F467614

General Info

Members Datasets Scaffolds Average Seq Length
596 469 397 235

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935675223|2935683727
Length 268
Sequence QRVFAAGPPRRTSVREPAAAGAGSESQQQESATGIEQKVAIITGASQGIGAALVQGFRDRNYRVVATARSIKPSGDDDILAVPGDIADRATAERVVSEAVARFGRVDTLVNNAGIFVAKPFTQYTAEDYAAVMGTNVAGFFHITQLAIAEMEKQGSGHVVQITTTLADQANSNVPSVLASLSKGGLNAATKSLAIEYARRGIRVNAVAPGIIKSPMHPVATHAQLGALHPVGHMGEMSDIVGAVLYLEQASFVTGEILHVDGGQSAGH

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
15 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
20 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
23 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
24 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
27 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
28 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
29 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
30 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
31 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
32 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
33 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2818991459 Paenibacillus sp. 597 Isolate Unclassified
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
69 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
76 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
77 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
78 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
79 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
80 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
81 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
82 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
83 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
84 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
85 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
86 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
87 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
88 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
89 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
90 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
91 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
92 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
93 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
94 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
95 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
96 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
97 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
98 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
99 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
100 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
101 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
102 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
103 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
104 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
105 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
106 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
107 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
108 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
109 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
110 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
111 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
112 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
113 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
114 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
115 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
116 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
117 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
118 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
119 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
120 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
121 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
122 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
123 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
124 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
125 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
126 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
127 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
128 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
129 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
130 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
131 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
132 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
133 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
134 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
135 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
136 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
139 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
140 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
141 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
142 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
143 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
144 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
145 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
146 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
147 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
148 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
149 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
150 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
151 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
152 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
153 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
154 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
155 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
156 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
157 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
158 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
159 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
160 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
161 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
162 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
163 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
164 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
165 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
166 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
167 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
168 2996887358 Rhizobium sp. R711 Isolate Nodule
169 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
170 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
171 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
172 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
173 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
174 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
175 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
176 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
177 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
178 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
179 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
180 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
183 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
186 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
187 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
192 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
193 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
194 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
195 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
198 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
199 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
200 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
201 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
202 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
203 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
205 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
206 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
207 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
208 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
209 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
210 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
211 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
212 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
213 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
214 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
215 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
216 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
217 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
218 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
219 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
220 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
221 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
222 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
223 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
224 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
225 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
226 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
227 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
228 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
229 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
230 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
231 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
232 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
233 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
234 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
235 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
236 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
238 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
239 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
240 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
241 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
242 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
243 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
244 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
251 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
253 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
254 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
255 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
295 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
298 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
299 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
300 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
301 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
302 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
303 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
304 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
305 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
306 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
307 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
308 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
309 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
310 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
311 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
343 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
350 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
354 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
355 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
356 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
357 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
358 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
359 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
362 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
363 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
364 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
365 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
375 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
376 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
377 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
423 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
424 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
425 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
426 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
427 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
428 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
429 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
433 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
434 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
435 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
436 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
437 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
438 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
442 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
443 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
444 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
445 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
446 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
447 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
448 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
449 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
450 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
451 8005258706 Rhizobium sp. R693 Isolate Nodule
452 8005321885 Rhizobium sp. R72 Isolate Nodule
453 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
454 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
455 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
456 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
457 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
458 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
459 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
460 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
461 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
462 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
463 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
464 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
465 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
466 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
467 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
468 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
469 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.22
Metatranscriptomes 0.5
Isolates 33.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 25.5
Rhizoplane 5.37
Rhizosphere 47.32
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000520 3300003215 Bacteria 24280
2 JGI25153J46596_10026789 3300003215 Bacteria 2033
3 JGI25160J50197_1012598 3300003354 Bacteria 2926
4 Ga0055539_1000029 3300003752 Bacteria 257094
5 Ga0055533_1000008 3300003756 Bacteria 575861
6 Ga0055525_1000634 3300003759 Bacteria 14316
7 Ga0055543_1003292 3300004625 Bacteria 4853
8 Ga0065165_1001022 3300005262 Bacteria 33988
9 Ga0065165_1003551 3300005262 Bacteria 10783
10 Ga0070658_10149431 3300005327 Bacteria 1955
11 Ga0070670_100403667 3300005331 Bacteria 1207
12 Ga0070682_100284315 3300005337 Bacteria 1207
13 Ga0070669_100085468 3300005353 Bacteria 2356
14 Ga0070671_100092078 3300005355 Bacteria 2540
15 Ga0070671_100116366 3300005355 Bacteria 2248
16 Ga0070673_100639405 3300005364 Bacteria 973
17 Ga0070714_100030611 3300005435 Bacteria 4482
18 Ga0070713_100036198 3300005436 Bacteria 3981
19 Ga0070713_100335022 3300005436 Bacteria 1400
20 Ga0070710_10001036 3300005437 Bacteria 13206
21 Ga0070710_10331839 3300005437 Bacteria 1002
22 Ga0070701_10100241 3300005438 Bacteria 1603
23 Ga0070711_100021868 3300005439 Bacteria 4140
24 Ga0070705_100018245 3300005440 Bacteria 3675
25 Ga0070708_100260706 3300005445 Bacteria 1629
26 Ga0070681_10831060 3300005458 Bacteria 841
27 Ga0070707_100000938 3300005468 Bacteria 28947
28 Ga0070707_100399423 3300005468 Bacteria 1334
29 Ga0070698_100019616 3300005471 Bacteria 7093
30 Ga0070699_100219128 3300005518 Bacteria 1696
31 Ga0070672_100213769 3300005543 Bacteria 1616
32 Ga0070665_100037553 3300005548 Bacteria 4870
33 Ga0070665_100059451 3300005548 Bacteria 3831
34 Ga0070665_100106448 3300005548 Bacteria 2807
35 Ga0070665_100912445 3300005548 Bacteria 891
36 Ga0068855_100007352 3300005563 Bacteria 13340
37 Ga0068855_100257782 3300005563 Bacteria 1944
38 Ga0068855_101170057 3300005563 Bacteria 801
39 Ga0068856_100216840 3300005614 Bacteria 1929
40 Ga0068852_100202531 3300005616 Bacteria 1879
41 Ga0068852_101214179 3300005616 Bacteria 775
42 Ga0068861_100090430 3300005719 Bacteria 2415
43 Ga0068863_100533956 3300005841 Bacteria 1157
44 Ga0081540_1000913 3300005983 Bacteria 26625
45 Ga0081540_1008393 3300005983 Bacteria 7221
46 Ga0081539_10012064 3300005985 Bacteria 6720
47 Ga0070717_10020693 3300006028 Bacteria 5179
48 Ga0070717_10584372 3300006028 Bacteria 1013
49 Ga0075365_10016394 3300006038 Bacteria 4506
50 Ga0075363_100347792 3300006048 Bacteria 865
51 Ga0075364_10196240 3300006051 Bacteria 1368
52 Ga0075432_10004533 3300006058 Bacteria 4731
53 Ga0070715_10000676 3300006163 Bacteria 9140
54 Ga0070716_100018717 3300006173 Bacteria 3611
55 Ga0070712_100033141 3300006175 Bacteria 3493
56 Ga0070712_100241128 3300006175 Bacteria 1440
57 Ga0075427_10030891 3300006194 Bacteria 879
58 Ga0075430_100008308 3300006846 Bacteria 8769
59 Ga0075433_10464975 3300006852 Bacteria 1115
60 Ga0068865_100818478 3300006881 Bacteria 805
61 Ga0099794_10063297 3300007265 Bacteria 1800
62 Ga0099794_10137296 3300007265 Bacteria 1237
63 Ga0105240_10065005 3300009093 Bacteria 4530
64 Ga0105245_10177315 3300009098 Bacteria 2033
65 Ga0105247_10131621 3300009101 Bacteria 1631
66 Ga0105243_10115658 3300009148 Bacteria 2252
67 Ga0105243_10200390 3300009148 Bacteria 1750
68 Ga0105241_10042861 3300009174 Bacteria 3427
69 Ga0105241_10050637 3300009174 Bacteria 3166
70 Ga0105248_10088838 3300009177 Bacteria 3478
71 Ga0105248_10328779 3300009177 Bacteria 1722
72 Ga0105237_10196576 3300009545 Bacteria 2017
73 Ga0105238_10113499 3300009551 Bacteria 2689
74 Ga0099796_10070381 3300010159 Bacteria 1261
75 Ga0105239_10032913 3300010375 Bacteria 5695
76 Ga0105246_10028542 3300011119 Bacteria 3666
77 Ga0157374_10035573 3300013296 Bacteria 4557
78 Ga0163162_10166670 3300013306 Bacteria 2327
79 Ga0157375_10594567 3300013308 Bacteria 1266
80 Ga0157375_11422586 3300013308 Bacteria 817
81 Ga0163163_10295532 3300014325 Bacteria 1672
82 Ga0157380_10472863 3300014326 Bacteria 1210
83 Ga0157376_10346926 3300014969 Bacteria 1419
84 Ga0157376_10360724 3300014969 Bacteria 1394
85 Ga0183361_10020 3300016635 Bacteria 128627
86 Ga0163161_10248315 3300017792 Bacteria 1386
87 Ga0197907_10389582 3300020069 Bacteria 1973
88 Ga0206354_10140982 3300020081 Bacteria 1703
89 Ga0214544_1024720 3300021320 Bacteria 3051
90 Ga0214544_1039634 3300021320 Bacteria 1071
91 Ga0214542_1042910 3300021321 Bacteria 1070
92 Ga0214545_1044035 3300021324 Bacteria 1070
93 Ga0214543_1043714 3300021327 Bacteria 1071
94 Ga0213872_10000210 3300021361 Bacteria 51803
95 Ga0213872_10006978 3300021361 Bacteria 5603
96 Ga0213872_10010859 3300021361 Bacteria 4321
97 Ga0213872_10017289 3300021361 Bacteria 3335
98 Ga0224712_10146944 3300022467 Bacteria 1042
99 Ga0209566_101668 3300025225 Bacteria 5589
100 Ga0209674_100015 3300025226 Bacteria 697299
101 Ga0209563_100017 3300025230 Bacteria 796449
102 Ga0209258_100294 3300025242 Bacteria 82196
103 Ga0209677_100022 3300025253 Bacteria 410724
104 Ga0209677_104740 3300025253 Bacteria 3802
105 Ga0209148_1000572 3300025254 Bacteria 34315
106 Ga0209233_1000643 3300025261 Bacteria 17301
107 Ga0209233_1023206 3300025261 Bacteria 1574
108 Ga0209455_1000813 3300025272 Bacteria 17043
109 Ga0209025_1002818 3300025294 Bacteria 17497
110 Ga0209025_1007567 3300025294 Bacteria 8057
111 Ga0209758_1000187 3300025297 Bacteria 138759
112 Ga0209758_1059919 3300025297 Bacteria 1263
113 Ga0207426_1002675 3300025302 Bacteria 10929
114 Ga0207426_1017824 3300025302 Bacteria 2516
115 Ga0207426_1029908 3300025302 Bacteria 1791
116 Ga0207653_10172756 3300025885 Bacteria 805
117 Ga0207710_10034859 3300025900 Bacteria 2213
118 Ga0207710_10105566 3300025900 Bacteria 1333
119 Ga0207688_10093462 3300025901 Bacteria 1730
120 Ga0207680_10328046 3300025903 Bacteria 1071
121 Ga0207685_10020588 3300025905 Bacteria 2196
122 Ga0207699_10015164 3300025906 Bacteria 3998
123 Ga0207699_10136702 3300025906 Bacteria 1606
124 Ga0207699_10192029 3300025906 Bacteria 1379
125 Ga0207684_10151524 3300025910 Bacteria 1995
126 Ga0207654_10022988 3300025911 Bacteria 3334
127 Ga0207695_10003969 3300025913 Bacteria 20441
128 Ga0207695_10241455 3300025913 Bacteria 1708
129 Ga0207671_10004407 3300025914 Bacteria 13488
130 Ga0207693_10035028 3300025915 Bacteria 3960
131 Ga0207693_10086018 3300025915 Bacteria 2463
132 Ga0207663_10032814 3300025916 Bacteria 3086
133 Ga0207657_10055889 3300025919 Bacteria 3407
134 Ga0207649_10246397 3300025920 Bacteria 1285
135 Ga0207646_10000289 3300025922 Bacteria 69345
136 Ga0207681_10071544 3300025923 Bacteria 2420
137 Ga0207694_10008183 3300025924 Bacteria 7903
138 Ga0207694_10136220 3300025924 Bacteria 1972
139 Ga0207650_10215842 3300025925 Bacteria 1542
140 Ga0207700_10054163 3300025928 Bacteria 3009
141 Ga0207700_10449269 3300025928 Bacteria 1136
142 Ga0207644_10132515 3300025931 Bacteria 1910
143 Ga0207644_10291198 3300025931 Bacteria 1313
144 Ga0207686_10120233 3300025934 Bacteria 1787
145 Ga0207665_10003278 3300025939 Bacteria 10844
146 Ga0207665_10005097 3300025939 Bacteria 8770
147 Ga0207665_10052248 3300025939 Bacteria 2753
148 Ga0207691_10219263 3300025940 Bacteria 1650
149 Ga0207711_10119106 3300025941 Bacteria 2355
150 Ga0207689_10138863 3300025942 Bacteria 2002
151 Ga0207667_10116134 3300025949 Bacteria 2758
152 Ga0207651_10677195 3300025960 Bacteria 907
153 Ga0207712_10130414 3300025961 Bacteria 1915
154 Ga0207712_10193828 3300025961 Bacteria 1606
155 Ga0207712_10549838 3300025961 Unclassified 993
156 Ga0207640_10061940 3300025981 Bacteria 2480
157 Ga0207703_10370503 3300026035 Bacteria 1323
158 Ga0207639_10065556 3300026041 Bacteria 2820
159 Ga0207678_10055518 3300026067 Bacteria 3412
160 Ga0207678_10136683 3300026067 Bacteria 2091
161 Ga0207702_10174209 3300026078 Bacteria 1975
162 Ga0207702_10188948 3300026078 Bacteria 1902
163 Ga0207641_10254082 3300026088 Bacteria 1643
164 Ga0207648_10040310 3300026089 Bacteria 4104
165 Ga0207675_100053707 3300026118 Bacteria 3759
166 Ga0207683_10101117 3300026121 Bacteria 2574
167 Ga0207698_10081550 3300026142 Bacteria 2612
168 Ga0209588_1013621 3300027671 Bacteria 2482
169 Ga0207428_10007648 3300027907 Bacteria 9840
170 Ga0268266_10009760 3300028379 Bacteria 8443
171 Ga0268266_10017775 3300028379 Bacteria 6059
172 Ga0268266_10761704 3300028379 Bacteria 934
173 Ga0268265_10108901 3300028380 Bacteria 2257
174 Ga0268265_10456890 3300028380 Bacteria 1194
175 Ga0265337_1001144 3300028556 Bacteria 13549
176 Ga0265326_10000343 3300028558 Bacteria 19752
177 Ga0265319_1000708 3300028563 Bacteria 21771
178 Ga0265334_10000334 3300028573 Bacteria 25204
179 Ga0265318_10003470 3300028577 Bacteria 7907
180 Ga0265323_10000353 3300028653 Bacteria 26349
181 Ga0265322_10028530 3300028654 Bacteria 1593
182 Ga0265336_10000288 3300028666 Bacteria 34727
183 Ga0307515_10142325 3300028794 Bacteria 2564
184 Ga0265338_10000159 3300028800 Bacteria 123495
185 Ga0265338_10000479 3300028800 Bacteria 71329
186 Ga0265338_10001718 3300028800 Bacteria 34727
187 Ga0265324_10006282 3300029957 Bacteria 4983
188 Ga0265340_10052744 3300031247 Bacteria 1966
189 Ga0265327_10000447 3300031251 Bacteria 74605
190 Ga0307508_10003896 3300031616 Bacteria 14839
191 Ga0307508_10398836 3300031616 Bacteria 967
192 Ga0307516_10248521 3300031730 Bacteria 1474
193 Ga0307414_10641964 3300032004 Bacteria 956
194 Ga0307510_10033295 3300033180 Bacteria 5790
195 Ga0307510_10144638 3300033180 Bacteria 2013
196 Ga0373935_0216083 3300035692 Bacteria 1330
197 Ga0373947_0025745 3300035725 Bacteria 3431
198 Ga0373925_0029698 3300037068 Bacteria 4011
199 Ga0395900_0224704 3300037418 Bacteria 1891
200 Ga0395905_0085700 3300037471 Bacteria 2952
201 Ga0436361_0272793 3300039447 Bacteria 2458
202 Ga0436361_0274756 3300039447 Bacteria 52927
203 Ga0436361_0340185 3300039447 Bacteria 3561
204 Ga0436361_0432288 3300039447 Bacteria 1949
205 Ga0436361_0448572 3300039447 Bacteria 2443
206 Ga0436361_0675026 3300039447 Bacteria 24349
207 Ga0466972_0004950 3300044658 Bacteria 6687
208 Ga0466965_0007235 3300044683 Bacteria 5087
209 Ga0466963_0157337 3300044694 Bacteria 1580
210 Ga0466957_0019249 3300044842 Bacteria 4015
211 Ga0466957_0118898 3300044842 Bacteria 1683
212 Ga0466957_0345653 3300044842 Bacteria 1008
213 Ga0466960_0000402 3300044901 Bacteria 14814
214 Ga0466960_0013703 3300044901 Bacteria 3452
215 Ga0466967_0073220 3300045976 Bacteria 3073
216 Ga0495590_0048362 3300046457 Bacteria 1484
217 Ga0495629_0014766 3300046459 Bacteria 5619
218 Ga0495629_0026072 3300046459 Bacteria 4154
219 Ga0495638_0003259 3300046460 Bacteria 12812
220 Ga0495651_0102265 3300046462 Bacteria 2131
221 Ga0495653_0218528 3300046463 Bacteria 1282
222 Ga0495605_0002953 3300046474 Bacteria 10294
223 Ga0495664_0053449 3300046477 Bacteria 2402
224 Ga0495585_0272204 3300046492 Bacteria 839
225 Ga0495594_0018592 3300046499 Bacteria 3683
226 Ga0495594_0066485 3300046499 Bacteria 2000
227 Ga0495594_0169069 3300046499 Bacteria 1243
228 Ga0495607_0138006 3300046501 Bacteria 1261
229 Ga0495607_0148399 3300046501 Bacteria 1202
230 Ga0495607_0189695 3300046501 Bacteria 1025
231 Ga0495583_0011138 3300046506 Bacteria 5181
232 Ga0495583_0070704 3300046506 Bacteria 1534
233 Ga0495606_0006484 3300046507 Bacteria 10769
234 Ga0495606_0012941 3300046507 Bacteria 6639
235 Ga0495606_0016165 3300046507 Bacteria 5706
236 Ga0495606_0181392 3300046507 Bacteria 1213
237 Ga0495608_0385061 3300046511 Bacteria 859
238 Ga0495610_0036672 3300046512 Bacteria 2503
239 Ga0495616_0004895 3300046513 Bacteria 8367
240 Ga0495618_0063428 3300046514 Bacteria 2346
241 Ga0495620_0002190 3300046515 Bacteria 11364
242 Ga0495631_0004911 3300046518 Bacteria 7045
243 Ga0495631_0018877 3300046518 Bacteria 3240
244 Ga0495631_0238028 3300046518 Bacteria 776
245 Ga0495632_0022542 3300046519 Bacteria 3374
246 Ga0495632_0146205 3300046519 Bacteria 1094
247 Ga0495632_0169060 3300046519 Bacteria 1005
248 Ga0495643_0010249 3300046522 Bacteria 5772
249 Ga0495648_0263099 3300046524 Bacteria 826
250 Ga0495666_0108132 3300046526 Bacteria 1307
251 Ga0495652_0113133 3300046529 Bacteria 2179
252 Ga0495665_0118332 3300046531 Bacteria 1388
253 Ga0495598_0015830 3300046537 Bacteria 1912
254 Ga0495609_0222355 3300046538 Bacteria 784
255 Ga0495597_0211541 3300046542 Bacteria 773
256 Ga0495622_0214955 3300046557 Bacteria 853
257 Ga0495633_0062286 3300046558 Bacteria 1746
258 Ga0495656_0097912 3300046615 Bacteria 1352
259 Ga0495668_0001382 3300046616 Bacteria 23661
260 Ga0495668_0105985 3300046616 Bacteria 1537
261 Ga0495668_0158732 3300046616 Bacteria 1239
262 Ga0495634_0056575 3300046642 Bacteria 2620
263 Ga0495634_0065601 3300046642 Bacteria 2406
264 Ga0495611_0106769 3300046648 Bacteria 1302
265 Ga0495625_0005301 3300046660 Bacteria 11828
266 Ga0495625_0018319 3300046660 Bacteria 5468
267 Ga0495625_0018985 3300046660 Bacteria 5350
268 Ga0495625_0028660 3300046660 Bacteria 4173
269 Ga0495625_0248203 3300046660 Bacteria 1156
270 Ga0495625_0262302 3300046660 Bacteria 1118
271 Ga0495635_0056402 3300046663 Bacteria 2704
272 Ga0495659_0068722 3300046664 Bacteria 1324
273 Ga0495657_0052641 3300046675 Bacteria 2728
274 Ga0495646_0145502 3300046680 Bacteria 1322
275 Ga0495647_0030572 3300046681 Bacteria 1999
276 Ga0495669_0000718 3300046684 Bacteria 14404
277 Ga0495669_0006828 3300046684 Bacteria 4777
278 Ga0495669_0040336 3300046684 Bacteria 2070
279 Ga0495613_0269258 3300046689 Bacteria 1185
280 Ga0495624_0057669 3300046690 Bacteria 2441
281 Ga0495624_0398414 3300046690 Bacteria 826
282 Ga0495649_0187996 3300046694 Bacteria 1076
283 Ga0495649_0279861 3300046694 Bacteria 852
284 Ga0495589_0210803 3300046794 Bacteria 915
285 Ga0495604_0073499 3300047317 Bacteria 2580
286 Ga0495676_0082487 3300047321 Bacteria 2433
287 Ga0495683_0079205 3300047323 Bacteria 1604
288 Ga0495687_019102 3300047443 Bacteria 3371
289 Ga0495687_030647 3300047443 Bacteria 2475
290 Ga0495677_0008675 3300047445 Bacteria 3772
291 Ga0495677_0128205 3300047445 Bacteria 970
292 Ga0495685_011048 3300047447 Bacteria 3038
293 Ga0495673_0038365 3300047469 Bacteria 2180
294 Ga0495681_0075497 3300047470 Bacteria 1517
295 Ga0495686_0000893 3300047472 Bacteria 37575
296 Ga0495686_0069067 3300047472 Bacteria 2179
297 Ga0495686_0305278 3300047472 Bacteria 877
298 Ga0495593_0193405 3300047673 Bacteria 1023
299 Ga0495602_0259949 3300048088 Bacteria 1288
300 Ga0495626_0001114 3300048091 Bacteria 22690
301 Ga0495626_0025041 3300048091 Bacteria 2921
302 Ga0496100_0322775 3300048903 Bacteria 1160
303 Ga0496101_0159123 3300048904 Bacteria 1731
304 Ga0496101_0415475 3300048904 Bacteria 1060
305 Ga0496102_0338126 3300048905 Bacteria 1418
306 Ga0496102_0465279 3300048905 Bacteria 1185
307 Ga0496102_0903371 3300048905 Bacteria 805
308 Ga0496103_0023624 3300048906 Bacteria 3709
309 Ga0496103_0317100 3300048906 Bacteria 1003
310 Ga0496104_0045686 3300048907 Bacteria 4120
311 Ga0496104_0056604 3300048907 Bacteria 3709
312 Ga0496104_0140668 3300048907 Bacteria 2318
313 Ga0496104_0672867 3300048907 Bacteria 943
314 Ga0496105_0008435 3300048908 Bacteria 8009
315 Ga0496105_0027974 3300048908 Bacteria 4610
316 Ga0496105_0172365 3300048908 Bacteria 1773
317 Ga0496106_0173709 3300048909 Bacteria 1709
318 Ga0496106_0417442 3300048909 Bacteria 1078
319 Ga0496107_0028607 3300048910 Bacteria 3961
320 Ga0496108_0024057 3300048911 Bacteria 5013
321 Ga0496109_0041715 3300048912 Bacteria 4156
322 Ga0496110_0222561 3300048913 Bacteria 1716
323 Ga0496112_0001243 3300048915 Bacteria 19260
324 Ga0496112_0044494 3300048915 Bacteria 4350
325 Ga0496112_0149683 3300048915 Bacteria 2301
326 Ga0496112_0364644 3300048915 Bacteria 1386
327 Ga0496113_0179961 3300048916 Bacteria 1676
328 Ga0496114_0737091 3300048917 Bacteria 862
329 Ga0496115_0093874 3300048918 Bacteria 2454
330 Ga0496115_0219757 3300048918 Bacteria 1568
331 Ga0496115_0254983 3300048918 Bacteria 1443
332 Ga0496115_0395729 3300048918 Bacteria 1122
333 Ga0496115_0708090 3300048918 Bacteria 791
334 Ga0496117_0120602 3300048920 Bacteria 1612
335 Ga0496118_0117030 3300048921 Bacteria 1750
336 Ga0496118_0333692 3300048921 Bacteria 816
337 Ga0496119_0057157 3300048922 Bacteria 2359
338 Ga0496119_0098815 3300048922 Bacteria 1643
339 Ga0496120_0032704 3300048923 Bacteria 3133
340 Ga0496120_0085568 3300048923 Bacteria 1696
341 Ga0496121_0016795 3300048924 Bacteria 7528
342 Ga0496121_0036905 3300048924 Bacteria 4348
343 Ga0496121_0239754 3300048924 Bacteria 1264
344 Ga0496122_0015131 3300048925 Bacteria 7395
345 Ga0496123_0002377 3300048926 Bacteria 23584
346 Ga0496125_0366125 3300048928 Bacteria 855
347 Ga0496126_0012552 3300048929 Bacteria 8671
348 Ga0496126_0230270 3300048929 Bacteria 1553
349 Ga0495682_0041601 3300049460 Bacteria 1684
350 Ga0501047_0659856 3300049581 Bacteria 865
351 nmdc:mga0yw44_29643_c1 3300050492 Bacteria 3161
352 nmdc:mga05p37_5759_c2 3300050507 Bacteria 7104
353 nmdc:mga09592_645996_c1 3300050508 Bacteria 904
354 nmdc:mga0qj67_9334_c1 3300050509 Bacteria 7295
355 nmdc:mga06r32_109893_c1 3300050510 Bacteria 2712
356 nmdc:mga06r32_51938_c1 3300050510 Bacteria 3925
357 nmdc:mga08y16_71896_c1 3300050511 Bacteria 3605
358 nmdc:mga0n895_5246_c1 3300050512 Bacteria 10797
359 nmdc:mga0rr50_113220_c1 3300050513 Bacteria 2150
360 nmdc:mga0a205_281119_c1 3300050515 Bacteria 1539
361 nmdc:mga0a205_9442_c1 3300050515 Bacteria 8918
362 nmdc:mga0sz30_204725_c1 3300050516 Bacteria 876
363 Ga0500610_0102976 3300053079 Bacteria 1475
364 Ga0500610_0136553 3300053079 Bacteria 1242
365 Ga0495655_0003565 3300053083 Bacteria 2579
366 Ga0495619_0033348 3300053085 Bacteria 3344
367 Ga0500643_000060 3300053087 Bacteria 128090
368 Ga0500644_0055575 3300053088 Bacteria 1375
369 Ga0500651_0004315 3300053093 Bacteria 7946
370 Ga0500566_0007485 3300053094 Bacteria 6468
371 Ga0500650_0150692 3300053098 Bacteria 1075
372 Ga0500555_009585 3300053103 Bacteria 2771
373 Ga0500557_000007 3300053105 Bacteria 136781
374 Ga0500557_003625 3300053105 Bacteria 3102
375 Ga0500562_001825 3300053108 Bacteria 5335
376 Ga0500594_0015966 3300053118 Bacteria 1819
377 Ga0500595_015228 3300053119 Bacteria 2891
378 Ga0500608_074058 3300053122 Bacteria 1615
379 Ga0500642_0092125 3300053130 Bacteria 1401
380 Ga0500559_0235233 3300053136 Bacteria 863
381 Ga0500564_081579 3300053138 Bacteria 1449
382 Ga0500568_0014640 3300053139 Bacteria 3535
383 Ga0500577_0213615 3300053142 Bacteria 834
384 Ga0500588_0225805 3300053146 Bacteria 699
385 Ga0500590_004472 3300053148 Bacteria 6600
386 Ga0500590_071218 3300053148 Bacteria 1727
387 Ga0500604_0068242 3300053151 Bacteria 1129
388 Ga0500616_0016604 3300053153 Bacteria 4187
389 Ga0500616_0083369 3300053153 Bacteria 1601
390 Ga0500620_000722 3300053155 Bacteria 5660
391 Ga0500622_0010418 3300053156 Bacteria 5104
392 Ga0500627_0028863 3300053158 Bacteria 2309
393 Ga0500636_0006462 3300053177 Bacteria 6731
394 Ga0500625_002773 3300053729 Bacteria 6687
395 Ga0500599_000509 3300053736 Bacteria 4061
396 Ga0500601_000696 3300053737 Bacteria 4502
397 Ga0500661_021756 3300055283 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053146 Ga0500588_0225805 Ga0500588_0225805_13_663 208
2 3300046499 Ga0495594_0066485 Ga0495594_0066485_951_1664 214
3 3300005355 Ga0070671_100092078 Ga0070671_1000920783 220
4 3300009177 Ga0105248_10088838 Ga0105248_100888384 220
5 3300025931 Ga0207644_10132515 Ga0207644_101325153 220
6 3300025941 Ga0207711_10119106 Ga0207711_101191063 220
7 3300037068 Ga0373925_0029698 Ga0373925_0029698_14_676 220
8 3300050508 nmdc:mga09592_645996_c1 nmdc:mga09592_645996_c1_35_697 220
9 3300050511 nmdc:mga08y16_71896_c1 nmdc:mga08y16_71896_c1_2909_3571 220
10 3300005262 Ga0065165_1003551 Ga0065165_10035516 222
11 3300025302 Ga0207426_1002675 Ga0207426_100267510 222
12 3300006028 Ga0070717_10584372 Ga0070717_105843722 223
13 3300048916 Ga0496113_0179961 Ga0496113_0179961_856_1566 223
14 3300031616 Ga0307508_10398836 Ga0307508_103988361 226
15 3300046459 Ga0495629_0026072 Ga0495629_0026072_2649_3359 226
16 3300046462 Ga0495651_0102265 Ga0495651_0102265_172_882 226
17 3300046463 Ga0495653_0218528 Ga0495653_0218528_130_840 226
18 3300046511 Ga0495608_0385061 Ga0495608_0385061_54_764 226
19 3300046514 Ga0495618_0063428 Ga0495618_0063428_454_1164 226
20 3300046529 Ga0495652_0113133 Ga0495652_0113133_997_1707 226
21 3300046531 Ga0495665_0118332 Ga0495665_0118332_199_909 226
22 3300046642 Ga0495634_0056575 Ga0495634_0056575_1122_1832 226
23 3300046663 Ga0495635_0056402 Ga0495635_0056402_1655_2365 226
24 3300046675 Ga0495657_0052641 Ga0495657_0052641_1712_2422 226
25 3300046680 Ga0495646_0145502 Ga0495646_0145502_12_722 226
26 3300046689 Ga0495613_0269258 Ga0495613_0269258_122_832 226
27 3300046690 Ga0495624_0057669 Ga0495624_0057669_1638_2348 226
28 3300047317 Ga0495604_0073499 Ga0495604_0073499_1174_1884 226
29 3300047321 Ga0495676_0082487 Ga0495676_0082487_1012_1722 226
30 3300048088 Ga0495602_0259949 Ga0495602_0259949_136_846 226
31 3300048904 Ga0496101_0415475 Ga0496101_0415475_200_910 226
32 3300048905 Ga0496102_0465279 Ga0496102_0465279_145_855 226
33 3300048907 Ga0496104_0056604 Ga0496104_0056604_2554_3264 226
34 3300048908 Ga0496105_0008435 Ga0496105_0008435_1396_2106 226
35 3300048918 Ga0496115_0093874 Ga0496115_0093874_919_1629 226
36 3300048922 Ga0496119_0057157 Ga0496119_0057157_1343_2053 226
37 3300048923 Ga0496120_0085568 Ga0496120_0085568_161_871 226
38 3300048928 Ga0496125_0366125 Ga0496125_0366125_11_721 226
39 3300048929 Ga0496126_0012552 Ga0496126_0012552_7520_8230 226
40 3300053136 Ga0500559_0235233 Ga0500559_0235233_129_839 226
41 3300053148 Ga0500590_071218 Ga0500590_071218_490_1200 226
42 3300046506 Ga0495583_0070704 Ga0495583_0070704_518_1228 228
43 3300046518 Ga0495631_0018877 Ga0495631_0018877_2499_3209 228
44 3300046519 Ga0495632_0022542 Ga0495632_0022542_399_1109 228
45 3300046537 Ga0495598_0015830 Ga0495598_0015830_13_699 228
46 3300046660 Ga0495625_0028660 Ga0495625_0028660_2348_3058 228
47 3300053079 Ga0500610_0102976 Ga0500610_0102976_638_1348 228
48 3300053105 Ga0500557_003625 Ga0500557_003625_309_1019 228
49 3300025960 Ga0207651_10677195 Ga0207651_106771951 229
50 3300025961 Ga0207712_10549838 Ga0207712_105498381 230
51 3300044658 Ga0466972_0004950 Ga0466972_0004950_4157_4870 230
52 iso_pu_bacteria 2524023129 2524189525 231
53 iso_pu_bacteria 2585428059 2587741651 231
54 iso_pu_bacteria 2585428059 2587741665 231
55 iso_pu_bacteria 2643221676 2644422087 231
56 iso_pu_bacteria 2643221676 2644422125 231
57 iso_pu_bacteria 2643221676 2644425500 231
58 iso_pu_bacteria 2818991459 2819669613 231
59 iso_pu_bacteria 2818991459 2819670060 231
60 iso_pu_bacteria 2857453340 2857454434 231
61 iso_pu_bacteria 2507262055 2507510280 232
62 iso_pu_bacteria 2508501042 2508697769 232
63 iso_pu_bacteria 2511231028 2511400948 232
64 iso_pu_bacteria 2512875026 2512968820 232
65 iso_pu_bacteria 2513237089 2513606428 232
66 iso_pu_bacteria 2513237095 2513648722 232
67 iso_pu_bacteria 2513237102 2513704164 232
68 iso_pu_bacteria 2513237104 2513715996 232
69 iso_pu_bacteria 2513237139 2513878610 232
70 iso_pu_bacteria 2513237156 2513987819 232
71 iso_pu_bacteria 2513237160 2514006130 232
72 iso_pu_bacteria 2513237161 2514013482 232
73 iso_pu_bacteria 2515154112 2515630527 232
74 iso_pu_bacteria 2517487022 2517566428 232
75 iso_pu_bacteria 2524023205 2524441742 232
76 iso_pu_bacteria 2526164713 2527077307 232
77 iso_pu_bacteria 2528768022 2528858708 232
78 iso_pu_bacteria 2585427590 2585825212 232
79 iso_pu_bacteria 2617270741 2617378370 232
80 iso_pu_bacteria 2617270741 2617379214 232
81 iso_pu_bacteria 2744054633 2745075051 232
82 iso_pu_bacteria 2791355091 2792619324 232
83 iso_pu_bacteria 2791355092 2792627096 232
84 iso_pu_bacteria 2802428858 2802719665 232
85 iso_pu_bacteria 2802428859 2802728285 232
86 iso_pu_bacteria 2802428860 2802733495 232
87 iso_pu_bacteria 2802428861 2802738725 232
88 iso_pu_bacteria 2802428862 2802745675 232
89 iso_pu_bacteria 2802428863 2802751440 232
90 iso_pu_bacteria 2802429603 2805917260 232
91 iso_pu_bacteria 2816332527 2818241863 232
92 iso_pu_bacteria 2824600985 2824606642 232
93 iso_pu_bacteria 2824609381 2824612439 232
94 iso_pu_bacteria 2824617872 2824621173 232
95 iso_pu_bacteria 2824626560 2824629714 232
96 iso_pu_bacteria 2824635225 2824637023 232
97 iso_pu_bacteria 2824644064 2824645994 232
98 iso_pu_bacteria 2824653114 2824656848 232
99 iso_pu_bacteria 2824661429 2824664665 232
100 iso_pu_bacteria 2824671348 2824673101 232
101 iso_pu_bacteria 2824679649 2824679947 232
102 iso_pu_bacteria 2824687955 2824689743 232
103 iso_pu_bacteria 2824696289 2824698775 232
104 iso_pu_bacteria 2824704595 2824710200 232
105 iso_pu_bacteria 2824714736 2824717341 232
106 iso_pu_bacteria 2824723954 2824725454 232
107 iso_pu_bacteria 2824732956 2824735375 232
108 iso_pu_bacteria 2824746037 2824749938 232
109 iso_pu_bacteria 2824753945 2824755365 232
110 iso_pu_bacteria 2824763712 2824771140 232
111 iso_pu_bacteria 2824773399 2824778398 232
112 iso_pu_bacteria 2838122688 2838125536 232
113 iso_pu_bacteria 2841941048 2841941802 232
114 iso_pu_bacteria 2841949485 2841951232 232
115 iso_pu_bacteria 2841966195 2841968777 232
116 iso_pu_bacteria 2841974524 2841976027 232
117 iso_pu_bacteria 2841983080 2841989119 232
118 iso_pu_bacteria 2842333319 2842340948 232
119 iso_pu_bacteria 2847939898 2847944836 232
120 iso_pu_bacteria 2849076700 2849080956 232
121 iso_pu_bacteria 2857509624 2857509686 232
122 iso_pu_bacteria 2867312974 2867319290 232
123 iso_pu_bacteria 2867319477 2867320571 232
124 iso_pu_bacteria 2874590934 2874594885 232
125 iso_pu_bacteria 2874620515 2874620975 232
126 iso_pu_bacteria 2874645413 2874646654 232
127 iso_pu_bacteria 2876761206 2876769528 232
128 iso_pu_bacteria 2876771140 2876774273 232
129 iso_pu_bacteria 2876818435 2876822937 232
130 iso_pu_bacteria 2879074833 2879078428 232
131 iso_pu_bacteria 2879099564 2879109898 232
132 iso_pu_bacteria 2879127579 2879128884 232
133 iso_pu_bacteria 2879127579 2879133221 232
134 iso_pu_bacteria 2879142872 2879144239 232
135 iso_pu_bacteria 2879142872 2879149503 232
136 iso_pu_bacteria 2881364244 2881368061 232
137 iso_pu_bacteria 2885366525 2885367526 232
138 iso_pu_bacteria 2885409591 2885414092 232
139 iso_pu_bacteria 2888378607 2888382161 232
140 iso_pu_bacteria 2888388044 2888388526 232
141 iso_pu_bacteria 2888419890 2888422761 232
142 iso_pu_bacteria 2903727486 2903733156 232
143 iso_pu_bacteria 2904666416 2904667061 232
144 iso_pu_bacteria 2904711408 2904718769 232
145 iso_pu_bacteria 2906602504 2906604001 232
146 iso_pu_bacteria 2908775508 2908778442 232
147 iso_pu_bacteria 2915980308 2915982074 232
148 iso_pu_bacteria 2916061851 2916066110 232
149 iso_pu_bacteria 2921250672 2921256765 232
150 iso_pu_bacteria 2922130491 2922130659 232
151 iso_pu_bacteria 2922368715 2922372233 232
152 iso_pu_bacteria 2922393267 2922399163 232
153 iso_pu_bacteria 2929615660 2929616559 232
154 iso_pu_bacteria 2929624759 2929625303 232
155 iso_pu_bacteria 2932784394 2932786763 232
156 iso_pu_bacteria 2932809354 2932817870 232
157 iso_pu_bacteria 2932818245 2932827317 232
158 iso_pu_bacteria 2932828146 2932832646 232
159 iso_pu_bacteria 2933577622 2933578158 232
160 iso_pu_bacteria 2935608549 2935610805 232
161 iso_pu_bacteria 2935616580 2935624915 232
162 iso_pu_bacteria 2935638405 2935645265 232
163 iso_pu_bacteria 2935648319 2935654604 232
164 iso_pu_bacteria 2935656913 2935663484 232
165 iso_pu_bacteria 2935665750 2935671364 232
166 iso_pu_bacteria 2935684952 2935691974 232
167 iso_pu_bacteria 2935694250 2935695079 232
168 iso_pu_bacteria 2935703347 2935708001 232
169 iso_pu_bacteria 2935713505 2935721813 232
170 iso_pu_bacteria 2935722832 2935731189 232
171 iso_pu_bacteria 2935732158 2935738949 232
172 iso_pu_bacteria 2935741537 2935747866 232
173 iso_pu_bacteria 2935750917 2935756450 232
174 iso_pu_bacteria 2935760218 2935761568 232
175 iso_pu_bacteria 2935769743 2935774441 232
176 iso_pu_bacteria 2935785616 2935790540 232
177 iso_pu_bacteria 2935793552 2935799052 232
178 iso_pu_bacteria 2935801545 2935804953 232
179 iso_pu_bacteria 2935810662 2935812116 232
180 iso_pu_bacteria 2935819856 2935820289 232
181 iso_pu_bacteria 2935827899 2935834892 232
182 iso_pu_bacteria 2935837841 2935838897 232
183 iso_pu_bacteria 2935847175 2935849701 232
184 iso_pu_bacteria 2935855204 2935863546 232
185 iso_pu_bacteria 2935864058 2935872757 232
186 iso_pu_bacteria 2935873716 2935882630 232
187 iso_pu_bacteria 2935908558 2935916012 232
188 iso_pu_bacteria 2935916978 2935919160 232
189 iso_pu_bacteria 2935926038 2935933369 232
190 iso_pu_bacteria 2935934488 2935941900 232
191 iso_pu_bacteria 2935942939 2935950290 232
192 iso_pu_bacteria 2935951376 2935958860 232
193 iso_pu_bacteria 2935967501 2935970331 232
194 iso_pu_bacteria 2935975950 2935979836 232
195 iso_pu_bacteria 2935984226 2935987595 232
196 iso_pu_bacteria 2935992306 2935997481 232
197 iso_pu_bacteria 2936002035 2936005260 232
198 iso_pu_bacteria 2936011229 2936017583 232
199 iso_pu_bacteria 2936019824 2936026086 232
200 iso_pu_bacteria 2936028420 2936034984 232
201 iso_pu_bacteria 2936037263 2936038710 232
202 iso_pu_bacteria 2936046547 2936052985 232
203 iso_pu_bacteria 2936055302 2936061916 232
204 iso_pu_bacteria 2937029754 2937034162 232
205 iso_pu_bacteria 2937036028 2937040232 232
206 iso_pu_bacteria 2937078374 2937084643 232
207 iso_pu_bacteria 2937084907 2937087891 232
208 iso_pu_bacteria 2940556831 2940562364 232
209 iso_pu_bacteria 2941531003 2941535273 232
210 iso_pu_bacteria 2941538514 2941539585 232
211 iso_pu_bacteria 2957375807 2957381109 232
212 iso_pu_bacteria 2957437181 2957440706 232
213 iso_pu_bacteria 2960591022 2960597055 232
214 iso_pu_bacteria 2960631154 2960636301 232
215 iso_pu_bacteria 2960680706 2960682259 232
216 iso_pu_bacteria 2960693952 2960699260 232
217 iso_pu_bacteria 2967686174 2967689565 232
218 iso_pu_bacteria 2967728569 2967734172 232
219 iso_pu_bacteria 2970026789 2970031623 232
220 iso_pu_bacteria 2970122695 2970127595 232
221 iso_pu_bacteria 2970143518 2970149405 232
222 iso_pu_bacteria 2977530762 2977535565 232
223 iso_pu_bacteria 2977544691 2977550222 232
224 iso_pu_bacteria 2996887358 2996892674 232
225 iso_pu_bacteria 3005594810 3005597187 232
226 iso_pu_bacteria 3005718088 3005720581 232
227 iso_pu_bacteria 8003999396 8004004901 232
228 iso_pu_bacteria 8005258706 8005264699 232
229 iso_pu_bacteria 8005321885 8005327201 232
230 iso_pu_bacteria 8016622563 8016628718 232
231 iso_pu_bacteria 8016630954 8016632860 232
232 iso_pu_bacteria 8017057580 8017061006 232
233 iso_pu_bacteria 8019547302 8019555805 232
234 iso_pu_bacteria 8019586578 8019588198 232
235 iso_pu_bacteria 8019597564 8019603144 232
236 iso_pu_bacteria 8019608314 8019615393 232
237 iso_pu_bacteria 8019619141 8019626234 232
238 iso_pu_bacteria 8019629233 8019636261 232
239 iso_pu_bacteria 8019638758 8019643409 232
240 iso_pu_bacteria 8019648815 8019656191 232
241 iso_pu_bacteria 8019659431 8019664044 232
242 iso_pu_bacteria 8019668869 8019673658 232
243 iso_pu_bacteria 8019687851 8019688112 232
244 iso_pu_bacteria 8055742211 8055748205 232
245 iso_pu_bacteria 8056967851 8056969014 232
246 3300005841 Ga0068863_100533956 Ga0068863_1005339562 233
247 iso_pu_bacteria 2622736626 2623591016 233
248 3300048925 Ga0496122_0015131 Ga0496122_0015131_64_768 234
249 3300048926 Ga0496123_0002377 Ga0496123_0002377_213_917 234
250 iso_pu_bacteria 8003870546 8003871041 234
251 3300025225 Ga0209566_101668 Ga0209566_1016681 235
252 3300025294 Ga0209025_1002818 Ga0209025_100281814 235
253 3300028800 Ga0265338_10000159 Ga0265338_1000015920 235
254 3300031247 Ga0265340_10052744 Ga0265340_100527442 235
255 iso_pu_bacteria 2619619294 2621272750 235
256 3300003215 JGI25153J46596_10000520 JGI25153J46596_100005205 236
257 3300003215 JGI25153J46596_10026789 JGI25153J46596_100267893 236
258 3300003354 JGI25160J50197_1012598 JGI25160J50197_10125982 236
259 3300003752 Ga0055539_1000029 Ga0055539_100002951 236
260 3300003756 Ga0055533_1000008 Ga0055533_1000008316 236
261 3300003759 Ga0055525_1000634 Ga0055525_10006349 236
262 3300004625 Ga0055543_1003292 Ga0055543_10032921 236
263 3300005262 Ga0065165_1001022 Ga0065165_10010224 236
264 3300005327 Ga0070658_10149431 Ga0070658_101494313 236
265 3300005331 Ga0070670_100403667 Ga0070670_1004036671 236
266 3300005337 Ga0070682_100284315 Ga0070682_1002843152 236
267 3300005353 Ga0070669_100085468 Ga0070669_1000854683 236
268 3300005355 Ga0070671_100116366 Ga0070671_1001163661 236
269 3300005364 Ga0070673_100639405 Ga0070673_1006394051 236
270 3300005435 Ga0070714_100030611 Ga0070714_1000306112 236
271 3300005436 Ga0070713_100036198 Ga0070713_1000361983 236
272 3300005436 Ga0070713_100335022 Ga0070713_1003350222 236
273 3300005437 Ga0070710_10001036 Ga0070710_1000103615 236
274 3300005437 Ga0070710_10331839 Ga0070710_103318391 236
275 3300005438 Ga0070701_10100241 Ga0070701_101002412 236
276 3300005439 Ga0070711_100021868 Ga0070711_1000218686 236
277 3300005440 Ga0070705_100018245 Ga0070705_1000182453 236
278 3300005445 Ga0070708_100260706 Ga0070708_1002607062 236
279 3300005458 Ga0070681_10831060 Ga0070681_108310601 236
280 3300005468 Ga0070707_100000938 Ga0070707_1000009389 236
281 3300005468 Ga0070707_100399423 Ga0070707_1003994231 236
282 3300005471 Ga0070698_100019616 Ga0070698_10001961610 236
283 3300005518 Ga0070699_100219128 Ga0070699_1002191281 236
284 3300005543 Ga0070672_100213769 Ga0070672_1002137692 236
285 3300005548 Ga0070665_100037553 Ga0070665_1000375534 236
286 3300005548 Ga0070665_100059451 Ga0070665_1000594514 236
287 3300005548 Ga0070665_100106448 Ga0070665_1001064482 236
288 3300005548 Ga0070665_100912445 Ga0070665_1009124451 236
289 3300005563 Ga0068855_100007352 Ga0068855_10000735212 236
290 3300005563 Ga0068855_100257782 Ga0068855_1002577821 236
291 3300005563 Ga0068855_101170057 Ga0068855_1011700571 236
292 3300005614 Ga0068856_100216840 Ga0068856_1002168403 236
293 3300005616 Ga0068852_100202531 Ga0068852_1002025313 236
294 3300005616 Ga0068852_101214179 Ga0068852_1012141791 236
295 3300005719 Ga0068861_100090430 Ga0068861_1000904303 236
296 3300005983 Ga0081540_1000913 Ga0081540_100091310 236
297 3300005983 Ga0081540_1008393 Ga0081540_10083936 236
298 3300005985 Ga0081539_10012064 Ga0081539_100120642 236
299 3300006028 Ga0070717_10020693 Ga0070717_100206938 236
300 3300006038 Ga0075365_10016394 Ga0075365_100163945 236
301 3300006048 Ga0075363_100347792 Ga0075363_1003477921 236
302 3300006051 Ga0075364_10196240 Ga0075364_101962401 236
303 3300006058 Ga0075432_10004533 Ga0075432_100045334 236
304 3300006163 Ga0070715_10000676 Ga0070715_100006769 236
305 3300006173 Ga0070716_100018717 Ga0070716_1000187172 236
306 3300006175 Ga0070712_100033141 Ga0070712_1000331412 236
307 3300006175 Ga0070712_100241128 Ga0070712_1002411282 236
308 3300006194 Ga0075427_10030891 Ga0075427_100308911 236
309 3300006846 Ga0075430_100008308 Ga0075430_10000830810 236
310 3300006852 Ga0075433_10464975 Ga0075433_104649751 236
311 3300006881 Ga0068865_100818478 Ga0068865_1008184781 236
312 3300007265 Ga0099794_10063297 Ga0099794_100632972 236
313 3300007265 Ga0099794_10137296 Ga0099794_101372962 236
314 3300009093 Ga0105240_10065005 Ga0105240_100650053 236
315 3300009098 Ga0105245_10177315 Ga0105245_101773152 236
316 3300009101 Ga0105247_10131621 Ga0105247_101316213 236
317 3300009148 Ga0105243_10115658 Ga0105243_101156582 236
318 3300009148 Ga0105243_10200390 Ga0105243_102003902 236
319 3300009174 Ga0105241_10042861 Ga0105241_100428613 236
320 3300009174 Ga0105241_10050637 Ga0105241_100506372 236
321 3300009177 Ga0105248_10328779 Ga0105248_103287792 236
322 3300009545 Ga0105237_10196576 Ga0105237_101965763 236
323 3300009551 Ga0105238_10113499 Ga0105238_101134992 236
324 3300010159 Ga0099796_10070381 Ga0099796_100703812 236
325 3300010375 Ga0105239_10032913 Ga0105239_100329136 236
326 3300011119 Ga0105246_10028542 Ga0105246_100285424 236
327 3300013296 Ga0157374_10035573 Ga0157374_100355732 236
328 3300013306 Ga0163162_10166670 Ga0163162_101666701 236
329 3300013308 Ga0157375_10594567 Ga0157375_105945671 236
330 3300013308 Ga0157375_11422586 Ga0157375_114225861 236
331 3300014325 Ga0163163_10295532 Ga0163163_102955323 236
332 3300014326 Ga0157380_10472863 Ga0157380_104728632 236
333 3300014969 Ga0157376_10346926 Ga0157376_103469263 236
334 3300014969 Ga0157376_10360724 Ga0157376_103607242 236
335 3300016635 Ga0183361_10020 Ga0183361_1002096 236
336 3300017792 Ga0163161_10248315 Ga0163161_102483151 236
337 3300020069 Ga0197907_10389582 Ga0197907_103895821 236
338 3300020081 Ga0206354_10140982 Ga0206354_101409822 236
339 3300021320 Ga0214544_1024720 Ga0214544_10247202 236
340 3300021320 Ga0214544_1039634 Ga0214544_10396342 236
341 3300021321 Ga0214542_1042910 Ga0214542_10429102 236
342 3300021324 Ga0214545_1044035 Ga0214545_10440351 236
343 3300021327 Ga0214543_1043714 Ga0214543_10437142 236
344 3300021361 Ga0213872_10000210 Ga0213872_1000021014 236
345 3300021361 Ga0213872_10006978 Ga0213872_100069787 236
346 3300021361 Ga0213872_10010859 Ga0213872_100108592 236
347 3300021361 Ga0213872_10017289 Ga0213872_100172892 236
348 3300022467 Ga0224712_10146944 Ga0224712_101469441 236
349 3300025226 Ga0209674_100015 Ga0209674_100015348 236
350 3300025230 Ga0209563_100017 Ga0209563_100017445 236
351 3300025242 Ga0209258_100294 Ga0209258_10029428 236
352 3300025253 Ga0209677_100022 Ga0209677_10002256 236
353 3300025253 Ga0209677_104740 Ga0209677_1047402 236
354 3300025254 Ga0209148_1000572 Ga0209148_10005724 236
355 3300025261 Ga0209233_1000643 Ga0209233_10006437 236
356 3300025261 Ga0209233_1023206 Ga0209233_10232062 236
357 3300025272 Ga0209455_1000813 Ga0209455_10008136 236
358 3300025294 Ga0209025_1007567 Ga0209025_10075674 236
359 3300025297 Ga0209758_1000187 Ga0209758_100018747 236
360 3300025297 Ga0209758_1059919 Ga0209758_10599192 236
361 3300025302 Ga0207426_1017824 Ga0207426_10178243 236
362 3300025302 Ga0207426_1029908 Ga0207426_10299082 236
363 3300025885 Ga0207653_10172756 Ga0207653_101727561 236
364 3300025900 Ga0207710_10034859 Ga0207710_100348594 236
365 3300025900 Ga0207710_10105566 Ga0207710_101055661 236
366 3300025901 Ga0207688_10093462 Ga0207688_100934622 236
367 3300025903 Ga0207680_10328046 Ga0207680_103280462 236
368 3300025905 Ga0207685_10020588 Ga0207685_100205881 236
369 3300025906 Ga0207699_10015164 Ga0207699_100151645 236
370 3300025906 Ga0207699_10136702 Ga0207699_101367022 236
371 3300025906 Ga0207699_10192029 Ga0207699_101920292 236
372 3300025910 Ga0207684_10151524 Ga0207684_101515242 236
373 3300025911 Ga0207654_10022988 Ga0207654_100229882 236
374 3300025913 Ga0207695_10003969 Ga0207695_100039693 236
375 3300025913 Ga0207695_10241455 Ga0207695_102414553 236
376 3300025914 Ga0207671_10004407 Ga0207671_100044074 236
377 3300025915 Ga0207693_10035028 Ga0207693_100350282 236
378 3300025915 Ga0207693_10086018 Ga0207693_100860182 236
379 3300025916 Ga0207663_10032814 Ga0207663_100328142 236
380 3300025919 Ga0207657_10055889 Ga0207657_100558892 236
381 3300025920 Ga0207649_10246397 Ga0207649_102463971 236
382 3300025922 Ga0207646_10000289 Ga0207646_1000028942 236
383 3300025923 Ga0207681_10071544 Ga0207681_100715443 236
384 3300025924 Ga0207694_10008183 Ga0207694_100081833 236
385 3300025924 Ga0207694_10136220 Ga0207694_101362201 236
386 3300025925 Ga0207650_10215842 Ga0207650_102158421 236
387 3300025928 Ga0207700_10054163 Ga0207700_100541634 236
388 3300025928 Ga0207700_10449269 Ga0207700_104492691 236
389 3300025931 Ga0207644_10291198 Ga0207644_102911983 236
390 3300025934 Ga0207686_10120233 Ga0207686_101202332 236
391 3300025939 Ga0207665_10003278 Ga0207665_1000327817 236
392 3300025939 Ga0207665_10005097 Ga0207665_100050972 236
393 3300025939 Ga0207665_10052248 Ga0207665_100522482 236
394 3300025940 Ga0207691_10219263 Ga0207691_102192632 236
395 3300025942 Ga0207689_10138863 Ga0207689_101388632 236
396 3300025949 Ga0207667_10116134 Ga0207667_101161342 236
397 3300025961 Ga0207712_10130414 Ga0207712_101304142 236
398 3300025961 Ga0207712_10193828 Ga0207712_101938282 236
399 3300025981 Ga0207640_10061940 Ga0207640_100619403 236
400 3300026035 Ga0207703_10370503 Ga0207703_103705032 236
401 3300026041 Ga0207639_10065556 Ga0207639_100655562 236
402 3300026067 Ga0207678_10055518 Ga0207678_100555184 236
403 3300026067 Ga0207678_10136683 Ga0207678_101366832 236
404 3300026078 Ga0207702_10174209 Ga0207702_101742091 236
405 3300026078 Ga0207702_10188948 Ga0207702_101889481 236
406 3300026088 Ga0207641_10254082 Ga0207641_102540823 236
407 3300026089 Ga0207648_10040310 Ga0207648_100403104 236
408 3300026118 Ga0207675_100053707 Ga0207675_1000537071 236
409 3300026121 Ga0207683_10101117 Ga0207683_101011172 236
410 3300026142 Ga0207698_10081550 Ga0207698_100815502 236
411 3300027671 Ga0209588_1013621 Ga0209588_10136213 236
412 3300027907 Ga0207428_10007648 Ga0207428_100076485 236
413 3300028379 Ga0268266_10009760 Ga0268266_100097603 236
414 3300028379 Ga0268266_10017775 Ga0268266_100177753 236
415 3300028379 Ga0268266_10761704 Ga0268266_107617042 236
416 3300028380 Ga0268265_10108901 Ga0268265_101089012 236
417 3300028380 Ga0268265_10456890 Ga0268265_104568901 236
418 3300028556 Ga0265337_1001144 Ga0265337_100114415 236
419 3300028558 Ga0265326_10000343 Ga0265326_100003435 236
420 3300028563 Ga0265319_1000708 Ga0265319_10007085 236
421 3300028573 Ga0265334_10000334 Ga0265334_100003349 236
422 3300028577 Ga0265318_10003470 Ga0265318_100034706 236
423 3300028653 Ga0265323_10000353 Ga0265323_1000035320 236
424 3300028654 Ga0265322_10028530 Ga0265322_100285303 236
425 3300028666 Ga0265336_10000288 Ga0265336_100002889 236
426 3300028794 Ga0307515_10142325 Ga0307515_101423252 236
427 3300028800 Ga0265338_10000479 Ga0265338_1000047950 236
428 3300028800 Ga0265338_10001718 Ga0265338_100017189 236
429 3300029957 Ga0265324_10006282 Ga0265324_100062825 236
430 3300031251 Ga0265327_10000447 Ga0265327_1000044720 236
431 3300031616 Ga0307508_10003896 Ga0307508_100038963 236
432 3300031730 Ga0307516_10248521 Ga0307516_102485211 236
433 3300032004 Ga0307414_10641964 Ga0307414_106419642 236
434 3300033180 Ga0307510_10033295 Ga0307510_100332952 236
435 3300033180 Ga0307510_10144638 Ga0307510_101446382 236
436 3300035692 Ga0373935_0216083 Ga0373935_0216083_577_1287 236
437 3300035725 Ga0373947_0025745 Ga0373947_0025745_1746_2456 236
438 3300037418 Ga0395900_0224704 Ga0395900_0224704_912_1622 236
439 3300037471 Ga0395905_0085700 Ga0395905_0085700_340_1050 236
440 3300039447 Ga0436361_0272793 Ga0436361_0272793_1464_2174 236
441 3300039447 Ga0436361_0274756 Ga0436361_0274756_39850_40563 236
442 3300039447 Ga0436361_0340185 Ga0436361_0340185_2082_2792 236
443 3300039447 Ga0436361_0432288 Ga0436361_0432288_262_972 236
444 3300039447 Ga0436361_0448572 Ga0436361_0448572_1297_2007 236
445 3300039447 Ga0436361_0675026 Ga0436361_0675026_1851_2564 236
446 3300044683 Ga0466965_0007235 Ga0466965_0007235_3054_3767 236
447 3300044694 Ga0466963_0157337 Ga0466963_0157337_203_916 236
448 3300044842 Ga0466957_0019249 Ga0466957_0019249_2968_3678 236
449 3300044842 Ga0466957_0118898 Ga0466957_0118898_81_794 236
450 3300044842 Ga0466957_0345653 Ga0466957_0345653_60_773 236
451 3300044901 Ga0466960_0000402 Ga0466960_0000402_5616_6329 236
452 3300044901 Ga0466960_0013703 Ga0466960_0013703_2043_2753 236
453 3300045976 Ga0466967_0073220 Ga0466967_0073220_255_968 236
454 3300046457 Ga0495590_0048362 Ga0495590_0048362_209_922 236
455 3300046459 Ga0495629_0014766 Ga0495629_0014766_1403_2116 236
456 3300046460 Ga0495638_0003259 Ga0495638_0003259_11666_12376 236
457 3300046474 Ga0495605_0002953 Ga0495605_0002953_2705_3418 236
458 3300046477 Ga0495664_0053449 Ga0495664_0053449_1364_2074 236
459 3300046492 Ga0495585_0272204 Ga0495585_0272204_96_806 236
460 3300046499 Ga0495594_0018592 Ga0495594_0018592_1596_2312 236
461 3300046499 Ga0495594_0169069 Ga0495594_0169069_48_761 236
462 3300046501 Ga0495607_0138006 Ga0495607_0138006_171_884 236
463 3300046501 Ga0495607_0148399 Ga0495607_0148399_73_786 236
464 3300046501 Ga0495607_0189695 Ga0495607_0189695_75_800 236
465 3300046506 Ga0495583_0011138 Ga0495583_0011138_2460_3173 236
466 3300046507 Ga0495606_0006484 Ga0495606_0006484_2258_2971 236
467 3300046507 Ga0495606_0012941 Ga0495606_0012941_3149_3865 236
468 3300046507 Ga0495606_0016165 Ga0495606_0016165_4000_4710 236
469 3300046507 Ga0495606_0181392 Ga0495606_0181392_450_1160 236
470 3300046512 Ga0495610_0036672 Ga0495610_0036672_1438_2151 236
471 3300046513 Ga0495616_0004895 Ga0495616_0004895_7592_8305 236
472 3300046515 Ga0495620_0002190 Ga0495620_0002190_2864_3577 236
473 3300046518 Ga0495631_0004911 Ga0495631_0004911_806_1519 236
474 3300046518 Ga0495631_0238028 Ga0495631_0238028_34_744 236
475 3300046519 Ga0495632_0146205 Ga0495632_0146205_51_764 236
476 3300046519 Ga0495632_0169060 Ga0495632_0169060_231_941 236
477 3300046522 Ga0495643_0010249 Ga0495643_0010249_3104_3817 236
478 3300046524 Ga0495648_0263099 Ga0495648_0263099_41_754 236
479 3300046526 Ga0495666_0108132 Ga0495666_0108132_462_1175 236
480 3300046538 Ga0495609_0222355 Ga0495609_0222355_43_753 236
481 3300046542 Ga0495597_0211541 Ga0495597_0211541_53_763 236
482 3300046557 Ga0495622_0214955 Ga0495622_0214955_61_771 236
483 3300046558 Ga0495633_0062286 Ga0495633_0062286_732_1445 236
484 3300046615 Ga0495656_0097912 Ga0495656_0097912_360_1070 236
485 3300046616 Ga0495668_0001382 Ga0495668_0001382_19025_19741 236
486 3300046616 Ga0495668_0105985 Ga0495668_0105985_586_1299 236
487 3300046616 Ga0495668_0158732 Ga0495668_0158732_459_1169 236
488 3300046642 Ga0495634_0065601 Ga0495634_0065601_916_1629 236
489 3300046648 Ga0495611_0106769 Ga0495611_0106769_222_935 236
490 3300046660 Ga0495625_0005301 Ga0495625_0005301_3230_3946 236
491 3300046660 Ga0495625_0018319 Ga0495625_0018319_4544_5257 236
492 3300046660 Ga0495625_0018985 Ga0495625_0018985_1985_2698 236
493 3300046660 Ga0495625_0248203 Ga0495625_0248203_298_1008 236
494 3300046660 Ga0495625_0262302 Ga0495625_0262302_158_868 236
495 3300046664 Ga0495659_0068722 Ga0495659_0068722_552_1262 236
496 3300046681 Ga0495647_0030572 Ga0495647_0030572_824_1534 236
497 3300046684 Ga0495669_0000718 Ga0495669_0000718_3962_4675 236
498 3300046684 Ga0495669_0006828 Ga0495669_0006828_1653_2366 236
499 3300046684 Ga0495669_0040336 Ga0495669_0040336_1237_1947 236
500 3300046690 Ga0495624_0398414 Ga0495624_0398414_47_760 236
501 3300046694 Ga0495649_0187996 Ga0495649_0187996_22_732 236
502 3300046694 Ga0495649_0279861 Ga0495649_0279861_93_806 236
503 3300046794 Ga0495589_0210803 Ga0495589_0210803_121_831 236
504 3300047323 Ga0495683_0079205 Ga0495683_0079205_206_919 236
505 3300047443 Ga0495687_019102 Ga0495687_019102_2024_2737 236
506 3300047443 Ga0495687_030647 Ga0495687_030647_70_780 236
507 3300047445 Ga0495677_0008675 Ga0495677_0008675_2987_3700 236
508 3300047445 Ga0495677_0128205 Ga0495677_0128205_156_869 236
509 3300047447 Ga0495685_011048 Ga0495685_011048_270_983 236
510 3300047469 Ga0495673_0038365 Ga0495673_0038365_139_849 236
511 3300047470 Ga0495681_0075497 Ga0495681_0075497_212_925 236
512 3300047472 Ga0495686_0000893 Ga0495686_0000893_16893_17603 236
513 3300047472 Ga0495686_0069067 Ga0495686_0069067_253_963 236
514 3300047472 Ga0495686_0305278 Ga0495686_0305278_44_754 236
515 3300047673 Ga0495593_0193405 Ga0495593_0193405_161_871 236
516 3300048091 Ga0495626_0001114 Ga0495626_0001114_19119_19835 236
517 3300048091 Ga0495626_0025041 Ga0495626_0025041_1259_1972 236
518 3300048903 Ga0496100_0322775 Ga0496100_0322775_373_1083 236
519 3300048904 Ga0496101_0159123 Ga0496101_0159123_250_969 236
520 3300048905 Ga0496102_0338126 Ga0496102_0338126_529_1239 236
521 3300048905 Ga0496102_0903371 Ga0496102_0903371_19_729 236
522 3300048906 Ga0496103_0023624 Ga0496103_0023624_2645_3355 236
523 3300048906 Ga0496103_0317100 Ga0496103_0317100_18_728 236
524 3300048907 Ga0496104_0045686 Ga0496104_0045686_584_1303 236
525 3300048907 Ga0496104_0140668 Ga0496104_0140668_279_989 236
526 3300048907 Ga0496104_0672867 Ga0496104_0672867_145_861 236
527 3300048908 Ga0496105_0027974 Ga0496105_0027974_610_1329 236
528 3300048908 Ga0496105_0172365 Ga0496105_0172365_256_966 236
529 3300048909 Ga0496106_0173709 Ga0496106_0173709_203_913 236
530 3300048909 Ga0496106_0417442 Ga0496106_0417442_246_956 236
531 3300048910 Ga0496107_0028607 Ga0496107_0028607_241_960 236
532 3300048911 Ga0496108_0024057 Ga0496108_0024057_2620_3339 236
533 3300048912 Ga0496109_0041715 Ga0496109_0041715_2823_3542 236
534 3300048913 Ga0496110_0222561 Ga0496110_0222561_646_1365 236
535 3300048915 Ga0496112_0001243 Ga0496112_0001243_16633_17373 236
536 3300048915 Ga0496112_0044494 Ga0496112_0044494_2455_3165 236
537 3300048915 Ga0496112_0149683 Ga0496112_0149683_55_774 236
538 3300048915 Ga0496112_0364644 Ga0496112_0364644_226_942 236
539 3300048917 Ga0496114_0737091 Ga0496114_0737091_107_817 236
540 3300048918 Ga0496115_0219757 Ga0496115_0219757_571_1281 236
541 3300048918 Ga0496115_0254983 Ga0496115_0254983_388_1107 236
542 3300048918 Ga0496115_0395729 Ga0496115_0395729_60_770 236
543 3300048918 Ga0496115_0708090 Ga0496115_0708090_71_781 236
544 3300048920 Ga0496117_0120602 Ga0496117_0120602_271_981 236
545 3300048921 Ga0496118_0117030 Ga0496118_0117030_243_953 236
546 3300048921 Ga0496118_0333692 Ga0496118_0333692_70_780 236
547 3300048922 Ga0496119_0098815 Ga0496119_0098815_634_1344 236
548 3300048923 Ga0496120_0032704 Ga0496120_0032704_336_1046 236
549 3300048924 Ga0496121_0016795 Ga0496121_0016795_3360_4070 236
550 3300048924 Ga0496121_0036905 Ga0496121_0036905_2273_2983 236
551 3300048924 Ga0496121_0239754 Ga0496121_0239754_30_740 236
552 3300048929 Ga0496126_0230270 Ga0496126_0230270_251_961 236
553 3300049460 Ga0495682_0041601 Ga0495682_0041601_784_1494 236
554 3300049581 Ga0501047_0659856 Ga0501047_0659856_103_816 236
555 3300050492 nmdc:mga0yw44_29643_c1 nmdc:mga0yw44_29643_c1_110_820 236
556 3300050507 nmdc:mga05p37_5759_c2 nmdc:mga05p37_5759_c2_3746_4456 236
557 3300050509 nmdc:mga0qj67_9334_c1 nmdc:mga0qj67_9334_c1_2697_3407 236
558 3300050510 nmdc:mga06r32_109893_c1 nmdc:mga06r32_109893_c1_1844_2554 236
559 3300050510 nmdc:mga06r32_51938_c1 nmdc:mga06r32_51938_c1_2872_3582 236
560 3300050512 nmdc:mga0n895_5246_c1 nmdc:mga0n895_5246_c1_4042_4752 236
561 3300050513 nmdc:mga0rr50_113220_c1 nmdc:mga0rr50_113220_c1_296_1006 236
562 3300050515 nmdc:mga0a205_281119_c1 nmdc:mga0a205_281119_c1_347_1072 236
563 3300050515 nmdc:mga0a205_9442_c1 nmdc:mga0a205_9442_c1_1794_2504 236
564 3300050516 nmdc:mga0sz30_204725_c1 nmdc:mga0sz30_204725_c1_35_745 236
565 3300053079 Ga0500610_0136553 Ga0500610_0136553_276_986 236
566 3300053083 Ga0495655_0003565 Ga0495655_0003565_1456_2166 236
567 3300053085 Ga0495619_0033348 Ga0495619_0033348_683_1393 236
568 3300053087 Ga0500643_000060 Ga0500643_000060_51546_52256 236
569 3300053088 Ga0500644_0055575 Ga0500644_0055575_482_1192 236
570 3300053093 Ga0500651_0004315 Ga0500651_0004315_558_1538 236
571 3300053094 Ga0500566_0007485 Ga0500566_0007485_4396_5106 236
572 3300053098 Ga0500650_0150692 Ga0500650_0150692_258_968 236
573 3300053103 Ga0500555_009585 Ga0500555_009585_323_1033 236
574 3300053105 Ga0500557_000007 Ga0500557_000007_34493_35203 236
575 3300053108 Ga0500562_001825 Ga0500562_001825_3619_4329 236
576 3300053118 Ga0500594_0015966 Ga0500594_0015966_211_921 236
577 3300053119 Ga0500595_015228 Ga0500595_015228_1248_1958 236
578 3300053122 Ga0500608_074058 Ga0500608_074058_468_1178 236
579 3300053130 Ga0500642_0092125 Ga0500642_0092125_300_1010 236
580 3300053138 Ga0500564_081579 Ga0500564_081579_324_1034 236
581 3300053139 Ga0500568_0014640 Ga0500568_0014640_418_1128 236
582 3300053142 Ga0500577_0213615 Ga0500577_0213615_66_776 236
583 3300053148 Ga0500590_004472 Ga0500590_004472_4754_5467 236
584 3300053151 Ga0500604_0068242 Ga0500604_0068242_231_941 236
585 3300053153 Ga0500616_0016604 Ga0500616_0016604_885_1595 236
586 3300053153 Ga0500616_0083369 Ga0500616_0083369_745_1455 236
587 3300053155 Ga0500620_000722 Ga0500620_000722_3446_4156 236
588 3300053156 Ga0500622_0010418 Ga0500622_0010418_1728_2438 236
589 3300053158 Ga0500627_0028863 Ga0500627_0028863_955_1665 236
590 3300053177 Ga0500636_0006462 Ga0500636_0006462_3970_4680 236
591 3300053729 Ga0500625_002773 Ga0500625_002773_3651_4361 236
592 3300053736 Ga0500599_000509 Ga0500599_000509_1957_2667 236
593 3300053737 Ga0500601_000696 Ga0500601_000696_926_1636 236
594 3300055283 Ga0500661_021756 Ga0500661_021756_73_783 236
595 iso_pu_bacteria 2935675223 2935683727 236
596 iso_pu_bacteria 8055412473 8055418939 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

224

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

265

0.93

PF08659

KR

KR domain

39

212

0.85

PF23441

52

265

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un1-assembly1.cif.gz_A crystal structure of an oxidoreductase from sinorhizobium meliloti 1021 0.9828 4 236
3un1-assembly1.cif.gz_A crystal structure of an oxidoreductase from sinorhizobium meliloti 1021 0.9664 4 236
4qec-assembly1.cif.gz_A elxo with nadp bound 0.9322 5 234
4cqm-assembly3.cif.gz_O crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9319 5 233
6qhe-assembly2.cif.gz_B alcohol dehydrogenase from arthrobacter sp. ts-15 in complex with nad+ 0.9306 6 236
ID Description Score Start End Superfamily
3un1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9805 4 236 3.40.50.720
3un1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 4 236 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 2 174 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 6 232 3.40.50.720
4qedB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9316 5 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A2WA29-F1-model_v4 deleted 0.9898 5 236
AF-A0A7Z7GVI4-F1-model_v4 deleted 0.9895 1 222
AF-A0A2U0XY21-F1-model_v4 deleted 0.9883 1 125
AF-A0A7I8CZV1-F1-model_v4 Gluconate 5-dehydrogenase 0.9865 1 187 GO:0016616
GO:0030497
AF-A0A1H6L4B0-F1-model_v4 deleted 0.9864 1 214

Feature Viewer

pLDDT pTM Quality
92.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map