 277 |
| 466 | 3300031241 | Ga0265325_10058454 | Ga0265325_100584543 | 277 |
| 467 | 3300031344 | Ga0265316_10191371 | Ga0265316_101913712 | 277 |
| 468 | 3300031728 | Ga0316578_10059481 | Ga0316578_100594812 | 277 |
| 469 | 3300034816 | Ga0373930_0000042 | Ga0373930_0000042_2735_3568 | 277 |
| 470 | 3300034817 | Ga0373948_0000129 | Ga0373948_0000129_624_1457 | 277 |
| 471 | 3300034818 | Ga0373950_0001254 | Ga0373950_0001254_675_1508 | 277 |
| 472 | 3300034957 | Ga0373938_0000030 | Ga0373938_0000030_663_1496 | 277 |
| 473 | 3300035083 | Ga0373926_0118501 | Ga0373926_0118501_46_882 | 277 |
| 474 | 3300035084 | Ga0373928_0000123 | Ga0373928_0000123_12954_13787 | 277 |
| 475 | 3300035085 | Ga0373929_0000703 | Ga0373929_0000703_108_941 | 277 |
| 476 | 3300035086 | Ga0373934_0017783 | Ga0373934_0017783_191_1027 | 277 |
| 477 | 3300035088 | Ga0373940_0000022 | Ga0373940_0000022_15675_16508 | 277 |
| 478 | 3300035089 | Ga0373944_0006259 | Ga0373944_0006259_1735_2571 | 277 |
| 479 | 3300035090 | Ga0373949_0000438 | Ga0373949_0000438_12816_13649 | 277 |
| 480 | 3300035091 | Ga0373951_0004506 | Ga0373951_0004506_1806_2639 | 277 |
| 481 | 3300035092 | Ga0373952_0000180 | Ga0373952_0000180_671_1504 | 277 |
| 482 | 3300035111 | Ga0373923_0121884 | Ga0373923_0121884_11_847 | 277 |
| 483 | 3300035112 | Ga0373932_0000683 | Ga0373932_0000683_8734_9567 | 277 |
| 484 | 3300035114 | Ga0373939_0000329 | Ga0373939_0000329_687_1520 | 277 |
| 485 | 3300035115 | Ga0373941_0000049 | Ga0373941_0000049_637_1470 | 277 |
| 486 | 3300035116 | Ga0373945_0005566 | Ga0373945_0005566_2253_3089 | 277 |
| 487 | 3300035119 | Ga0373956_0003856 | Ga0373956_0003856_2429_3265 | 277 |
| 488 | 3300035120 | Ga0373957_0017204 | Ga0373957_0017204_223_1059 | 277 |
| 489 | 3300035121 | Ga0373960_0000240 | Ga0373960_0000240_8715_9548 | 277 |
| 490 | 3300035170 | Ga0373943_0094098 | Ga0373943_0094098_680_1516 | 277 |
| 491 | 3300035171 | Ga0373946_0040899 | Ga0373946_0040899_960_1799 | 277 |
| 492 | 3300035241 | Ga0373961_0001448 | Ga0373961_0001448_687_1520 | 277 |
| 493 | 3300035242 | Ga0373962_0000637 | Ga0373962_0000637_674_1507 | 277 |
| 494 | 3300035398 | Ga0316574_0000202 | Ga0316574_0000202_6731_7570 | 277 |
| 495 | 3300035410 | Ga0373924_0003107 | Ga0373924_0003107_1007_1843 | 277 |
| 496 | 3300035691 | Ga0373931_0014415 | Ga0373931_0014415_2344_3177 | 277 |
| 497 | 3300035692 | Ga0373935_0025186 | Ga0373935_0025186_676_1512 | 277 |
| 498 | 3300035695 | Ga0373927_0048991 | Ga0373927_0048991_1189_2028 | 277 |
| 499 | 3300035724 | Ga0373933_0001345 | Ga0373933_0001345_5864_6700 | 277 |
| 500 | 3300035725 | Ga0373947_0020264 | Ga0373947_0020264_781_1617 | 277 |
| 501 | 3300035725 | Ga0373947_0181537 | Ga0373947_0181537_434_1273 | 277 |
| 502 | 3300036401 | Ga0373937_0008587 | Ga0373937_0008587_2574_3410 | 277 |
| 503 | 3300036712 | Ga0316584_0108806 | Ga0316584_0108806_776_1615 | 277 |
| 504 | 3300037068 | Ga0373925_0019319 | Ga0373925_0019319_3452_4288 | 277 |
| 505 | 3300037068 | Ga0373925_0099428 | Ga0373925_0099428_830_1666 | 277 |
| 506 | 3300037068 | Ga0373925_0463873 | Ga0373925_0463873_175_1011 | 277 |
| 507 | 3300037068 | Ga0373925_0500799 | Ga0373925_0500799_60_899 | 277 |
| 508 | 3300037853 | Ga0436364_1223108 | Ga0436364_1223108_2422_3264 | 277 |
| 509 | 3300039437 | Ga0436365_1676454 | Ga0436365_1676454_1341_2183 | 277 |
| 510 | 3300039438 | Ga0436360_0330917 | Ga0436360_0330917_1523_2368 | 277 |
| 511 | 3300039447 | Ga0436361_1044138 | Ga0436361_1044138_1603_2475 | 277 |
| 512 | 3300039450 | Ga0436363_1667002 | Ga0436363_1667002_75_923 | 277 |
| 513 | 3300044712 | Ga0453684_0106785 | Ga0453684_0106785_146_979 | 277 |
| 514 | 3300045051 | Ga0451576_0066990 | Ga0451576_0066990_687_1520 | 277 |
| 515 | 3300046462 | Ga0495651_0014205 | Ga0495651_0014205_1340_2176 | 277 |
| 516 | 3300046473 | Ga0495582_0089684 | Ga0495582_0089684_83_919 | 277 |
| 517 | 3300046473 | Ga0495582_0091039 | Ga0495582_0091039_24_860 | 277 |
| 518 | 3300046474 | Ga0495605_0076281 | Ga0495605_0076281_107_943 | 277 |
| 519 | 3300046491 | Ga0495584_0018615 | Ga0495584_0018615_40_876 | 277 |
| 520 | 3300046492 | Ga0495585_0138323 | Ga0495585_0138323_358_1254 | 277 |
| 521 | 3300046517 | Ga0495630_0036987 | Ga0495630_0036987_2799_3635 | 277 |
| 522 | 3300046525 | Ga0495663_0041205 | Ga0495663_0041205_14_850 | 277 |
| 523 | 3300046533 | Ga0495640_0159682 | Ga0495640_0159682_521_1360 | 277 |
| 524 | 3300046538 | Ga0495609_0145750 | Ga0495609_0145750_89_925 | 277 |
| 525 | 3300046558 | Ga0495633_0059262 | Ga0495633_0059262_941_1777 | 277 |
| 526 | 3300046559 | Ga0495667_0060226 | Ga0495667_0060226_463_1299 | 277 |
| 527 | 3300046559 | Ga0495667_0179533 | Ga0495667_0179533_102_938 | 277 |
| 528 | 3300046616 | Ga0495668_0166948 | Ga0495668_0166948_53_949 | 277 |
| 529 | 3300046642 | Ga0495634_0094839 | Ga0495634_0094839_1048_1884 | 277 |
| 530 | 3300046642 | Ga0495634_0224304 | Ga0495634_0224304_308_1147 | 277 |
| 531 | 3300046675 | Ga0495657_0015918 | Ga0495657_0015918_3640_4476 | 277 |
| 532 | 3300046679 | Ga0495623_0025557 | Ga0495623_0025557_2798_3634 | 277 |
| 533 | 3300046681 | Ga0495647_0030190 | Ga0495647_0030190_990_1826 | 277 |
| 534 | 3300046683 | Ga0495658_0106054 | Ga0495658_0106054_828_1664 | 277 |
| 535 | 3300046683 | Ga0495658_0192531 | Ga0495658_0192531_46_882 | 277 |
| 536 | 3300046684 | Ga0495669_0135910 | Ga0495669_0135910_292_1146 | 277 |
| 537 | 3300046689 | Ga0495613_0183065 | Ga0495613_0183065_44_880 | 277 |
| 538 | 3300046691 | Ga0495670_0065940 | Ga0495670_0065940_252_1088 | 277 |
| 539 | 3300046694 | Ga0495649_0058802 | Ga0495649_0058802_234_1130 | 277 |
| 540 | 3300047315 | Ga0495581_0057301 | Ga0495581_0057301_504_1340 | 277 |
| 541 | 3300047319 | Ga0495674_0205843 | Ga0495674_0205843_235_1071 | 277 |
| 542 | 3300047321 | Ga0495676_0059847 | Ga0495676_0059847_493_1329 | 277 |
| 543 | 3300047322 | Ga0495680_0292774 | Ga0495680_0292774_286_1122 | 277 |
| 544 | 3300048088 | Ga0495602_0006017 | Ga0495602_0006017_3977_4813 | 277 |
| 545 | 3300048904 | Ga0496101_0391724 | Ga0496101_0391724_238_1074 | 277 |
| 546 | 3300048905 | Ga0496102_0062761 | Ga0496102_0062761_1769_2605 | 277 |
| 547 | 3300048905 | Ga0496102_0094133 | Ga0496102_0094133_613_1446 | 277 |
| 548 | 3300048905 | Ga0496102_0146468 | Ga0496102_0146468_250_1086 | 277 |
| 549 | 3300048905 | Ga0496102_0173890 | Ga0496102_0173890_313_1167 | 277 |
| 550 | 3300048906 | Ga0496103_0091513 | Ga0496103_0091513_799_1695 | 277 |
| 551 | 3300048906 | Ga0496103_0363260 | Ga0496103_0363260_24_860 | 277 |
| 552 | 3300048907 | Ga0496104_0000629 | Ga0496104_0000629_20138_20983 | 277 |
| 553 | 3300048908 | Ga0496105_0001322 | Ga0496105_0001322_2249_3085 | 277 |
| 554 | 3300048908 | Ga0496105_0040140 | Ga0496105_0040140_731_1627 | 277 |
| 555 | 3300048908 | Ga0496105_0335131 | Ga0496105_0335131_304_1149 | 277 |
| 556 | 3300048909 | Ga0496106_0022634 | Ga0496106_0022634_902_1798 | 277 |
| 557 | 3300048909 | Ga0496106_0077696 | Ga0496106_0077696_1089_1934 | 277 |
| 558 | 3300048909 | Ga0496106_0099112 | Ga0496106_0099112_689_1525 | 277 |
| 559 | 3300048909 | Ga0496106_0297069 | Ga0496106_0297069_365_1204 | 277 |
| 560 | 3300048910 | Ga0496107_0244389 | Ga0496107_0244389_206_1102 | 277 |
| 561 | 3300048911 | Ga0496108_0009174 | Ga0496108_0009174_3057_3893 | 277 |
| 562 | 3300048911 | Ga0496108_0211421 | Ga0496108_0211421_421_1260 | 277 |
| 563 | 3300048912 | Ga0496109_0002809 | Ga0496109_0002809_5511_6347 | 277 |
| 564 | 3300048912 | Ga0496109_0145202 | Ga0496109_0145202_727_1623 | 277 |
| 565 | 3300048913 | Ga0496110_0042460 | Ga0496110_0042460_156_998 | 277 |
| 566 | 3300048914 | Ga0496111_0030271 | Ga0496111_0030271_2370_3206 | 277 |
| 567 | 3300048915 | Ga0496112_0009460 | Ga0496112_0009460_2437_3273 | 277 |
| 568 | 3300048915 | Ga0496112_0154440 | Ga0496112_0154440_445_1341 | 277 |
| 569 | 3300048916 | Ga0496113_0072484 | Ga0496113_0072484_784_1680 | 277 |
| 570 | 3300048917 | Ga0496114_0075244 | Ga0496114_0075244_900_1742 | 277 |
| 571 | 3300048917 | Ga0496114_0088863 | Ga0496114_0088863_1183_2079 | 277 |
| 572 | 3300048918 | Ga0496115_0025523 | Ga0496115_0025523_704_1600 | 277 |
| 573 | 3300048918 | Ga0496115_0100877 | Ga0496115_0100877_865_1701 | 277 |
| 574 | 3300048918 | Ga0496115_0293449 | Ga0496115_0293449_432_1277 | 277 |
| 575 | 3300049588 | Ga0501072_0251235 | Ga0501072_0251235_445_1284 | 277 |
| 576 | 3300049591 | Ga0501075_0023405 | Ga0501075_0023405_1714_2553 | 277 |
| 577 | 3300049593 | Ga0501077_0014216 | Ga0501077_0014216_2882_3721 | 277 |
| 578 | 3300049743 | Ga0501081_0003438 | Ga0501081_0003438_984_1823 | 277 |
| 579 | 3300050489 | nmdc:mga03683_40001_c1 | nmdc:mga03683_40001_c1_80_916 | 277 |
| 580 | 3300050492 | nmdc:mga0yw44_918_c1 | nmdc:mga0yw44_918_c1_6151_6987 | 277 |
| 581 | 3300050494 | nmdc:mga06z11_38348_c1 | nmdc:mga06z11_38348_c1_941_1777 | 277 |
| 582 | 3300050507 | nmdc:mga05p37_25897_c1 | nmdc:mga05p37_25897_c1_853_1689 | 277 |
| 583 | 3300050507 | nmdc:mga05p37_64007_c1 | nmdc:mga05p37_64007_c1_1155_1991 | 277 |
| 584 | 3300050508 | nmdc:mga09592_118300_c1 | nmdc:mga09592_118300_c1_1156_1992 | 277 |
| 585 | 3300050510 | nmdc:mga06r32_165598_c2 | nmdc:mga06r32_165598_c2_621_1457 | 277 |
| 586 | 3300050510 | nmdc:mga06r32_70468_c1 | nmdc:mga06r32_70468_c1_416_1252 | 277 |
| 587 | 3300050511 | nmdc:mga08y16_15633_c1 | nmdc:mga08y16_15633_c1_6463_7296 | 277 |
| 588 | 3300050513 | nmdc:mga0rr50_440609_c1 | nmdc:mga0rr50_440609_c1_73_909 | 277 |
| 589 | 3300050515 | nmdc:mga0a205_31909_c1 | nmdc:mga0a205_31909_c1_37_870 | 277 |
| 590 | 3300053077 | Ga0495601_0008245 | Ga0495601_0008245_444_1337 | 277 |
| 591 | 3300053077 | Ga0495601_0121364 | Ga0495601_0121364_682_1518 | 277 |
| 592 | 3300053078 | Ga0495612_0009258 | Ga0495612_0009258_1711_2547 | 277 |
| 593 | 3300053078 | Ga0495612_0168114 | Ga0495612_0168114_39_932 | 277 |
| 594 | 3300053084 | Ga0495595_0000714 | Ga0495595_0000714_11777_12613 | 277 |
| 595 | 3300053085 | Ga0495619_0009180 | Ga0495619_0009180_969_1805 | 277 |
| 596 | 3300054114 | Ga0501084_0032380 | Ga0501084_0032380_352_1191 | 277 |
| 597 | 3300060353 | Ga0501082_0150963 | Ga0501082_0150963_540_1379 | 277 |
| 598 | 3300060353 | Ga0501082_0262109 | Ga0501082_0262109_24_860 | 277 |
| 599 | 3300060353 | Ga0501082_0309010 | Ga0501082_0309010_375_1211 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v4c-assembly3.cif.gz_F | crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici | 0.9583 | 1 | 277 |
| 4v4c-assembly3.cif.gz_F | crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici | 0.9549 | 1 | 277 |
| 2vpw-assembly1.cif.gz_F | polysulfide reductase with bound menaquinone | 0.8773 | 1 | 188 |
| 4zjh-assembly1.cif.gz_A | crystal structure of native alpha-2-macroglobulin from escherichia coli spanning domains nie-mg1. | 0.8669 | 210 | 262 |
| 5ch7-assembly1.cif.gz_B | crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps | 0.8434 | 2 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vldX02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9662 | 71 | 127 | 3.30.70.20 |
| 1vldX02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9502 | 71 | 127 | 3.30.70.20 |
| 1ti2D01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9442 | 1 | 188 | 3.30.70.20 |
| 1ti2B03 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9433 | 189 | 277 | 2.60.40.10 |
| 1ti2D01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9374 | 1 | 188 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A244DU35-F1-model_v4 | deleted | 0.9905 | 194 | 277 |
|
| AF-A0A7C7BRX5-F1-model_v4 | Oxidoreductase | 0.9853 | 1 | 277 |
GO:0051539
|
| AF-A0A524HNG6-F1-model_v4 | Oxidoreductase | 0.9851 | 1 | 187 |
GO:0051539
|
| AF-A0A7C7Y7J7-F1-model_v4 | Oxidoreductase | 0.985 | 1 | 277 |
GO:0051539
|
| AF-A0A2S6TBT0-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9848 | 24 | 277 |
GO:0051539
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar