F467863

General Info

Members Datasets Scaffolds Average Seq Length
599 269 1198 132

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10068558|Ga0105248_100685585
Length 155
Sequence MLDAAGITNRKDAALQFGSGGIFMRLRMMAMTLGLLAGTAPFLLAHHSFVAEYDANQPVKVTGVVTRVEWQNPHIWFFVDVKDAQGKVTNWGFSGGPPGVLQRRGISRNALKTGDTVVVEGFRARDGSNNASGGKVTFPDGRSVFTASNEDRAPQ

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
194 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
254 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2
Rhizosphere 97.33
Stem 0
Stem Tuber 0
Unclassified 33.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10068558 3300009177 Unclassified 3982
2 ARcpr5oldR_c029632 3300000041 Bacteria 511
3 ARcpr5yngRDRAFT_c013008 3300000043 Bacteria 700
4 ARCol0yngRDRAFT_1007756 3300000652 Bacteria 773
5 JGI24746J21847_1005952 3300001977 Unclassified 1896
6 JGI24035J26624_1005684 3300002126 Unclassified 1196
7 JGI24035J26624_1008812 3300002126 Bacteria 989
8 JGI24033J26618_1026270 3300002155 Unclassified 766
9 JGI24034J26672_10070424 3300002239 Bacteria 626
10 Ga0058859_11699449 3300004798 Bacteria 1181
11 Ga0065714_10297954 3300005288 Bacteria 698
12 Ga0065714_10305714 3300005288 Bacteria 688
13 Ga0065712_10021745 3300005290 Bacteria 1310
14 Ga0065712_10248133 3300005290 Unclassified 966
15 Ga0065715_10003799 3300005293 Bacteria 4941
16 Ga0065715_10036177 3300005293 Bacteria 1841
17 Ga0065707_10011772 3300005295 Unclassified 4141
18 Ga0065707_10145540 3300005295 Bacteria 1718
19 Ga0065707_10206161 3300005295 Unclassified 1287
20 Ga0065707_10484051 3300005295 Bacteria 771
21 Ga0070676_10017028 3300005328 Bacteria 4018
22 Ga0070676_10152636 3300005328 Bacteria 1480
23 Ga0070676_11031114 3300005328 Unclassified 619
24 Ga0070690_100047748 3300005330 Bacteria 2724
25 Ga0070690_100124957 3300005330 Bacteria 1731
26 Ga0070670_100047752 3300005331 Unclassified 3684
27 Ga0070670_100153087 3300005331 Bacteria 1996
28 Ga0070677_10002034 3300005333 Bacteria 6434
29 Ga0070677_10017353 3300005333 Bacteria 2576
30 Ga0070677_10044211 3300005333 Unclassified 1771
31 Ga0068869_100178652 3300005334 Unclassified 1663
32 Ga0068869_100225076 3300005334 Unclassified 1488
33 Ga0068869_100318550 3300005334 Unclassified 1261
34 Ga0068869_100403092 3300005334 Unclassified 1125
35 Ga0070666_10066435 3300005335 Bacteria 2447
36 Ga0070666_10067640 3300005335 Bacteria 2426
37 Ga0070666_10485534 3300005335 Unclassified 895
38 Ga0070666_10535298 3300005335 Bacteria 851
39 Ga0070680_101704242 3300005336 Bacteria 546
40 Ga0070682_100282210 3300005337 Bacteria 1211
41 Ga0068868_100014260 3300005338 Bacteria 5854
42 Ga0068868_100363411 3300005338 Bacteria 1242
43 Ga0068868_100596209 3300005338 Unclassified 978
44 Ga0068868_100770104 3300005338 Bacteria 866
45 Ga0070689_100027446 3300005340 Bacteria 4292
46 Ga0070689_100265449 3300005340 Bacteria 1420
47 Ga0070689_100320760 3300005340 Bacteria 1294
48 Ga0070691_10454690 3300005341 Unclassified 732
49 Ga0070687_100009248 3300005343 Bacteria 4214
50 Ga0070687_100366609 3300005343 Unclassified 934
51 Ga0070687_100370299 3300005343 Unclassified 930
52 Ga0070661_100018892 3300005344 Bacteria 4908
53 Ga0070668_100038692 3300005347 Bacteria 3647
54 Ga0070669_100002813 3300005353 Bacteria 12560
55 Ga0070669_100075452 3300005353 Bacteria 2501
56 Ga0070669_100658290 3300005353 Bacteria 881
57 Ga0070669_101101943 3300005353 Unclassified 684
58 Ga0070675_100039204 3300005354 Unclassified 3865
59 Ga0070675_100100569 3300005354 Unclassified 2435
60 Ga0070675_100125050 3300005354 Bacteria 2187
61 Ga0070675_100163207 3300005354 Unclassified 1917
62 Ga0070675_100203574 3300005354 Unclassified 1718
63 Ga0070675_100470026 3300005354 Bacteria 1130
64 Ga0070671_100024792 3300005355 Bacteria 4914
65 Ga0070674_100001211 3300005356 Bacteria 13530
66 Ga0070674_100115083 3300005356 Unclassified 1982
67 Ga0070674_100326463 3300005356 Bacteria 1232
68 Ga0070673_100012564 3300005364 Bacteria 5817
69 Ga0070673_100021523 3300005364 Unclassified 4677
70 Ga0070673_100091838 3300005364 Bacteria 2482
71 Ga0070673_100235379 3300005364 Unclassified 1590
72 Ga0070673_100475705 3300005364 Unclassified 1127
73 Ga0070688_100048323 3300005365 Bacteria 2643
74 Ga0070659_100063740 3300005366 Bacteria 2916
75 Ga0070659_100522008 3300005366 Unclassified 1014
76 Ga0070659_101033742 3300005366 Unclassified 722
77 Ga0070667_100024818 3300005367 Bacteria 4981
78 Ga0070667_100176510 3300005367 Bacteria 1888
79 Ga0070667_100402764 3300005367 Bacteria 1246
80 Ga0070703_10234393 3300005406 Bacteria 737
81 Ga0070713_100046518 3300005436 Unclassified 3561
82 Ga0070713_102417223 3300005436 Archaea 508
83 Ga0070710_10214667 3300005437 Bacteria 1221
84 Ga0070701_10015049 3300005438 Bacteria 3562
85 Ga0070705_100214058 3300005440 Bacteria 1330
86 Ga0070700_100150187 3300005441 Unclassified 1593
87 Ga0070700_100502659 3300005441 Bacteria 933
88 Ga0070694_100092327 3300005444 Bacteria 2127
89 Ga0070694_100294730 3300005444 Bacteria 1241
90 Ga0070694_101311657 3300005444 Unclassified 609
91 Ga0070708_100058110 3300005445 Bacteria 3445
92 Ga0070663_100193551 3300005455 Unclassified 1584
93 Ga0070678_100096418 3300005456 Bacteria 2281
94 Ga0070678_100486504 3300005456 Unclassified 1087
95 Ga0070662_100013140 3300005457 Bacteria 5503
96 Ga0070662_100183356 3300005457 Bacteria 1651
97 Ga0070662_100183477 3300005457 Bacteria 1651
98 Ga0070681_10377630 3300005458 Bacteria 1328
99 Ga0068867_100013520 3300005459 Bacteria 5781
100 Ga0068867_100199525 3300005459 Bacteria 1601
101 Ga0068867_100314331 3300005459 Bacteria 1295
102 Ga0068867_100335469 3300005459 Bacteria 1257
103 Ga0070685_10008854 3300005466 Bacteria 5189
104 Ga0070685_10152100 3300005466 Unclassified 1467
105 Ga0070698_100548125 3300005471 Unclassified 1096
106 Ga0070699_100945223 3300005518 Unclassified 790
107 Ga0070684_100355897 3300005535 Unclassified 1347
108 Ga0070672_100002971 3300005543 Bacteria 10925
109 Ga0070672_100081580 3300005543 Bacteria 2593
110 Ga0070672_100657423 3300005543 Bacteria 916
111 Ga0070686_100020642 3300005544 Bacteria 3901
112 Ga0070686_100212024 3300005544 Bacteria 1395
113 Ga0070695_100305840 3300005545 Unclassified 1177
114 Ga0070696_100375493 3300005546 Unclassified 1107
115 Ga0070693_100469996 3300005547 Unclassified 886
116 Ga0070665_100022685 3300005548 Bacteria 6319
117 Ga0070665_100095877 3300005548 Bacteria 2972
118 Ga0070665_100124445 3300005548 Bacteria 2580
119 Ga0070665_100527462 3300005548 Unclassified 1193
120 Ga0070665_102492582 3300005548 Unclassified 519
121 Ga0070704_101108501 3300005549 Unclassified 719
122 Ga0068855_100011333 3300005563 Bacteria 10763
123 Ga0070664_100028978 3300005564 Bacteria 4612
124 Ga0068857_100206698 3300005577 Unclassified 1791
125 Ga0068857_100978035 3300005577 Bacteria 814
126 Ga0068854_100177648 3300005578 Unclassified 1661
127 Ga0068856_100101015 3300005614 Bacteria 2877
128 Ga0068856_101760587 3300005614 Unclassified 632
129 Ga0070702_100213404 3300005615 Bacteria 1286
130 Ga0068852_100043702 3300005616 Bacteria 3801
131 Ga0068859_100017767 3300005617 Bacteria 7150
132 Ga0068859_100081770 3300005617 Bacteria 3273
133 Ga0068859_100150146 3300005617 Bacteria 2406
134 Ga0068859_100178425 3300005617 Bacteria 2206
135 Ga0068859_102105713 3300005617 Unclassified 623
136 Ga0068864_100067143 3300005618 Bacteria 3114
137 Ga0068864_100292417 3300005618 Bacteria 1523
138 Ga0068864_100320380 3300005618 Unclassified 1456
139 Ga0068864_101057061 3300005618 Bacteria 807
140 Ga0068866_10119867 3300005718 Bacteria 1481
141 Ga0068866_10189628 3300005718 Unclassified 1220
142 Ga0068861_100009676 3300005719 Bacteria 6660
143 Ga0068861_100424446 3300005719 Unclassified 1185
144 Ga0068851_10877511 3300005834 Unclassified 561
145 Ga0068870_10005396 3300005840 Bacteria 5581
146 Ga0068870_10184886 3300005840 Unclassified 1254
147 Ga0068870_10521738 3300005840 Unclassified 795
148 Ga0068863_100010167 3300005841 Bacteria 9151
149 Ga0068863_101812628 3300005841 Bacteria 620
150 Ga0068858_100049891 3300005842 Bacteria 3875
151 Ga0068858_100051538 3300005842 Bacteria 3807
152 Ga0068858_100273190 3300005842 Unclassified 1609
153 Ga0068860_100031552 3300005843 Bacteria 5093
154 Ga0068860_100086716 3300005843 Bacteria 2980
155 Ga0068862_100002879 3300005844 Bacteria 15072
156 Ga0068862_100167688 3300005844 Unclassified 1964
157 Ga0068862_100280118 3300005844 Unclassified 1528
158 Ga0068862_100452955 3300005844 Bacteria 1210
159 Ga0068862_100818356 3300005844 Bacteria 911
160 Ga0068862_100945048 3300005844 Bacteria 850
161 Ga0068862_102330578 3300005844 Unclassified 547
162 Ga0075427_10004363 3300006194 Bacteria 1981
163 Ga0097621_100048657 3300006237 Bacteria 3441
164 Ga0097621_100097775 3300006237 Bacteria 2465
165 Ga0097621_100302436 3300006237 Bacteria 1413
166 Ga0068871_100093338 3300006358 Bacteria 2511
167 Ga0068871_100100105 3300006358 Bacteria 2427
168 Ga0068871_100123226 3300006358 Bacteria 2192
169 Ga0068871_100271809 3300006358 Bacteria 1481
170 Ga0075428_100000987 3300006844 Bacteria 30133
171 Ga0075428_100046978 3300006844 Unclassified 4742
172 Ga0075428_100062872 3300006844 Bacteria 4063
173 Ga0075428_100089850 3300006844 Bacteria 3350
174 Ga0075428_100160227 3300006844 Unclassified 2442
175 Ga0075428_100223325 3300006844 Bacteria 2034
176 Ga0075428_100749573 3300006844 Bacteria 1039
177 Ga0075430_100022837 3300006846 Bacteria 5320
178 Ga0075430_100037385 3300006846 Unclassified 4115
179 Ga0075430_100043062 3300006846 Unclassified 3816
180 Ga0075430_100064977 3300006846 Bacteria 3066
181 Ga0075430_100133597 3300006846 Bacteria 2068
182 Ga0075430_100152522 3300006846 Bacteria 1924
183 Ga0075430_100275902 3300006846 Unclassified 1391
184 Ga0075431_100024156 3300006847 Bacteria 6223
185 Ga0075431_100103491 3300006847 Unclassified 2939
186 Ga0075431_100321328 3300006847 Bacteria 1561
187 Ga0075431_100595737 3300006847 Bacteria 1090
188 Ga0075431_101148293 3300006847 Bacteria 740
189 Ga0075433_10001513 3300006852 Bacteria 17179
190 Ga0075433_10001938 3300006852 Bacteria 15564
191 Ga0075434_100000830 3300006871 Bacteria 24547
192 Ga0075434_100001210 3300006871 Bacteria 21445
193 Ga0075434_100020687 3300006871 Bacteria 6388
194 Ga0075429_100009567 3300006880 Bacteria 8408
195 Ga0075429_100014179 3300006880 Bacteria 6909
196 Ga0075429_100021057 3300006880 Bacteria 5657
197 Ga0075429_100154185 3300006880 Bacteria 2011
198 Ga0075429_100267720 3300006880 Bacteria 1496
199 Ga0068865_100014243 3300006881 Bacteria 5049
200 Ga0068865_100352017 3300006881 Unclassified 1193
201 Ga0068865_100510695 3300006881 Bacteria 1003
202 Ga0097620_100017767 3300006931 Bacteria 7150
203 Ga0097620_100081764 3300006931 Bacteria 3273
204 Ga0097620_100150155 3300006931 Bacteria 2406
205 Ga0097620_100178444 3300006931 Bacteria 2206
206 Ga0097620_102106104 3300006931 Unclassified 623
207 Ga0075435_100003297 3300007076 Bacteria 10942
208 Ga0075435_100039424 3300007076 Bacteria 3770
209 Ga0075435_101050566 3300007076 Unclassified 712
210 Ga0105240_10012866 3300009093 Bacteria 11527
211 Ga0111539_10000057 3300009094 Bacteria 114860
212 Ga0111539_10003225 3300009094 Bacteria 21578
213 Ga0111539_10007494 3300009094 Bacteria 13970
214 Ga0111539_10073958 3300009094 Bacteria 4016
215 Ga0111539_10315728 3300009094 Unclassified 1819
216 Ga0111539_10689736 3300009094 Bacteria 1189
217 Ga0105245_10150852 3300009098 Bacteria 2198
218 Ga0105245_10980412 3300009098 Unclassified 889
219 Ga0105245_11330406 3300009098 Unclassified 768
220 Ga0105245_11743437 3300009098 Unclassified 675
221 Ga0105247_11488279 3300009101 Bacteria 551
222 Ga0114129_10022531 3300009147 Bacteria 8937
223 Ga0114129_10026293 3300009147 Bacteria 8243
224 Ga0114129_10234676 3300009147 Unclassified 2469
225 Ga0114129_10274862 3300009147 Bacteria 2253
226 Ga0114129_10445345 3300009147 Bacteria 1699
227 Ga0114129_12059541 3300009147 Unclassified 689
228 Ga0105243_10233179 3300009148 Unclassified 1634
229 Ga0105243_10337249 3300009148 Bacteria 1380
230 Ga0105243_11202675 3300009148 Bacteria 771
231 Ga0105243_11385158 3300009148 Bacteria 723
232 Ga0105243_11532225 3300009148 Bacteria 691
233 Ga0105242_10096480 3300009176 Bacteria 2498
234 Ga0105242_10612741 3300009176 Bacteria 1053
235 Ga0105248_10062339 3300009177 Bacteria 4187
236 Ga0105248_10268958 3300009177 Bacteria 1919
237 Ga0105248_10366958 3300009177 Bacteria 1621
238 Ga0105248_10435575 3300009177 Unclassified 1477
239 Ga0105248_10903489 3300009177 Bacteria 997
240 Ga0105248_11136732 3300009177 Unclassified 883
241 Ga0105248_11666743 3300009177 Unclassified 723
242 Ga0105237_10473437 3300009545 Unclassified 1259
243 Ga0105238_10667504 3300009551 Unclassified 1050
244 Ga0105249_10000858 3300009553 Bacteria 27086
245 Ga0105249_10328702 3300009553 Bacteria 1542
246 Ga0105249_11169803 3300009553 Unclassified 840
247 Ga0099796_10123732 3300010159 Bacteria 996
248 Ga0105246_10141314 3300011119 Unclassified 1810
249 Ga0157314_1004351 3300012500 Bacteria 1039
250 Ga0157370_10008250 3300013104 Bacteria 11246
251 Ga0157369_10046614 3300013105 Bacteria 4710
252 Ga0157369_11990450 3300013105 Unclassified 589
253 Ga0157374_11133562 3300013296 Unclassified 803
254 Ga0157374_11401178 3300013296 Unclassified 722
255 Ga0157374_11468105 3300013296 Bacteria 705
256 Ga0157378_10081494 3300013297 Unclassified 2925
257 Ga0157378_11335625 3300013297 Unclassified 759
258 Ga0163162_10085784 3300013306 Bacteria 3226
259 Ga0163162_10090106 3300013306 Bacteria 3148
260 Ga0163162_10615204 3300013306 Unclassified 1212
261 Ga0163162_11364766 3300013306 Unclassified 806
262 Ga0157372_10078427 3300013307 Bacteria 3732
263 Ga0157375_10156251 3300013308 Bacteria 2420
264 Ga0157375_10176237 3300013308 Bacteria 2288
265 Ga0157375_10520031 3300013308 Bacteria 1353
266 Ga0157375_12712034 3300013308 Bacteria 592
267 Ga0163163_10088667 3300014325 Bacteria 3105
268 Ga0163163_11283605 3300014325 Bacteria 794
269 Ga0163163_11293857 3300014325 Bacteria 791
270 Ga0157380_10003933 3300014326 Bacteria 10252
271 Ga0157380_10213219 3300014326 Unclassified 1722
272 Ga0157380_10477471 3300014326 Bacteria 1205
273 Ga0157380_10621997 3300014326 Unclassified 1072
274 Ga0157380_12300320 3300014326 Bacteria 603
275 Ga0157380_13086553 3300014326 Unclassified 531
276 Ga0157377_10030234 3300014745 Bacteria 2933
277 Ga0157377_10087913 3300014745 Bacteria 1829
278 Ga0157377_10411134 3300014745 Unclassified 924
279 Ga0157379_10015901 3300014968 Bacteria 6614
280 Ga0157379_10345278 3300014968 Bacteria 1362
281 Ga0157379_10436712 3300014968 Bacteria 1207
282 Ga0157379_10984858 3300014968 Unclassified 803
283 Ga0157379_12567685 3300014968 Unclassified 510
284 Ga0157376_10069435 3300014969 Bacteria 2987
285 Ga0157376_10099297 3300014969 Bacteria 2540
286 Ga0157376_11080075 3300014969 Unclassified 828
287 Ga0157376_11326385 3300014969 Unclassified 750
288 Ga0163161_10074480 3300017792 Bacteria 2490
289 Ga0163161_10130089 3300017792 Bacteria 1898
290 Ga0163161_10577569 3300017792 Unclassified 924
291 Ga0163161_10661589 3300017792 Bacteria 866
292 Ga0207673_1011772 3300025290 Bacteria 1135
293 Ga0207697_10019133 3300025315 Bacteria 2805
294 Ga0207653_10128287 3300025885 Bacteria 919
295 Ga0207682_10001472 3300025893 Bacteria 10879
296 Ga0207682_10006223 3300025893 Bacteria 4822
297 Ga0207682_10026057 3300025893 Bacteria 2322
298 Ga0207692_10431252 3300025898 Unclassified 827
299 Ga0207642_10222112 3300025899 Unclassified 1056
300 Ga0207688_10003474 3300025901 Bacteria 8595
301 Ga0207688_10011412 3300025901 Bacteria 4837
302 Ga0207688_10516685 3300025901 Unclassified 749
303 Ga0207680_10055470 3300025903 Bacteria 2388
304 Ga0207680_10445444 3300025903 Bacteria 919
305 Ga0207645_10065707 3300025907 Bacteria 2318
306 Ga0207643_10002052 3300025908 Bacteria 11104
307 Ga0207643_10077352 3300025908 Bacteria 1923
308 Ga0207643_10396722 3300025908 Bacteria 872
309 Ga0207643_10610387 3300025908 Bacteria 703
310 Ga0207695_10069431 3300025913 Bacteria 3605
311 Ga0207662_10023291 3300025918 Bacteria 3557
312 Ga0207662_10320792 3300025918 Bacteria 1034
313 Ga0207662_10446380 3300025918 Bacteria 884
314 Ga0207681_10018250 3300025923 Bacteria 4418
315 Ga0207681_10035818 3300025923 Bacteria 3272
316 Ga0207681_11014055 3300025923 Unclassified 696
317 Ga0207694_10856586 3300025924 Unclassified 768
318 Ga0207650_10104132 3300025925 Bacteria 2189
319 Ga0207659_10007890 3300025926 Bacteria 6581
320 Ga0207659_10009924 3300025926 Bacteria 5958
321 Ga0207659_10042054 3300025926 Bacteria 3203
322 Ga0207659_10061809 3300025926 Unclassified 2701
323 Ga0207700_10057384 3300025928 Unclassified 2935
324 Ga0207644_10111875 3300025931 Bacteria 2066
325 Ga0207690_10224979 3300025932 Bacteria 1437
326 Ga0207706_10006815 3300025933 Bacteria 10563
327 Ga0207706_10086099 3300025933 Bacteria 2762
328 Ga0207706_10169337 3300025933 Unclassified 1920
329 Ga0207686_11171889 3300025934 Bacteria 628
330 Ga0207709_10076479 3300025935 Unclassified 2143
331 Ga0207709_10820132 3300025935 Unclassified 752
332 Ga0207670_10032840 3300025936 Bacteria 3340
333 Ga0207670_10353392 3300025936 Unclassified 1164
334 Ga0207670_11514956 3300025936 Unclassified 570
335 Ga0207669_10003652 3300025937 Bacteria 6678
336 Ga0207669_10244435 3300025937 Unclassified 1332
337 Ga0207669_10437400 3300025937 Unclassified 1033
338 Ga0207704_10026248 3300025938 Bacteria 3193
339 Ga0207704_10151826 3300025938 Unclassified 1635
340 Ga0207691_10005522 3300025940 Bacteria 12217
341 Ga0207691_10018669 3300025940 Bacteria 6569
342 Ga0207691_10269564 3300025940 Bacteria 1466
343 Ga0207691_10711756 3300025940 Unclassified 846
344 Ga0207711_10023859 3300025941 Bacteria 5120
345 Ga0207711_10035920 3300025941 Bacteria 4202
346 Ga0207711_10040339 3300025941 Unclassified 3972
347 Ga0207711_10123326 3300025941 Unclassified 2315
348 Ga0207711_10492055 3300025941 Bacteria 1143
349 Ga0207711_10585112 3300025941 Bacteria 1041
350 Ga0207711_10623040 3300025941 Bacteria 1007
351 Ga0207689_10096010 3300025942 Bacteria 2435
352 Ga0207689_10106094 3300025942 Bacteria 2308
353 Ga0207689_10215707 3300025942 Unclassified 1586
354 Ga0207689_10428195 3300025942 Unclassified 1105
355 Ga0207689_10839005 3300025942 Unclassified 776
356 Ga0207679_10014441 3300025945 Bacteria 5195
357 Ga0207679_10510103 3300025945 Unclassified 1074
358 Ga0207667_10000938 3300025949 Bacteria 37175
359 Ga0207651_10005627 3300025960 Bacteria 6457
360 Ga0207651_10055348 3300025960 Bacteria 2724
361 Ga0207651_10260861 3300025960 Bacteria 1422
362 Ga0207651_10301644 3300025960 Unclassified 1332
363 Ga0207651_10370356 3300025960 Bacteria 1212
364 Ga0207712_10005957 3300025961 Bacteria 7690
365 Ga0207668_10118500 3300025972 Bacteria 2000
366 Ga0207668_10519932 3300025972 Unclassified 1027
367 Ga0207668_11172475 3300025972 Bacteria 690
368 Ga0207658_10227724 3300025986 Unclassified 1572
369 Ga0207658_10377959 3300025986 Bacteria 1240
370 Ga0207658_10590513 3300025986 Bacteria 997
371 Ga0207658_11180931 3300025986 Bacteria 699
372 Ga0207677_10277211 3300026023 Bacteria 1375
373 Ga0207703_10021566 3300026035 Bacteria 5044
374 Ga0207703_10030737 3300026035 Bacteria 4243
375 Ga0207703_10047324 3300026035 Bacteria 3467
376 Ga0207703_10074686 3300026035 Bacteria 2808
377 Ga0207678_10215142 3300026067 Unclassified 1644
378 Ga0207678_11550850 3300026067 Unclassified 584
379 Ga0207708_10082754 3300026075 Unclassified 2467
380 Ga0207708_10188875 3300026075 Bacteria 1639
381 Ga0207708_10513525 3300026075 Bacteria 1006
382 Ga0207702_10164797 3300026078 Unclassified 2027
383 Ga0207702_10579151 3300026078 Bacteria 1100
384 Ga0207641_10008084 3300026088 Bacteria 8715
385 Ga0207641_10346616 3300026088 Bacteria 1415
386 Ga0207648_10027925 3300026089 Bacteria 5006
387 Ga0207648_10035474 3300026089 Bacteria 4393
388 Ga0207648_10047473 3300026089 Bacteria 3764
389 Ga0207648_10154030 3300026089 Bacteria 2028
390 Ga0207648_10239190 3300026089 Bacteria 1616
391 Ga0207648_11286065 3300026089 Bacteria 687
392 Ga0207648_11744135 3300026089 Bacteria 584
393 Ga0207676_10057249 3300026095 Bacteria 3069
394 Ga0207676_10272211 3300026095 Bacteria 1534
395 Ga0207676_10323208 3300026095 Bacteria 1417
396 Ga0207674_10061692 3300026116 Bacteria 3787
397 Ga0207674_10159038 3300026116 Bacteria 2214
398 Ga0207674_11394246 3300026116 Bacteria 670
399 Ga0207675_100009805 3300026118 Bacteria 8965
400 Ga0207675_100049928 3300026118 Bacteria 3904
401 Ga0207675_100134722 3300026118 Unclassified 2343
402 Ga0207675_100729974 3300026118 Unclassified 1001
403 Ga0207683_10032402 3300026121 Unclassified 4540
404 Ga0207683_10159367 3300026121 Bacteria 2039
405 Ga0207683_10301585 3300026121 Unclassified 1466
406 Ga0207698_10062480 3300026142 Bacteria 2909
407 Ga0210000_1035452 3300027462 Bacteria 786
408 Ga0209968_1061614 3300027526 Bacteria 662
409 Ga0209970_1122202 3300027614 Bacteria 504
410 Ga0209974_10011637 3300027876 Unclassified 2953
411 Ga0207428_10001289 3300027907 Bacteria 26736
412 Ga0207428_10003943 3300027907 Bacteria 14231
413 Ga0207428_10008732 3300027907 Bacteria 9142
414 Ga0207428_10186092 3300027907 Unclassified 1567
415 Ga0207428_10617106 3300027907 Bacteria 780
416 Ga0268266_10436839 3300028379 Unclassified 1243
417 Ga0268265_10032702 3300028380 Bacteria 3772
418 Ga0268265_10495688 3300028380 Unclassified 1150
419 Ga0268265_10509293 3300028380 Bacteria 1136
420 Ga0268265_10649117 3300028380 Unclassified 1014
421 Ga0268265_10672345 3300028380 Bacteria 997
422 Ga0268265_11008116 3300028380 Bacteria 823
423 Ga0268264_10120961 3300028381 Bacteria 2307
424 Ga0268264_11271818 3300028381 Unclassified 746
425 Ga0268264_11906628 3300028381 Unclassified 604
426 Ga0265338_10069867 3300028800 Bacteria 3015
427 Ga0265332_10028622 3300031238 Unclassified 2438
428 Ga0265314_10120236 3300031711 Bacteria 1655
429 Ga0307416_100849025 3300032002 Unclassified 1011
430 Ga0373958_0073789 3300034819 Bacteria 761
431 Ga0373940_0049054 3300035088 Bacteria 1181
432 Ga0373944_0320783 3300035089 Unclassified 585
433 Ga0373949_0012283 3300035090 Bacteria 1893
434 Ga0373936_0010684 3300035113 Bacteria 3466
435 Ga0373945_0135706 3300035116 Bacteria 989
436 Ga0373953_0167047 3300035117 Bacteria 947
437 Ga0373956_0133675 3300035119 Bacteria 1162
438 Ga0373943_0035880 3300035170 Bacteria 2372
439 Ga0373946_0002257 3300035171 Bacteria 6807
440 Ga0373946_0335190 3300035171 Bacteria 754
441 Ga0373935_0014312 3300035692 Unclassified 4787
442 Ga0373935_0223144 3300035692 Unclassified 1310
443 Ga0373935_1353495 3300035692 Bacteria 532
444 Ga0373927_0048940 3300035695 Bacteria 2734
445 Ga0373933_0388119 3300035724 Bacteria 910
446 Ga0373947_1249497 3300035725 Unclassified 506
447 Ga0373937_0383627 3300036401 Bacteria 1333
448 Ga0373937_0550260 3300036401 Bacteria 1096
449 Ga0373937_1454003 3300036401 Bacteria 633
450 Ga0373925_0047989 3300037068 Bacteria 3180
451 Ga0242420_098062 3300038996 Bacteria 621
452 Ga0436365_0828423 3300039437 Bacteria 2757
453 Ga0451839_0588551 3300041496 Bacteria 693
454 Ga0451849_1042583 3300041505 Unclassified 730
455 Ga0439443_007821 3300042003 Bacteria 1495
456 Ga0439456_039824 3300042013 Bacteria 1017
457 Ga0450923_024374 3300042125 Unclassified 1199
458 Ga0439435_0004891 3300042436 Bacteria 2914
459 Ga0439435_0029069 3300042436 Bacteria 1490
460 Ga0439464_0088479 3300042439 Bacteria 931
461 Ga0439464_0248392 3300042439 Unclassified 574
462 Ga0439460_0065473 3300042461 Unclassified 1117
463 Ga0451576_0086742 3300045051 Bacteria 3255
464 Ga0451576_1906876 3300045051 Unclassified 613
465 Ga0495629_0395794 3300046459 Bacteria 939
466 Ga0495629_0485225 3300046459 Bacteria 834
467 Ga0495651_0143731 3300046462 Bacteria 1727
468 Ga0495651_0208712 3300046462 Bacteria 1361
469 Ga0495580_0077580 3300046472 Bacteria 2317
470 Ga0495580_0533043 3300046472 Bacteria 781
471 Ga0495639_0224933 3300046475 Bacteria 923
472 Ga0495664_0023966 3300046477 Bacteria 3544
473 Ga0495652_0086467 3300046529 Bacteria 2574
474 Ga0495640_0372989 3300046533 Bacteria 879
475 Ga0495586_0697196 3300046535 Unclassified 586
476 Ga0495587_0081239 3300046536 Unclassified 1878
477 Ga0495598_0005715 3300046537 Unclassified 2774
478 Ga0495598_0307692 3300046537 Bacteria 601
479 Ga0495622_0249092 3300046557 Bacteria 782
480 Ga0495667_0047700 3300046559 Unclassified 2829
481 Ga0495656_0011886 3300046615 Unclassified 3202
482 Ga0495599_0013196 3300046678 Bacteria 5105
483 Ga0495647_0499642 3300046681 Bacteria 566
484 Ga0495636_0035420 3300047318 Bacteria 2056
485 Ga0495636_0579101 3300047318 Unclassified 547
486 Ga0495674_0661039 3300047319 Bacteria 823
487 Ga0495680_0084782 3300047322 Unclassified 2387
488 Ga0495680_0898394 3300047322 Bacteria 572
489 Ga0495685_008827 3300047447 Unclassified 3359
490 Ga0495684_0191846 3300047471 Unclassified 1510
491 Ga0495684_0412196 3300047471 Unclassified 946
492 Ga0495684_0430614 3300047471 Unclassified 920
493 Ga0495684_0722183 3300047471 Bacteria 658
494 Ga0496100_0035700 3300048903 Bacteria 3129
495 Ga0496101_0002317 3300048904 Bacteria 11658
496 Ga0496102_0591796 3300048905 Bacteria 1032
497 Ga0496104_0002516 3300048907 Bacteria 15787
498 Ga0496104_0276083 3300048907 Archaea 1593
499 Ga0496107_0056362 3300048910 Bacteria 2839
500 Ga0496108_0160793 3300048911 Bacteria 1941
501 Ga0496108_0439837 3300048911 Unclassified 1139
502 Ga0496109_0024948 3300048912 Bacteria 5323
503 Ga0496113_0610160 3300048916 Bacteria 874
504 Ga0496114_0001255 3300048917 Bacteria 19210
505 Ga0496114_0806058 3300048917 Unclassified 818
506 Ga0501299_074897 3300049522 Bacteria 741
507 Ga0501031_0783975 3300049568 Bacteria 611
508 Ga0501033_0114911 3300049570 Unclassified 1956
509 Ga0501033_0915173 3300049570 Unclassified 589
510 Ga0501036_0170412 3300049572 Unclassified 1834
511 Ga0501036_0265382 3300049572 Bacteria 1438
512 Ga0501038_0129266 3300049574 Unclassified 2076
513 Ga0501039_0057616 3300049575 Bacteria 3009
514 Ga0501039_0623308 3300049575 Unclassified 845
515 Ga0501040_0001341 3300049576 Bacteria 15573
516 Ga0501041_0097161 3300049577 Bacteria 1821
517 Ga0501041_0199576 3300049577 Bacteria 1254
518 Ga0501042_0074927 3300049578 Unclassified 2421
519 Ga0501042_0082123 3300049578 Bacteria 2310
520 Ga0501042_0134031 3300049578 Bacteria 1786
521 Ga0501043_0298990 3300049579 Unclassified 1230
522 Ga0501046_0083305 3300049580 Unclassified 2469
523 Ga0501046_0215613 3300049580 Unclassified 1423
524 Ga0501048_0048664 3300049582 Unclassified 3023
525 Ga0501048_0056089 3300049582 Bacteria 2796
526 Ga0501048_0559380 3300049582 Unclassified 821
527 Ga0501068_0204381 3300049584 Unclassified 1253
528 Ga0501071_0079333 3300049587 Bacteria 2400
529 Ga0501071_0268830 3300049587 Bacteria 1289
530 Ga0501072_0255119 3300049588 Bacteria 1396
531 Ga0501075_0097219 3300049591 Bacteria 2234
532 Ga0501075_1147281 3300049591 Bacteria 590
533 Ga0501076_0078869 3300049592 Unclassified 2642
534 Ga0501076_0340890 3300049592 Bacteria 1230
535 Ga0501076_0603816 3300049592 Bacteria 905
536 Ga0501076_1207517 3300049592 Unclassified 622
537 Ga0501077_0084422 3300049593 Bacteria 2013
538 Ga0501077_0168087 3300049593 Unclassified 1393
539 Ga0501223_081662 3300049663 Bacteria 648
540 Ga0501225_0081263 3300049705 Bacteria 931
541 Ga0501079_0052138 3300049741 Unclassified 3158
542 Ga0501079_0207703 3300049741 Bacteria 1529
543 Ga0501079_1219134 3300049741 Bacteria 593
544 Ga0501080_0280072 3300049742 Unclassified 1516
545 Ga0501081_0060189 3300049743 Unclassified 2630
546 Ga0501081_0636429 3300049743 Bacteria 799
547 Ga0501081_0686275 3300049743 Unclassified 769
548 Ga0501081_0956862 3300049743 Bacteria 646
549 Ga0501083_0528978 3300049744 Unclassified 767
550 Ga0501269_036811 3300049766 Unclassified 642
551 Ga0501283_041346 3300049779 Bacteria 798
552 Ga0501035_0432492 3300049822 Unclassified 1091
553 Ga0501045_0066291 3300049824 Unclassified 2651
554 nmdc:mga05p37_220345_c1 3300050507 Unclassified 2290
555 nmdc:mga05p37_37016_c1 3300050507 Bacteria 5985
556 nmdc:mga05p37_428440_c1 3300050507 Unclassified 1537
557 nmdc:mga05p37_55453_c1 3300050507 Unclassified 4877
558 nmdc:mga05p37_743169_c1 3300050507 Bacteria 1083
559 nmdc:mga05p37_8550_c1 3300050507 Bacteria 12099
560 nmdc:mga09592_115960_c1 3300050508 Unclassified 2299
561 nmdc:mga09592_15093_c1 3300050508 Bacteria 6310
562 nmdc:mga09592_29178_c1 3300050508 Bacteria 4588
563 nmdc:mga09592_668703_c1 3300050508 Unclassified 886
564 nmdc:mga09592_751383_c1 3300050508 Unclassified 827
565 nmdc:mga0qj67_10090_c1 3300050509 Bacteria 7047
566 nmdc:mga0qj67_183393_c1 3300050509 Unclassified 1700
567 nmdc:mga0qj67_208428_c1 3300050509 Bacteria 1588
568 nmdc:mga0qj67_21371_c1 3300050509 Bacteria 4965
569 nmdc:mga0qj67_37855_c1 3300050509 Bacteria 3781
570 nmdc:mga0qj67_40459_c1 3300050509 Bacteria 3663
571 nmdc:mga0qj67_7166_c1 3300050509 Bacteria 8227
572 nmdc:mga0qj67_95958_c1 3300050509 Bacteria 2387
573 nmdc:mga06r32_1034199_c1 3300050510 Bacteria 773
574 nmdc:mga06r32_264113_c1 3300050510 Unclassified 1709
575 nmdc:mga06r32_313986_c1 3300050510 Unclassified 1553
576 nmdc:mga06r32_4433_c1 3300050510 Bacteria 12561
577 nmdc:mga06r32_573681_c1 3300050510 Bacteria 1101
578 nmdc:mga06r32_85101_c1 3300050510 Bacteria 3083
579 nmdc:mga08y16_13008_c1 3300050511 Bacteria 8758
580 nmdc:mga08y16_1831_c1 3300050511 Bacteria 21551
581 nmdc:mga08y16_2117675_c1 3300050511 Unclassified 510
582 nmdc:mga08y16_3411_c1 3300050511 Bacteria 16480
583 nmdc:mga08y16_735376_c1 3300050511 Bacteria 984
584 nmdc:mga08y16_8801_c1 3300050511 Bacteria 10596
585 nmdc:mga0n895_3687_c1 3300050512 Bacteria 12378
586 nmdc:mga0n895_9696_c1 3300050512 Bacteria 8447
587 nmdc:mga0n895_98709_c1 3300050512 Bacteria 2928
588 nmdc:mga0rr50_900_c1 3300050513 Bacteria 16067
589 nmdc:mga0a205_3766_c1 3300050515 Bacteria 13573
590 nmdc:mga0a205_7018_c1 3300050515 Bacteria 10173
591 nmdc:mga0a205_708_c1 3300050515 Bacteria 26770
592 Ga0495595_0071464 3300053084 Unclassified 1641
593 Ga0495619_0222516 3300053085 Unclassified 1307
594 Ga0495619_0353307 3300053085 Bacteria 1017
595 Ga0501084_0149336 3300054114 Unclassified 1969
596 Ga0501084_0610174 3300054114 Bacteria 922
597 Ga0501082_0081811 3300060353 Bacteria 2786
598 Ga0530510_0010998 3300061734 Bacteria 6347
599 Ga0530510_0205437 3300061734 Bacteria 1464
600 Ga0105248_10068558
601 ARcpr5oldR_c029632
602 ARcpr5yngRDRAFT_c013008
603 ARCol0yngRDRAFT_1007756
604 JGI24746J21847_1005952
605 JGI24035J26624_1005684
606 JGI24035J26624_1008812
607 JGI24033J26618_1026270
608 JGI24034J26672_10070424
609 Ga0058859_11699449
610 Ga0065714_10297954
611 Ga0065714_10305714
612 Ga0065712_10021745
613 Ga0065712_10248133
614 Ga0065715_10003799
615 Ga0065715_10036177
616 Ga0065707_10011772
617 Ga0065707_10145540
618 Ga0065707_10206161
619 Ga0065707_10484051
620 Ga0070676_10017028
621 Ga0070676_10152636
622 Ga0070676_11031114
623 Ga0070690_100047748
624 Ga0070690_100124957
625 Ga0070670_100047752
626 Ga0070670_100153087
627 Ga0070677_10002034
628 Ga0070677_10017353
629 Ga0070677_10044211
630 Ga0068869_100178652
631 Ga0068869_100225076
632 Ga0068869_100318550
633 Ga0068869_100403092
634 Ga0070666_10066435
635 Ga0070666_10067640
636 Ga0070666_10485534
637 Ga0070666_10535298
638 Ga0070680_101704242
639 Ga0070682_100282210
640 Ga0068868_100014260
641 Ga0068868_100363411
642 Ga0068868_100596209
643 Ga0068868_100770104
644 Ga0070689_100027446
645 Ga0070689_100265449
646 Ga0070689_100320760
647 Ga0070691_10454690
648 Ga0070687_100009248
649 Ga0070687_100366609
650 Ga0070687_100370299
651 Ga0070661_100018892
652 Ga0070668_100038692
653 Ga0070669_100002813
654 Ga0070669_100075452
655 Ga0070669_100658290
656 Ga0070669_101101943
657 Ga0070675_100039204
658 Ga0070675_100100569
659 Ga0070675_100125050
660 Ga0070675_100163207
661 Ga0070675_100203574
662 Ga0070675_100470026
663 Ga0070671_100024792
664 Ga0070674_100001211
665 Ga0070674_100115083
666 Ga0070674_100326463
667 Ga0070673_100012564
668 Ga0070673_100021523
669 Ga0070673_100091838
670 Ga0070673_100235379
671 Ga0070673_100475705
672 Ga0070688_100048323
673 Ga0070659_100063740
674 Ga0070659_100522008
675 Ga0070659_101033742
676 Ga0070667_100024818
677 Ga0070667_100176510
678 Ga0070667_100402764
679 Ga0070703_10234393
680 Ga0070713_100046518
681 Ga0070713_102417223
682 Ga0070710_10214667
683 Ga0070701_10015049
684 Ga0070705_100214058
685 Ga0070700_100150187
686 Ga0070700_100502659
687 Ga0070694_100092327
688 Ga0070694_100294730
689 Ga0070694_101311657
690 Ga0070708_100058110
691 Ga0070663_100193551
692 Ga0070678_100096418
693 Ga0070678_100486504
694 Ga0070662_100013140
695 Ga0070662_100183356
696 Ga0070662_100183477
697 Ga0070681_10377630
698 Ga0068867_100013520
699 Ga0068867_100199525
700 Ga0068867_100314331
701 Ga0068867_100335469
702 Ga0070685_10008854
703 Ga0070685_10152100
704 Ga0070698_100548125
705 Ga0070699_100945223
706 Ga0070684_100355897
707 Ga0070672_100002971
708 Ga0070672_100081580
709 Ga0070672_100657423
710 Ga0070686_100020642
711 Ga0070686_100212024
712 Ga0070695_100305840
713 Ga0070696_100375493
714 Ga0070693_100469996
715 Ga0070665_100022685
716 Ga0070665_100095877
717 Ga0070665_100124445
718 Ga0070665_100527462
719 Ga0070665_102492582
720 Ga0070704_101108501
721 Ga0068855_100011333
722 Ga0070664_100028978
723 Ga0068857_100206698
724 Ga0068857_100978035
725 Ga0068854_100177648
726 Ga0068856_100101015
727 Ga0068856_101760587
728 Ga0070702_100213404
729 Ga0068852_100043702
730 Ga0068859_100017767
731 Ga0068859_100081770
732 Ga0068859_100150146
733 Ga0068859_100178425
734 Ga0068859_102105713
735 Ga0068864_100067143
736 Ga0068864_100292417
737 Ga0068864_100320380
738 Ga0068864_101057061
739 Ga0068866_10119867
740 Ga0068866_10189628
741 Ga0068861_100009676
742 Ga0068861_100424446
743 Ga0068851_10877511
744 Ga0068870_10005396
745 Ga0068870_10184886
746 Ga0068870_10521738
747 Ga0068863_100010167
748 Ga0068863_101812628
749 Ga0068858_100049891
750 Ga0068858_100051538
751 Ga0068858_100273190
752 Ga0068860_100031552
753 Ga0068860_100086716
754 Ga0068862_100002879
755 Ga0068862_100167688
756 Ga0068862_100280118
757 Ga0068862_100452955
758 Ga0068862_100818356
759 Ga0068862_100945048
760 Ga0068862_102330578
761 Ga0075427_10004363
762 Ga0097621_100048657
763 Ga0097621_100097775
764 Ga0097621_100302436
765 Ga0068871_100093338
766 Ga0068871_100100105
767 Ga0068871_100123226
768 Ga0068871_100271809
769 Ga0075428_100000987
770 Ga0075428_100046978
771 Ga0075428_100062872
772 Ga0075428_100089850
773 Ga0075428_100160227
774 Ga0075428_100223325
775 Ga0075428_100749573
776 Ga0075430_100022837
777 Ga0075430_100037385
778 Ga0075430_100043062
779 Ga0075430_100064977
780 Ga0075430_100133597
781 Ga0075430_100152522
782 Ga0075430_100275902
783 Ga0075431_100024156
784 Ga0075431_100103491
785 Ga0075431_100321328
786 Ga0075431_100595737
787 Ga0075431_101148293
788 Ga0075433_10001513
789 Ga0075433_10001938
790 Ga0075434_100000830
791 Ga0075434_100001210
792 Ga0075434_100020687
793 Ga0075429_100009567
794 Ga0075429_100014179
795 Ga0075429_100021057
796 Ga0075429_100154185
797 Ga0075429_100267720
798 Ga0068865_100014243
799 Ga0068865_100352017
800 Ga0068865_100510695
801 Ga0097620_100017767
802 Ga0097620_100081764
803 Ga0097620_100150155
804 Ga0097620_100178444
805 Ga0097620_102106104
806 Ga0075435_100003297
807 Ga0075435_100039424
808 Ga0075435_101050566
809 Ga0105240_10012866
810 Ga0111539_10000057
811 Ga0111539_10003225
812 Ga0111539_10007494
813 Ga0111539_10073958
814 Ga0111539_10315728
815 Ga0111539_10689736
816 Ga0105245_10150852
817 Ga0105245_10980412
818 Ga0105245_11330406
819 Ga0105245_11743437
820 Ga0105247_11488279
821 Ga0114129_10022531
822 Ga0114129_10026293
823 Ga0114129_10234676
824 Ga0114129_10274862
825 Ga0114129_10445345
826 Ga0114129_12059541
827 Ga0105243_10233179
828 Ga0105243_10337249
829 Ga0105243_11202675
830 Ga0105243_11385158
831 Ga0105243_11532225
832 Ga0105242_10096480
833 Ga0105242_10612741
834 Ga0105248_10062339
835 Ga0105248_10268958
836 Ga0105248_10366958
837 Ga0105248_10435575
838 Ga0105248_10903489
839 Ga0105248_11136732
840 Ga0105248_11666743
841 Ga0105237_10473437
842 Ga0105238_10667504
843 Ga0105249_10000858
844 Ga0105249_10328702
845 Ga0105249_11169803
846 Ga0099796_10123732
847 Ga0105246_10141314
848 Ga0157314_1004351
849 Ga0157370_10008250
850 Ga0157369_10046614
851 Ga0157369_11990450
852 Ga0157374_11133562
853 Ga0157374_11401178
854 Ga0157374_11468105
855 Ga0157378_10081494
856 Ga0157378_11335625
857 Ga0163162_10085784
858 Ga0163162_10090106
859 Ga0163162_10615204
860 Ga0163162_11364766
861 Ga0157372_10078427
862 Ga0157375_10156251
863 Ga0157375_10176237
864 Ga0157375_10520031
865 Ga0157375_12712034
866 Ga0163163_10088667
867 Ga0163163_11283605
868 Ga0163163_11293857
869 Ga0157380_10003933
870 Ga0157380_10213219
871 Ga0157380_10477471
872 Ga0157380_10621997
873 Ga0157380_12300320
874 Ga0157380_13086553
875 Ga0157377_10030234
876 Ga0157377_10087913
877 Ga0157377_10411134
878 Ga0157379_10015901
879 Ga0157379_10345278
880 Ga0157379_10436712
881 Ga0157379_10984858
882 Ga0157379_12567685
883 Ga0157376_10069435
884 Ga0157376_10099297
885 Ga0157376_11080075
886 Ga0157376_11326385
887 Ga0163161_10074480
888 Ga0163161_10130089
889 Ga0163161_10577569
890 Ga0163161_10661589
891 Ga0207673_1011772
892 Ga0207697_10019133
893 Ga0207653_10128287
894 Ga0207682_10001472
895 Ga0207682_10006223
896 Ga0207682_10026057
897 Ga0207692_10431252
898 Ga0207642_10222112
899 Ga0207688_10003474
900 Ga0207688_10011412
901 Ga0207688_10516685
902 Ga0207680_10055470
903 Ga0207680_10445444
904 Ga0207645_10065707
905 Ga0207643_10002052
906 Ga0207643_10077352
907 Ga0207643_10396722
908 Ga0207643_10610387
909 Ga0207695_10069431
910 Ga0207662_10023291
911 Ga0207662_10320792
912 Ga0207662_10446380
913 Ga0207681_10018250
914 Ga0207681_10035818
915 Ga0207681_11014055
916 Ga0207694_10856586
917 Ga0207650_10104132
918 Ga0207659_10007890
919 Ga0207659_10009924
920 Ga0207659_10042054
921 Ga0207659_10061809
922 Ga0207700_10057384
923 Ga0207644_10111875
924 Ga0207690_10224979
925 Ga0207706_10006815
926 Ga0207706_10086099
927 Ga0207706_10169337
928 Ga0207686_11171889
929 Ga0207709_10076479
930 Ga0207709_10820132
931 Ga0207670_10032840
932 Ga0207670_10353392
933 Ga0207670_11514956
934 Ga0207669_10003652
935 Ga0207669_10244435
936 Ga0207669_10437400
937 Ga0207704_10026248
938 Ga0207704_10151826
939 Ga0207691_10005522
940 Ga0207691_10018669
941 Ga0207691_10269564
942 Ga0207691_10711756
943 Ga0207711_10023859
944 Ga0207711_10035920
945 Ga0207711_10040339
946 Ga0207711_10123326
947 Ga0207711_10492055
948 Ga0207711_10585112
949 Ga0207711_10623040
950 Ga0207689_10096010
951 Ga0207689_10106094
952 Ga0207689_10215707
953 Ga0207689_10428195
954 Ga0207689_10839005
955 Ga0207679_10014441
956 Ga0207679_10510103
957 Ga0207667_10000938
958 Ga0207651_10005627
959 Ga0207651_10055348
960 Ga0207651_10260861
961 Ga0207651_10301644
962 Ga0207651_10370356
963 Ga0207712_10005957
964 Ga0207668_10118500
965 Ga0207668_10519932
966 Ga0207668_11172475
967 Ga0207658_10227724
968 Ga0207658_10377959
969 Ga0207658_10590513
970 Ga0207658_11180931
971 Ga0207677_10277211
972 Ga0207703_10021566
973 Ga0207703_10030737
974 Ga0207703_10047324
975 Ga0207703_10074686
976 Ga0207678_10215142
977 Ga0207678_11550850
978 Ga0207708_10082754
979 Ga0207708_10188875
980 Ga0207708_10513525
981 Ga0207702_10164797
982 Ga0207702_10579151
983 Ga0207641_10008084
984 Ga0207641_10346616
985 Ga0207648_10027925
986 Ga0207648_10035474
987 Ga0207648_10047473
988 Ga0207648_10154030
989 Ga0207648_10239190
990 Ga0207648_11286065
991 Ga0207648_11744135
992 Ga0207676_10057249
993 Ga0207676_10272211
994 Ga0207676_10323208
995 Ga0207674_10061692
996 Ga0207674_10159038
997 Ga0207674_11394246
998 Ga0207675_100009805
999 Ga0207675_100049928
1000 Ga0207675_100134722
1001 Ga0207675_100729974
1002 Ga0207683_10032402
1003 Ga0207683_10159367
1004 Ga0207683_10301585
1005 Ga0207698_10062480
1006 Ga0210000_1035452
1007 Ga0209968_1061614
1008 Ga0209970_1122202
1009 Ga0209974_10011637
1010 Ga0207428_10001289
1011 Ga0207428_10003943
1012 Ga0207428_10008732
1013 Ga0207428_10186092
1014 Ga0207428_10617106
1015 Ga0268266_10436839
1016 Ga0268265_10032702
1017 Ga0268265_10495688
1018 Ga0268265_10509293
1019 Ga0268265_10649117
1020 Ga0268265_10672345
1021 Ga0268265_11008116
1022 Ga0268264_10120961
1023 Ga0268264_11271818
1024 Ga0268264_11906628
1025 Ga0265338_10069867
1026 Ga0265332_10028622
1027 Ga0265314_10120236
1028 Ga0307416_100849025
1029 Ga0373958_0073789
1030 Ga0373940_0049054
1031 Ga0373944_0320783
1032 Ga0373949_0012283
1033 Ga0373936_0010684
1034 Ga0373945_0135706
1035 Ga0373953_0167047
1036 Ga0373956_0133675
1037 Ga0373943_0035880
1038 Ga0373946_0002257
1039 Ga0373946_0335190
1040 Ga0373935_0014312
1041 Ga0373935_0223144
1042 Ga0373935_1353495
1043 Ga0373927_0048940
1044 Ga0373933_0388119
1045 Ga0373947_1249497
1046 Ga0373937_0383627
1047 Ga0373937_0550260
1048 Ga0373937_1454003
1049 Ga0373925_0047989
1050 Ga0242420_098062
1051 Ga0436365_0828423
1052 Ga0451839_0588551
1053 Ga0451849_1042583
1054 Ga0439443_007821
1055 Ga0439456_039824
1056 Ga0450923_024374
1057 Ga0439435_0004891
1058 Ga0439435_0029069
1059 Ga0439464_0088479
1060 Ga0439464_0248392
1061 Ga0439460_0065473
1062 Ga0451576_0086742
1063 Ga0451576_1906876
1064 Ga0495629_0395794
1065 Ga0495629_0485225
1066 Ga0495651_0143731
1067 Ga0495651_0208712
1068 Ga0495580_0077580
1069 Ga0495580_0533043
1070 Ga0495639_0224933
1071 Ga0495664_0023966
1072 Ga0495652_0086467
1073 Ga0495640_0372989
1074 Ga0495586_0697196
1075 Ga0495587_0081239
1076 Ga0495598_0005715
1077 Ga0495598_0307692
1078 Ga0495622_0249092
1079 Ga0495667_0047700
1080 Ga0495656_0011886
1081 Ga0495599_0013196
1082 Ga0495647_0499642
1083 Ga0495636_0035420
1084 Ga0495636_0579101
1085 Ga0495674_0661039
1086 Ga0495680_0084782
1087 Ga0495680_0898394
1088 Ga0495685_008827
1089 Ga0495684_0191846
1090 Ga0495684_0412196
1091 Ga0495684_0430614
1092 Ga0495684_0722183
1093 Ga0496100_0035700
1094 Ga0496101_0002317
1095 Ga0496102_0591796
1096 Ga0496104_0002516
1097 Ga0496104_0276083
1098 Ga0496107_0056362
1099 Ga0496108_0160793
1100 Ga0496108_0439837
1101 Ga0496109_0024948
1102 Ga0496113_0610160
1103 Ga0496114_0001255
1104 Ga0496114_0806058
1105 Ga0501299_074897
1106 Ga0501031_0783975
1107 Ga0501033_0114911
1108 Ga0501033_0915173
1109 Ga0501036_0170412
1110 Ga0501036_0265382
1111 Ga0501038_0129266
1112 Ga0501039_0057616
1113 Ga0501039_0623308
1114 Ga0501040_0001341
1115 Ga0501041_0097161
1116 Ga0501041_0199576
1117 Ga0501042_0074927
1118 Ga0501042_0082123
1119 Ga0501042_0134031
1120 Ga0501043_0298990
1121 Ga0501046_0083305
1122 Ga0501046_0215613
1123 Ga0501048_0048664
1124 Ga0501048_0056089
1125 Ga0501048_0559380
1126 Ga0501068_0204381
1127 Ga0501071_0079333
1128 Ga0501071_0268830
1129 Ga0501072_0255119
1130 Ga0501075_0097219
1131 Ga0501075_1147281
1132 Ga0501076_0078869
1133 Ga0501076_0340890
1134 Ga0501076_0603816
1135 Ga0501076_1207517
1136 Ga0501077_0084422
1137 Ga0501077_0168087
1138 Ga0501223_081662
1139 Ga0501225_0081263
1140 Ga0501079_0052138
1141 Ga0501079_0207703
1142 Ga0501079_1219134
1143 Ga0501080_0280072
1144 Ga0501081_0060189
1145 Ga0501081_0636429
1146 Ga0501081_0686275
1147 Ga0501081_0956862
1148 Ga0501083_0528978
1149 Ga0501269_036811
1150 Ga0501283_041346
1151 Ga0501035_0432492
1152 Ga0501045_0066291
1153 nmdc:mga05p37_220345_c1
1154 nmdc:mga05p37_37016_c1
1155 nmdc:mga05p37_428440_c1
1156 nmdc:mga05p37_55453_c1
1157 nmdc:mga05p37_743169_c1
1158 nmdc:mga05p37_8550_c1
1159 nmdc:mga09592_115960_c1
1160 nmdc:mga09592_15093_c1
1161 nmdc:mga09592_29178_c1
1162 nmdc:mga09592_668703_c1
1163 nmdc:mga09592_751383_c1
1164 nmdc:mga0qj67_10090_c1
1165 nmdc:mga0qj67_183393_c1
1166 nmdc:mga0qj67_208428_c1
1167 nmdc:mga0qj67_21371_c1
1168 nmdc:mga0qj67_37855_c1
1169 nmdc:mga0qj67_40459_c1
1170 nmdc:mga0qj67_7166_c1
1171 nmdc:mga0qj67_95958_c1
1172 nmdc:mga06r32_1034199_c1
1173 nmdc:mga06r32_264113_c1
1174 nmdc:mga06r32_313986_c1
1175 nmdc:mga06r32_4433_c1
1176 nmdc:mga06r32_573681_c1
1177 nmdc:mga06r32_85101_c1
1178 nmdc:mga08y16_13008_c1
1179 nmdc:mga08y16_1831_c1
1180 nmdc:mga08y16_2117675_c1
1181 nmdc:mga08y16_3411_c1
1182 nmdc:mga08y16_735376_c1
1183 nmdc:mga08y16_8801_c1
1184 nmdc:mga0n895_3687_c1
1185 nmdc:mga0n895_9696_c1
1186 nmdc:mga0n895_98709_c1
1187 nmdc:mga0rr50_900_c1
1188 nmdc:mga0a205_3766_c1
1189 nmdc:mga0a205_7018_c1
1190 nmdc:mga0a205_708_c1
1191 Ga0495595_0071464
1192 Ga0495619_0222516
1193 Ga0495619_0353307
1194 Ga0501084_0149336
1195 Ga0501084_0610174
1196 Ga0501082_0081811
1197 Ga0530510_0010998
1198 Ga0530510_0205437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

35

134

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8215 38 71
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8189 38 71
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.7978 39 71
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7726 37 73
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7722 37 73
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8872 42 71 2.30.29.30
af_Q9UBZ4_1_312_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8788 51 71 3.60.10.10
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8416 42 69 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8361 36 93 2.40.50.140
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8189 38 71 2.40.50.730
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9428 30 126
AF-A0A381U9S7-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.942 21 122
AF-A0A351D263-F1-model_v4 Uncharacterized protein 0.9396 22 120
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9382 30 114
AF-A0A2V8NP93-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9338 19 125

Map