metagRoot

F467516

General Info

Members	Datasets	Scaffolds	Average Seq Length
596	215	596	148

Family's Representative Sequence

Representative Sequence	3300005439\|Ga0070711_100284159\|Ga0070711_1002841592
Length	164
Sequence	MQSTGTAATSAANKPAGGKRSMVWMIFAFGAVLSWGIYGVALHKGQVLLGNPLKALLCVGVAYFLIGVLAPVLALSGQGGLGGFNLSGTIWAGLGGALVCIIYAFRNGGLPNYVMPLVFGGAPVINVLVSTLMHPPKNAPNPLLYLGYLLAVAGAGMVLYFKPS

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
28	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
29	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
30	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
31	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
32	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
33	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
34	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
35	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
36	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
37	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
38	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
39	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
40	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
41	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
42	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
52	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
53	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
54	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
65	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
71	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
72	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
73	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
74	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
75	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
77	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
78	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
81	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
83	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
99	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
136	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
140	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
141	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
142	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
143	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
144	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
145	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
146	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
147	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
148	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
149	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
150	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
151	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
152	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
153	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
154	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
155	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
156	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
157	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
158	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
159	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
160	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
161	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
162	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
163	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
164	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
165	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
166	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
167	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
168	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
169	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
170	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
171	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
172	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
173	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
174	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
175	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
176	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
177	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
178	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
179	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
180	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
181	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
182	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
183	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
184	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
185	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
186	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
187	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
188	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
189	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
190	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
191	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
192	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
193	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
194	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
195	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
196	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
197	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
200	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
201	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
202	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
203	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
204	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
205	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
206	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
207	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
208	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
209	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
210	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
211	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
212	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
213	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
214	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
215	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.67
Nodule	0
Rhizoplane	1.34
Rhizosphere	97.99
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_2157287	2162886012	Unclassified	909
2	Ga0065704_10030966	3300005289	Bacteria	985
3	Ga0065704_10285878	3300005289	Bacteria	913
4	Ga0065712_10057244	3300005290	Unclassified	699
5	Ga0065712_10068334	3300005290	Bacteria	11606
6	Ga0065712_10069287	3300005290	Bacteria	7588
7	Ga0065712_10094091	3300005290	Unclassified	2248
8	Ga0065715_10000495	3300005293	Bacteria	10833
9	Ga0065715_10027854	3300005293	Bacteria	2017
10	Ga0065715_10290232	3300005293	Unclassified	1065
11	Ga0065707_10086558	3300005295	Bacteria	5402
12	Ga0065707_10318304	3300005295	Bacteria	971
13	Ga0070676_10198699	3300005328	Bacteria	1313
14	Ga0070683_100671298	3300005329	Bacteria	992
15	Ga0070690_100059747	3300005330	Unclassified	2452
16	Ga0070690_100072741	3300005330	Bacteria	2235
17	Ga0070690_100092130	3300005330	Bacteria	1998
18	Ga0070670_100056317	3300005331	Bacteria	3374
19	Ga0070670_100096219	3300005331	Bacteria	2547
20	Ga0070670_100099111	3300005331	Bacteria	2508
21	Ga0070670_100138886	3300005331	Bacteria	2101
22	Ga0070670_100452090	3300005331	Bacteria	1138
23	Ga0070670_101384434	3300005331	Unclassified	645
24	Ga0070670_101603264	3300005331	Unclassified	598
25	Ga0070677_10172380	3300005333	Bacteria	1024
26	Ga0068869_100090262	3300005334	Bacteria	2302
27	Ga0068869_100135274	3300005334	Bacteria	1898
28	Ga0068869_100202119	3300005334	Bacteria	1567
29	Ga0068869_100259093	3300005334	Bacteria	1392
30	Ga0070666_10054180	3300005335	Bacteria	2706
31	Ga0070680_100781635	3300005336	Unclassified	822
32	Ga0070680_101071376	3300005336	Unclassified	696
33	Ga0070682_100000059	3300005337	Bacteria	106643
34	Ga0070682_100928211	3300005337	Unclassified	717
35	Ga0068868_101956825	3300005338	Unclassified	556
36	Ga0070689_100189254	3300005340	Unclassified	1675
37	Ga0070689_100210655	3300005340	Unclassified	1590
38	Ga0070689_100393501	3300005340	Unclassified	1170
39	Ga0070689_100486456	3300005340	Bacteria	1055
40	Ga0070689_100672029	3300005340	Bacteria	902
41	Ga0070689_100804235	3300005340	Unclassified	827
42	Ga0070689_101197090	3300005340	Unclassified	682
43	Ga0070691_10462148	3300005341	Unclassified	727
44	Ga0070687_100111084	3300005343	Unclassified	1551
45	Ga0070687_100197804	3300005343	Bacteria	1216
46	Ga0070687_100254700	3300005343	Unclassified	1092
47	Ga0070687_100697683	3300005343	Unclassified	709
48	Ga0070661_100827208	3300005344	Bacteria	761
49	Ga0070668_100016155	3300005347	Bacteria	5586
50	Ga0070669_100008642	3300005353	Bacteria	7265
51	Ga0070669_100138896	3300005353	Bacteria	1871
52	Ga0070669_101912441	3300005353	Unclassified	518
53	Ga0070675_100000419	3300005354	Bacteria	28965
54	Ga0070675_100007036	3300005354	Bacteria	8649
55	Ga0070675_100129777	3300005354	Bacteria	2147
56	Ga0070675_100280667	3300005354	Bacteria	1463
57	Ga0070675_100296575	3300005354	Bacteria	1423
58	Ga0070675_100355825	3300005354	Bacteria	1299
59	Ga0070675_100796797	3300005354	Unclassified	863
60	Ga0070671_100002555	3300005355	Bacteria	14102
61	Ga0070671_100019293	3300005355	Bacteria	5547
62	Ga0070671_100230731	3300005355	Bacteria	1571
63	Ga0070671_100628422	3300005355	Unclassified	929
64	Ga0070674_100068536	3300005356	Bacteria	2500
65	Ga0070674_100072966	3300005356	Bacteria	2432
66	Ga0070674_100089975	3300005356	Bacteria	2213
67	Ga0070674_100241947	3300005356	Bacteria	1413
68	Ga0070674_100479928	3300005356	Unclassified	1032
69	Ga0070674_101740462	3300005356	Bacteria	564
70	Ga0070673_100013445	3300005364	Bacteria	5662
71	Ga0070673_100023245	3300005364	Bacteria	4527
72	Ga0070673_100211375	3300005364	Bacteria	1676
73	Ga0070673_100635458	3300005364	Bacteria	976
74	Ga0070673_100706537	3300005364	Unclassified	926
75	Ga0070688_100011858	3300005365	Bacteria	4863
76	Ga0070688_100053037	3300005365	Bacteria	2535
77	Ga0070688_100281698	3300005365	Bacteria	1195
78	Ga0070688_100469176	3300005365	Unclassified	944
79	Ga0070688_100696729	3300005365	Unclassified	786
80	Ga0070667_100150712	3300005367	Bacteria	2043
81	Ga0070709_10112778	3300005434	Unclassified	1830
82	Ga0070701_10032942	3300005438	Unclassified	2585
83	Ga0070701_10106489	3300005438	Bacteria	1561
84	Ga0070711_100284159	3300005439	Unclassified	1310
85	Ga0070705_100131241	3300005440	Bacteria	1635
86	Ga0070700_100007106	3300005441	Bacteria	6022
87	Ga0070700_100318817	3300005441	Bacteria	1141
88	Ga0070700_100579114	3300005441	Unclassified	876
89	Ga0070700_100675677	3300005441	Bacteria	818
90	Ga0070694_100088578	3300005444	Bacteria	2167
91	Ga0070694_100163358	3300005444	Bacteria	1636
92	Ga0070694_100235556	3300005444	Bacteria	1379
93	Ga0070694_100582864	3300005444	Bacteria	899
94	Ga0070694_100801590	3300005444	Bacteria	772
95	Ga0070694_100935855	3300005444	Unclassified	717
96	Ga0070708_100120999	3300005445	Bacteria	2415
97	Ga0070708_101582531	3300005445	Unclassified	610
98	Ga0070663_100024710	3300005455	Bacteria	4047
99	Ga0070678_100409390	3300005456	Bacteria	1180
100	Ga0070662_100088661	3300005457	Bacteria	2319
101	Ga0070662_100094430	3300005457	Bacteria	2252
102	Ga0070662_100360487	3300005457	Bacteria	1193
103	Ga0070662_100424673	3300005457	Bacteria	1100
104	Ga0068867_100089994	3300005459	Bacteria	2327
105	Ga0068867_100231157	3300005459	Bacteria	1495
106	Ga0068867_101091876	3300005459	Unclassified	728
107	Ga0070706_100021636	3300005467	Bacteria	5923
108	Ga0070706_100396335	3300005467	Bacteria	1285
109	Ga0070707_101115956	3300005468	Unclassified	755
110	Ga0070698_101024429	3300005471	Bacteria	773
111	Ga0070698_101149899	3300005471	Bacteria	725
112	Ga0070699_100970975	3300005518	Bacteria	779
113	Ga0070684_100373508	3300005535	Unclassified	1313
114	Ga0070684_101779299	3300005535	Bacteria	581
115	Ga0070697_100000293	3300005536	Bacteria	40046
116	Ga0068853_101043328	3300005539	Bacteria	788
117	Ga0070672_100040674	3300005543	Bacteria	3568
118	Ga0070672_100050613	3300005543	Bacteria	3236
119	Ga0070672_100263071	3300005543	Bacteria	1455
120	Ga0070672_100423328	3300005543	Bacteria	1144
121	Ga0070672_100518363	3300005543	Unclassified	1032
122	Ga0070672_100529553	3300005543	Bacteria	1021
123	Ga0070672_100580518	3300005543	Bacteria	975
124	Ga0070686_100005534	3300005544	Bacteria	6989
125	Ga0070686_100021629	3300005544	Bacteria	3828
126	Ga0070686_100090087	3300005544	Bacteria	2050
127	Ga0070686_100122388	3300005544	Unclassified	1788
128	Ga0070686_100271605	3300005544	Bacteria	1247
129	Ga0070686_100402336	3300005544	Bacteria	1041
130	Ga0070686_100422326	3300005544	Bacteria	1019
131	Ga0070695_100129279	3300005545	Bacteria	1739
132	Ga0070695_100733574	3300005545	Bacteria	787
133	Ga0070695_100975307	3300005545	Unclassified	688
134	Ga0070696_100116920	3300005546	Unclassified	1926
135	Ga0070696_100161343	3300005546	Unclassified	1652
136	Ga0070696_101677923	3300005546	Unclassified	547
137	Ga0070704_100034334	3300005549	Bacteria	3439
138	Ga0070704_100106047	3300005549	Unclassified	2129
139	Ga0070704_100186091	3300005549	Bacteria	1665
140	Ga0070704_100236280	3300005549	Bacteria	1494
141	Ga0070704_100485422	3300005549	Bacteria	1070
142	Ga0070704_100750034	3300005549	Bacteria	869
143	Ga0070664_100032040	3300005564	Bacteria	4396
144	Ga0070664_100442402	3300005564	Bacteria	1192
145	Ga0068857_100164863	3300005577	Bacteria	2012
146	Ga0068857_100415955	3300005577	Bacteria	1253
147	Ga0068857_100811259	3300005577	Bacteria	894
148	Ga0068857_100981215	3300005577	Unclassified	813
149	Ga0068854_100302250	3300005578	Bacteria	1295
150	Ga0068854_100884233	3300005578	Unclassified	784
151	Ga0070702_100258750	3300005615	Bacteria	1184
152	Ga0070702_100481940	3300005615	Unclassified	907
153	Ga0070702_101068615	3300005615	Unclassified	643
154	Ga0068859_100002378	3300005617	Bacteria	19152
155	Ga0068859_100002800	3300005617	Bacteria	17665
156	Ga0068859_100093617	3300005617	Bacteria	3056
157	Ga0068859_100113669	3300005617	Bacteria	2771
158	Ga0068859_100380838	3300005617	Bacteria	1506
159	Ga0068859_100451569	3300005617	Bacteria	1381
160	Ga0068859_100525718	3300005617	Bacteria	1278
161	Ga0068859_100897462	3300005617	Bacteria	971
162	Ga0068859_101438596	3300005617	Unclassified	760
163	Ga0068864_100047696	3300005618	Bacteria	3680
164	Ga0068864_100099258	3300005618	Bacteria	2579
165	Ga0068864_100402332	3300005618	Bacteria	1301
166	Ga0068864_101096789	3300005618	Unclassified	792
167	Ga0068864_101339259	3300005618	Bacteria	717
168	Ga0068866_10091269	3300005718	Bacteria	1659
169	Ga0068861_100008375	3300005719	Bacteria	7116
170	Ga0068861_100009784	3300005719	Bacteria	6629
171	Ga0068861_100018429	3300005719	Unclassified	4973
172	Ga0068861_100033870	3300005719	Unclassified	3772
173	Ga0068861_102346836	3300005719	Unclassified	536
174	Ga0068870_10192721	3300005840	Bacteria	1231
175	Ga0068870_10201622	3300005840	Bacteria	1207
176	Ga0068870_10247287	3300005840	Bacteria	1104
177	Ga0068870_10347511	3300005840	Bacteria	951
178	Ga0068863_100255762	3300005841	Bacteria	1692
179	Ga0068863_100341974	3300005841	Bacteria	1456
180	Ga0068863_100587263	3300005841	Unclassified	1102
181	Ga0068863_101813126	3300005841	Archaea	620
182	Ga0068858_100112626	3300005842	Bacteria	2541
183	Ga0068858_102002054	3300005842	Bacteria	572
184	Ga0068860_100271414	3300005843	Bacteria	1655
185	Ga0068860_101676153	3300005843	Unclassified	658
186	Ga0068860_101944619	3300005843	Bacteria	610
187	Ga0068862_100120342	3300005844	Bacteria	2313
188	Ga0068862_100168973	3300005844	Bacteria	1957
189	Ga0068862_100293122	3300005844	Bacteria	1495
190	Ga0068862_100316420	3300005844	Bacteria	1439
191	Ga0068862_100436672	3300005844	Bacteria	1231
192	Ga0068862_101782376	3300005844	Bacteria	625
193	Ga0081540_1220361	3300005983	Bacteria	675
194	Ga0075364_10056478	3300006051	Bacteria	2570
195	Ga0097621_100002263	3300006237	Bacteria	13169
196	Ga0097621_100087045	3300006237	Bacteria	2608
197	Ga0097621_101283895	3300006237	Bacteria	691
198	Ga0068871_100287265	3300006358	Bacteria	1440
199	Ga0068871_101226125	3300006358	Bacteria	704
200	Ga0075428_100070892	3300006844	Bacteria	3809
201	Ga0075428_100074758	3300006844	Bacteria	3701
202	Ga0075428_100390485	3300006844	Bacteria	1492
203	Ga0075428_100802738	3300006844	Unclassified	1000
204	Ga0075428_101144768	3300006844	Unclassified	821
205	Ga0075430_100021997	3300006846	Bacteria	5420
206	Ga0075430_100056574	3300006846	Bacteria	3298
207	Ga0075430_100197150	3300006846	Unclassified	1673
208	Ga0075431_100081098	3300006847	Bacteria	3350
209	Ga0075431_100255832	3300006847	Bacteria	1778
210	Ga0075433_10000042	3300006852	Bacteria	51751
211	Ga0075433_10000874	3300006852	Bacteria	21140
212	Ga0075433_10050727	3300006852	Bacteria	3613
213	Ga0075433_10184037	3300006852	Bacteria	1859
214	Ga0075433_10326224	3300006852	Bacteria	1358
215	Ga0075433_10966277	3300006852	Unclassified	742
216	Ga0075433_11136085	3300006852	Bacteria	679
217	Ga0075434_100001063	3300006871	Bacteria	22430
218	Ga0075434_100016467	3300006871	Bacteria	7107
219	Ga0075434_100025150	3300006871	Bacteria	5825
220	Ga0075434_100188306	3300006871	Bacteria	2084
221	Ga0075429_100111632	3300006880	Bacteria	2389
222	Ga0075429_100564975	3300006880	Unclassified	997
223	Ga0075429_100609393	3300006880	Bacteria	957
224	Ga0068865_101078561	3300006881	Unclassified	706
225	Ga0097620_100002378	3300006931	Bacteria	19152
226	Ga0097620_100002800	3300006931	Bacteria	17665
227	Ga0097620_100093614	3300006931	Bacteria	3056
228	Ga0097620_100113672	3300006931	Bacteria	2771
229	Ga0097620_100380858	3300006931	Bacteria	1506
230	Ga0097620_100451565	3300006931	Bacteria	1381
231	Ga0097620_100525696	3300006931	Bacteria	1278
232	Ga0097620_100897426	3300006931	Bacteria	971
233	Ga0097620_101438637	3300006931	Unclassified	760
234	Ga0075435_100654399	3300007076	Bacteria	912
235	Ga0075435_101260746	3300007076	Unclassified	647
236	Ga0105250_10117034	3300009092	Bacteria	1094
237	Ga0111539_10003028	3300009094	Bacteria	22290
238	Ga0111539_10003931	3300009094	Bacteria	19533
239	Ga0111539_10013361	3300009094	Bacteria	10261
240	Ga0111539_10015325	3300009094	Bacteria	9548
241	Ga0111539_10022166	3300009094	Bacteria	7808
242	Ga0111539_10026016	3300009094	Bacteria	7162
243	Ga0111539_10044021	3300009094	Bacteria	5350
244	Ga0111539_10068844	3300009094	Bacteria	4178
245	Ga0111539_10075091	3300009094	Bacteria	3983
246	Ga0111539_10103089	3300009094	Bacteria	3348
247	Ga0111539_10232545	3300009094	Unclassified	2146
248	Ga0111539_10374758	3300009094	Unclassified	1657
249	Ga0111539_10677769	3300009094	Unclassified	1200
250	Ga0111539_12259403	3300009094	Unclassified	631
251	Ga0105245_10151151	3300009098	Bacteria	2196
252	Ga0105245_10492144	3300009098	Bacteria	1241
253	Ga0105245_10608424	3300009098	Unclassified	1120
254	Ga0105247_11073068	3300009101	Bacteria	634
255	Ga0114129_10040695	3300009147	Bacteria	6551
256	Ga0114129_10053949	3300009147	Bacteria	5637
257	Ga0114129_10103872	3300009147	Bacteria	3928
258	Ga0114129_10136767	3300009147	Bacteria	3361
259	Ga0114129_10249532	3300009147	Bacteria	2383
260	Ga0114129_10629673	3300009147	Bacteria	1387
261	Ga0114129_10827272	3300009147	Unclassified	1179
262	Ga0114129_11733719	3300009147	Unclassified	761
263	Ga0105243_10375198	3300009148	Bacteria	1314
264	Ga0105243_10899452	3300009148	Unclassified	880
265	Ga0105243_12336496	3300009148	Unclassified	572
266	Ga0105241_10013504	3300009174	Bacteria	5984
267	Ga0105242_10346258	3300009176	Bacteria	1371
268	Ga0105242_10360845	3300009176	Unclassified	1345
269	Ga0105242_10684477	3300009176	Unclassified	1001
270	Ga0105242_10883691	3300009176	Bacteria	892
271	Ga0105242_11768748	3300009176	Unclassified	656
272	Ga0105242_12577468	3300009176	Unclassified	557
273	Ga0105248_10043039	3300009177	Bacteria	5064
274	Ga0105248_10061782	3300009177	Bacteria	4207
275	Ga0105248_10140990	3300009177	Bacteria	2719
276	Ga0105248_12207283	3300009177	Bacteria	626
277	Ga0105238_10369079	3300009551	Bacteria	1425
278	Ga0105238_11487645	3300009551	Unclassified	706
279	Ga0105249_10000201	3300009553	Bacteria	68199
280	Ga0105249_10101186	3300009553	Unclassified	2710
281	Ga0105249_10202045	3300009553	Unclassified	1945
282	Ga0105249_10263038	3300009553	Bacteria	1715
283	Ga0105249_10746096	3300009553	Unclassified	1041
284	Ga0105249_11202970	3300009553	Unclassified	829
285	Ga0105249_11255060	3300009553	Unclassified	812
286	Ga0105246_10192438	3300011119	Bacteria	1580
287	Ga0105246_11334494	3300011119	Unclassified	666
288	Ga0157371_10281302	3300013102	Bacteria	1202
289	Ga0157374_10679229	3300013296	Bacteria	1042
290	Ga0157374_11333097	3300013296	Unclassified	740
291	Ga0157378_10066715	3300013297	Unclassified	3224
292	Ga0157378_10106521	3300013297	Bacteria	2565
293	Ga0157378_10328191	3300013297	Bacteria	1488
294	Ga0157378_10343270	3300013297	Bacteria	1457
295	Ga0157378_10610456	3300013297	Bacteria	1103
296	Ga0157378_10897486	3300013297	Bacteria	917
297	Ga0157378_10898546	3300013297	Unclassified	916
298	Ga0157378_11937207	3300013297	Unclassified	639
299	Ga0163162_10000128	3300013306	Bacteria	68199
300	Ga0163162_10243700	3300013306	Bacteria	1929
301	Ga0163162_10594826	3300013306	Unclassified	1233
302	Ga0157375_10040407	3300013308	Unclassified	4496
303	Ga0157375_10121286	3300013308	Bacteria	2724
304	Ga0157375_10188111	3300013308	Bacteria	2219
305	Ga0157375_10567470	3300013308	Bacteria	1296
306	Ga0163163_10086769	3300014325	Bacteria	3139
307	Ga0163163_10154750	3300014325	Unclassified	2337
308	Ga0163163_10258993	3300014325	Bacteria	1790
309	Ga0163163_10392831	3300014325	Bacteria	1445
310	Ga0163163_10561946	3300014325	Bacteria	1204
311	Ga0157380_10005208	3300014326	Bacteria	9088
312	Ga0157380_10139984	3300014326	Unclassified	2077
313	Ga0157380_10143435	3300014326	Unclassified	2055
314	Ga0157380_10325032	3300014326	Bacteria	1428
315	Ga0157380_10441735	3300014326	Bacteria	1247
316	Ga0157380_10509101	3300014326	Bacteria	1171
317	Ga0157380_11826281	3300014326	Bacteria	667
318	Ga0157380_11955340	3300014326	Unclassified	648
319	Ga0157377_10018431	3300014745	Bacteria	3627
320	Ga0157377_10172809	3300014745	Bacteria	1353
321	Ga0157377_10202980	3300014745	Unclassified	1260
322	Ga0157377_10522087	3300014745	Bacteria	834
323	Ga0157377_10913157	3300014745	Unclassified	657
324	Ga0157376_10045130	3300014969	Bacteria	3627
325	Ga0157376_10440115	3300014969	Unclassified	1269
326	Ga0157376_10566380	3300014969	Bacteria	1126
327	Ga0163161_10016306	3300017792	Bacteria	5186
328	Ga0163161_10326226	3300017792	Bacteria	1215
329	Ga0163161_11140430	3300017792	Bacteria	672
330	Ga0207697_10103685	3300025315	Bacteria	1214
331	Ga0207697_10123927	3300025315	Unclassified	1114
332	Ga0207688_10271856	3300025901	Bacteria	1031
333	Ga0207688_10314220	3300025901	Bacteria	960
334	Ga0207680_10644411	3300025903	Unclassified	758
335	Ga0207645_10273300	3300025907	Bacteria	1121
336	Ga0207643_10106057	3300025908	Bacteria	1651
337	Ga0207693_10557747	3300025915	Bacteria	893
338	Ga0207662_10041067	3300025918	Bacteria	2722
339	Ga0207662_10089717	3300025918	Bacteria	1889
340	Ga0207662_10129893	3300025918	Bacteria	1588
341	Ga0207649_10584987	3300025920	Bacteria	857
342	Ga0207681_10004181	3300025923	Bacteria	8928
343	Ga0207681_10014725	3300025923	Unclassified	4869
344	Ga0207681_11587436	3300025923	Unclassified	548
345	Ga0207681_11641772	3300025923	Unclassified	538
346	Ga0207650_10046358	3300025925	Bacteria	3201
347	Ga0207650_10075584	3300025925	Bacteria	2542
348	Ga0207650_10113115	3300025925	Bacteria	2104
349	Ga0207650_10134663	3300025925	Bacteria	1937
350	Ga0207650_10158799	3300025925	Bacteria	1790
351	Ga0207650_11143192	3300025925	Unclassified	663
352	Ga0207659_10001276	3300025926	Bacteria	15083
353	Ga0207659_10001773	3300025926	Bacteria	12753
354	Ga0207659_10026791	3300025926	Bacteria	3895
355	Ga0207659_10042255	3300025926	Bacteria	3195
356	Ga0207659_10469966	3300025926	Bacteria	1061
357	Ga0207659_10624829	3300025926	Bacteria	919
358	Ga0207659_10693257	3300025926	Bacteria	872
359	Ga0207687_10190981	3300025927	Bacteria	1594
360	Ga0207687_10213720	3300025927	Bacteria	1514
361	Ga0207700_10617028	3300025928	Unclassified	966
362	Ga0207644_10002223	3300025931	Bacteria	12594
363	Ga0207644_10345317	3300025931	Bacteria	1207
364	Ga0207644_10777672	3300025931	Bacteria	800
365	Ga0207706_10069074	3300025933	Bacteria	3107
366	Ga0207706_10094615	3300025933	Bacteria	2628
367	Ga0207706_10355540	3300025933	Bacteria	1273
368	Ga0207706_10485548	3300025933	Bacteria	1067
369	Ga0207709_10017685	3300025935	Bacteria	3982
370	Ga0207709_10604925	3300025935	Bacteria	868
371	Ga0207709_11312364	3300025935	Bacteria	598
372	Ga0207670_10070967	3300025936	Bacteria	2407
373	Ga0207670_10161723	3300025936	Unclassified	1672
374	Ga0207670_10232695	3300025936	Unclassified	1416
375	Ga0207670_10328191	3300025936	Bacteria	1206
376	Ga0207669_10117437	3300025937	Bacteria	1798
377	Ga0207669_10613221	3300025937	Unclassified	886
378	Ga0207704_10114591	3300025938	Unclassified	1830
379	Ga0207704_10310428	3300025938	Bacteria	1212
380	Ga0207704_11163985	3300025938	Unclassified	657
381	Ga0207691_10002560	3300025940	Bacteria	17760
382	Ga0207691_10017783	3300025940	Bacteria	6740
383	Ga0207691_10056171	3300025940	Bacteria	3587
384	Ga0207691_10397287	3300025940	Bacteria	1176
385	Ga0207691_10500442	3300025940	Unclassified	1032
386	Ga0207711_10142408	3300025941	Bacteria	2158
387	Ga0207711_10151589	3300025941	Bacteria	2092
388	Ga0207711_10336610	3300025941	Bacteria	1396
389	Ga0207711_10893234	3300025941	Unclassified	826
390	Ga0207689_10023742	3300025942	Bacteria	5144
391	Ga0207689_10066483	3300025942	Bacteria	2964
392	Ga0207689_10246164	3300025942	Bacteria	1478
393	Ga0207689_10759780	3300025942	Bacteria	818
394	Ga0207689_10789767	3300025942	Bacteria	801
395	Ga0207651_10013757	3300025960	Bacteria	4644
396	Ga0207651_10054004	3300025960	Unclassified	2750
397	Ga0207651_10210675	3300025960	Bacteria	1564
398	Ga0207712_10000330	3300025961	Bacteria	43368
399	Ga0207712_10025816	3300025961	Bacteria	3907
400	Ga0207712_10297770	3300025961	Unclassified	1322
401	Ga0207712_11641433	3300025961	Unclassified	576
402	Ga0207668_10007655	3300025972	Bacteria	6427
403	Ga0207668_10300336	3300025972	Bacteria	1325
404	Ga0207668_10453596	3300025972	Unclassified	1095
405	Ga0207640_10367465	3300025981	Bacteria	1161
406	Ga0207640_10935142	3300025981	Unclassified	759
407	Ga0207658_10379243	3300025986	Bacteria	1238
408	Ga0207658_10539669	3300025986	Bacteria	1043
409	Ga0207677_10203250	3300026023	Bacteria	1576
410	Ga0207677_10884956	3300026023	Unclassified	804
411	Ga0207677_11169195	3300026023	Bacteria	703
412	Ga0207678_10049226	3300026067	Bacteria	3642
413	Ga0207708_10001112	3300026075	Bacteria	20185
414	Ga0207708_10124377	3300026075	Unclassified	2012
415	Ga0207708_10748465	3300026075	Unclassified	838
416	Ga0207708_11308687	3300026075	Bacteria	635
417	Ga0207641_10221427	3300026088	Bacteria	1755
418	Ga0207641_10481575	3300026088	Bacteria	1203
419	Ga0207641_10530900	3300026088	Bacteria	1145
420	Ga0207641_11609769	3300026088	Unclassified	651
421	Ga0207648_10007333	3300026089	Bacteria	10859
422	Ga0207648_10194114	3300026089	Bacteria	1800
423	Ga0207648_10282933	3300026089	Bacteria	1483
424	Ga0207648_10313523	3300026089	Unclassified	1408
425	Ga0207676_10268766	3300026095	Bacteria	1543
426	Ga0207676_10493216	3300026095	Bacteria	1162
427	Ga0207676_11115020	3300026095	Unclassified	780
428	Ga0207676_11997686	3300026095	Unclassified	579
429	Ga0207674_10182697	3300026116	Bacteria	2048
430	Ga0207674_10412126	3300026116	Bacteria	1306
431	Ga0207674_10899999	3300026116	Unclassified	853
432	Ga0207675_100002007	3300026118	Bacteria	20297
433	Ga0207675_100004930	3300026118	Bacteria	12863
434	Ga0207675_100090975	3300026118	Unclassified	2869
435	Ga0207675_100170992	3300026118	Bacteria	2077
436	Ga0207675_100193346	3300026118	Bacteria	1952
437	Ga0207675_100273554	3300026118	Bacteria	1639
438	Ga0207675_100312861	3300026118	Bacteria	1532
439	Ga0207675_100915171	3300026118	Unclassified	894
440	Ga0207675_101593037	3300026118	Unclassified	673
441	Ga0207675_101803509	3300026118	Unclassified	631
442	Ga0207683_10237968	3300026121	Bacteria	1661
443	Ga0207683_10298218	3300026121	Bacteria	1475
444	Ga0207683_10307454	3300026121	Bacteria	1451
445	Ga0207683_10394348	3300026121	Bacteria	1273
446	Ga0207428_10001923	3300027907	Bacteria	21027
447	Ga0207428_10005976	3300027907	Bacteria	11271
448	Ga0207428_10023316	3300027907	Bacteria	5205
449	Ga0207428_10027991	3300027907	Unclassified	4686
450	Ga0207428_10084780	3300027907	Unclassified	2468
451	Ga0207428_10116430	3300027907	Unclassified	2052
452	Ga0207428_10152222	3300027907	Bacteria	1760
453	Ga0207428_10608673	3300027907	Bacteria	787
454	Ga0268266_10457747	3300028379	Unclassified	1214
455	Ga0268266_11129513	3300028379	Bacteria	758
456	Ga0268265_10031751	3300028380	Bacteria	3817
457	Ga0268265_10109066	3300028380	Bacteria	2255
458	Ga0268265_10181839	3300028380	Bacteria	1807
459	Ga0268265_10209592	3300028380	Bacteria	1697
460	Ga0268265_10262870	3300028380	Bacteria	1535
461	Ga0268265_10635329	3300028380	Bacteria	1024
462	Ga0268265_10938153	3300028380	Bacteria	852
463	Ga0268264_10071942	3300028381	Unclassified	2932
464	Ga0268264_10087740	3300028381	Bacteria	2675
465	Ga0268264_10820498	3300028381	Unclassified	930
466	Ga0268264_11610444	3300028381	Unclassified	660
467	Ga0316182_1383427	3300030745	Bacteria	924
468	Ga0307408_100590213	3300031548	Bacteria	986
469	Ga0307405_10896534	3300031731	Unclassified	750
470	Ga0307412_10466723	3300031911	Bacteria	1044
471	Ga0307416_100332446	3300032002	Bacteria	1528
472	Ga0307416_101722044	3300032002	Unclassified	731
473	Ga0307415_101207549	3300032126	Unclassified	713
474	Ga0373925_0721668	3300037068	Bacteria	822
475	Ga0395905_0392759	3300037471	Bacteria	1282
476	Ga0395901_0307342	3300038443	Bacteria	1643
477	Ga0395901_1058390	3300038443	Unclassified	784
478	Ga0439433_0008414	3300041999	Unclassified	2237
479	Ga0439462_0063924	3300042015	Bacteria	996
480	Ga0439446_0060396	3300042156	Bacteria	1145
481	Ga0439435_0078925	3300042436	Unclassified	985
482	Ga0439435_0114753	3300042436	Unclassified	839
483	Ga0439444_0065991	3300042437	Unclassified	765
484	Ga0453684_2252766	3300044712	Unclassified	543
485	Ga0495580_0331481	3300046472	Unclassified	1033
486	Ga0495582_0205195	3300046473	Unclassified	1126
487	Ga0495663_0000150	3300046525	Bacteria	28417
488	Ga0495598_0000410	3300046537	Bacteria	7712
489	Ga0495598_0007619	3300046537	Bacteria	2491
490	Ga0495621_0000571	3300046539	Bacteria	9179
491	Ga0495621_0009323	3300046539	Bacteria	2977
492	Ga0495621_0087804	3300046539	Bacteria	1168
493	Ga0495656_0009621	3300046615	Bacteria	3483
494	Ga0495659_0305558	3300046664	Unclassified	673
495	Ga0495659_0416339	3300046664	Unclassified	581
496	Ga0495658_0081827	3300046683	Bacteria	1897
497	Ga0495670_0112943	3300046691	Bacteria	1407
498	Ga0495581_0348218	3300047315	Bacteria	865
499	Ga0495672_0060080	3300047320	Bacteria	2197
500	Ga0495615_0035162	3300048090	Bacteria	1223
501	Ga0495615_0135646	3300048090	Bacteria	723
502	Ga0496104_1366861	3300048907	Unclassified	611
503	Ga0496105_0411717	3300048908	Unclassified	1072
504	Ga0496108_1599008	3300048911	Unclassified	539
505	Ga0496109_0244818	3300048912	Bacteria	1688
506	Ga0496110_0543618	3300048913	Bacteria	1056
507	Ga0496112_0298795	3300048915	Bacteria	1556
508	Ga0496113_0273555	3300048916	Bacteria	1350
509	Ga0496113_1015783	3300048916	Unclassified	653
510	Ga0501032_0966735	3300049569	Unclassified	535
511	Ga0501033_0616033	3300049570	Bacteria	743
512	Ga0501036_0136079	3300049572	Bacteria	2074
513	Ga0501036_1673493	3300049572	Unclassified	513
514	Ga0501037_0271261	3300049573	Bacteria	1184
515	Ga0501037_0342852	3300049573	Unclassified	1032
516	Ga0501038_0113618	3300049574	Bacteria	2241
517	Ga0501039_0275982	3300049575	Bacteria	1321
518	Ga0501040_0074752	3300049576	Bacteria	2342
519	Ga0501041_0713141	3300049577	Bacteria	642
520	Ga0501048_0044384	3300049582	Bacteria	3179
521	Ga0501067_0042798	3300049583	Bacteria	2515
522	Ga0501068_0083436	3300049584	Bacteria	1964
523	Ga0501069_0114061	3300049585	Bacteria	1541
524	Ga0501070_0664098	3300049586	Bacteria	827
525	Ga0501071_1156218	3300049587	Unclassified	598
526	Ga0501072_0172618	3300049588	Bacteria	1725
527	Ga0501074_0275477	3300049590	Bacteria	1196
528	Ga0501075_0068892	3300049591	Bacteria	2673
529	Ga0501076_0052500	3300049592	Bacteria	3229
530	Ga0501077_0223296	3300049593	Bacteria	1197
531	Ga0501079_0041193	3300049741	Bacteria	3564
532	Ga0501079_0696687	3300049741	Bacteria	799
533	Ga0501080_0040754	3300049742	Bacteria	4331
534	Ga0501080_1515350	3300049742	Bacteria	570
535	Ga0501081_0153957	3300049743	Bacteria	1653
536	Ga0501081_0522229	3300049743	Bacteria	886
537	Ga0501081_0739311	3300049743	Bacteria	739
538	Ga0501083_0058060	3300049744	Bacteria	2590
539	Ga0501270_047274	3300049767	Unclassified	769
540	Ga0501044_0717622	3300049823	Bacteria	884
541	Ga0501045_0053202	3300049824	Bacteria	2958
542	nmdc:mga00v17_183558_c1	3300050491	Bacteria	1350
543	nmdc:mga05p37_10678_c1	3300050507	Bacteria	10899
544	nmdc:mga05p37_372662_c1	3300050507	Bacteria	1675
545	nmdc:mga05p37_3_c1	3300050507	Bacteria	172656
546	nmdc:mga05p37_432002_c1	3300050507	Bacteria	1530
547	nmdc:mga05p37_623900_c1	3300050507	Bacteria	1213
548	nmdc:mga05p37_78130_c1	3300050507	Bacteria	4075
549	nmdc:mga09592_144657_c1	3300050508	Bacteria	2050
550	nmdc:mga09592_22997_c1	3300050508	Bacteria	5144
551	nmdc:mga09592_287406_c1	3300050508	Bacteria	1426
552	nmdc:mga09592_570688_c1	3300050508	Bacteria	971
553	nmdc:mga0qj67_14423_c1	3300050509	Bacteria	5974
554	nmdc:mga0qj67_442204_c1	3300050509	Bacteria	1048
555	nmdc:mga06r32_154808_c1	3300050510	Bacteria	2273
556	nmdc:mga06r32_1651276_c1	3300050510	Unclassified	579
557	nmdc:mga06r32_20785_c1	3300050510	Bacteria	6048
558	nmdc:mga06r32_261093_c1	3300050510	Bacteria	1720
559	nmdc:mga08y16_1037132_c1	3300050511	Unclassified	798
560	nmdc:mga08y16_12435_c1	3300050511	Bacteria	8957
561	nmdc:mga08y16_1544172_c1	3300050511	Bacteria	623
562	nmdc:mga08y16_172578_c1	3300050511	Unclassified	2246
563	nmdc:mga08y16_2079_c1	3300050511	Bacteria	20522
564	nmdc:mga08y16_265880_c1	3300050511	Bacteria	1771
565	nmdc:mga08y16_293472_c1	3300050511	Unclassified	1676
566	nmdc:mga08y16_41760_c1	3300050511	Unclassified	4804
567	nmdc:mga08y16_441036_c1	3300050511	Bacteria	1329
568	nmdc:mga08y16_5878_c1	3300050511	Bacteria	12856
569	nmdc:mga08y16_643947_c1	3300050511	Bacteria	1065
570	nmdc:mga08y16_721791_c1	3300050511	Unclassified	995
571	nmdc:mga08y16_75090_c1	3300050511	Unclassified	3524
572	nmdc:mga0n895_365011_c1	3300050512	Bacteria	1462
573	nmdc:mga0n895_42460_c1	3300050512	Bacteria	4424
574	nmdc:mga0n895_45698_c1	3300050512	Bacteria	4274
575	nmdc:mga0n895_479221_c1	3300050512	Bacteria	1255
576	nmdc:mga0rr50_1198347_c1	3300050513	Bacteria	645
577	nmdc:mga0rr50_256174_c1	3300050513	Bacteria	1454
578	nmdc:mga0rr50_485631_c1	3300050513	Bacteria	1049
579	nmdc:mga0a205_1495_c1	3300050515	Bacteria	19924
580	nmdc:mga0a205_214692_c1	3300050515	Bacteria	1811
581	nmdc:mga0a205_252835_c1	3300050515	Bacteria	1641
582	nmdc:mga0a205_2879_c1	3300050515	Bacteria	15216
583	nmdc:mga0a205_60169_c1	3300050515	Bacteria	3668
584	nmdc:mga0a205_918625_c1	3300050515	Unclassified	722
585	Ga0500628_009177	3300053129	Unclassified	1738
586	Ga0500628_236571	3300053129	Bacteria	535
587	Ga0501084_0009975	3300054114	Bacteria	7850
588	Ga0590071_000267	3300059421	Bacteria	15185
589	Ga0590074_002358	3300059423	Bacteria	3098
590	Ga0590075_001928	3300059424	Bacteria	5027
591	Ga0590077_001436	3300059426	Bacteria	5582
592	Ga0501082_0069529	3300060353	Bacteria	3031
593	Ga0501082_0269793	3300060353	Unclassified	1481
594	Ga0530510_0278471	3300061734	Bacteria	1249
595	Ga0530510_0299690	3300061734	Bacteria	1203
596	Ga0530510_0438838	3300061734	Bacteria	986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026118	Ga0207675_100312861	Ga0207675_1003128612	122
2	3300005617	Ga0068859_100002800	Ga0068859_1000028004	125
3	3300005840	Ga0068870_10192721	Ga0068870_101927212	125
4	3300006931	Ga0097620_100002800	Ga0097620_1000028004	125
5	3300028380	Ga0268265_10181839	Ga0268265_101818392	125
6	3300005356	Ga0070674_101740462	Ga0070674_1017404621	127
7	3300049767	Ga0501270_047274	Ga0501270_047274_336_722	128
8	3300005338	Ga0068868_101956825	Ga0068868_1019568251	130
9	3300005354	Ga0070675_100296575	Ga0070675_1002965752	130
10	3300005364	Ga0070673_100013445	Ga0070673_1000134455	130
11	3300005457	Ga0070662_100360487	Ga0070662_1003604872	130
12	3300009094	Ga0111539_10022166	Ga0111539_100221667	130
13	3300014745	Ga0157377_10522087	Ga0157377_105220872	130
14	3300025315	Ga0207697_10103685	Ga0207697_101036851	130
15	3300025907	Ga0207645_10273300	Ga0207645_102733002	130
16	3300025926	Ga0207659_10042255	Ga0207659_100422552	130
17	3300025933	Ga0207706_10485548	Ga0207706_104855482	130
18	3300025960	Ga0207651_10013757	Ga0207651_100137572	130
19	3300050511	nmdc:mga08y16_75090_c1	nmdc:mga08y16_75090_c1_235_627	130
20	3300005843	Ga0068860_101944619	Ga0068860_1019446192	131
21	3300042436	Ga0439435_0078925	Ga0439435_0078925_269_718	131
22	3300042437	Ga0439444_0065991	Ga0439444_0065991_47_496	131
23	3300025938	Ga0207704_11163985	Ga0207704_111639851	132
24	3300025972	Ga0207668_10300336	Ga0207668_103003362	132
25	3300026118	Ga0207675_101803509	Ga0207675_1018035092	132
26	3300028381	Ga0268264_10820498	Ga0268264_108204981	132
27	3300014326	Ga0157380_10509101	Ga0157380_105091012	133
28	3300005355	Ga0070671_100628422	Ga0070671_1006284221	135
29	3300005365	Ga0070688_100696729	Ga0070688_1006967291	135
30	3300005544	Ga0070686_100122388	Ga0070686_1001223882	135
31	3300005617	Ga0068859_100380838	Ga0068859_1003808381	135
32	3300006931	Ga0097620_100380858	Ga0097620_1003808582	135
33	3300005457	Ga0070662_100424673	Ga0070662_1004246732	137
34	3300006847	Ga0075431_100255832	Ga0075431_1002558322	137
35	3300049569	Ga0501032_0966735	Ga0501032_0966735_17_466	137
36	3300049570	Ga0501033_0616033	Ga0501033_0616033_49_498	137
37	3300049572	Ga0501036_0136079	Ga0501036_0136079_10_459	137
38	3300049573	Ga0501037_0271261	Ga0501037_0271261_139_588	137
39	3300049574	Ga0501038_0113618	Ga0501038_0113618_317_766	137
40	3300049576	Ga0501040_0074752	Ga0501040_0074752_1124_1573	137
41	3300049582	Ga0501048_0044384	Ga0501048_0044384_2048_2497	137
42	3300049584	Ga0501068_0083436	Ga0501068_0083436_970_1419	137
43	3300049586	Ga0501070_0664098	Ga0501070_0664098_365_814	137
44	3300049588	Ga0501072_0172618	Ga0501072_0172618_706_1155	137
45	3300049590	Ga0501074_0275477	Ga0501074_0275477_384_833	137
46	3300049591	Ga0501075_0068892	Ga0501075_0068892_1798_2247	137
47	3300049592	Ga0501076_0052500	Ga0501076_0052500_585_1034	137
48	3300049593	Ga0501077_0223296	Ga0501077_0223296_276_725	137
49	3300049741	Ga0501079_0041193	Ga0501079_0041193_830_1279	137
50	3300049742	Ga0501080_0040754	Ga0501080_0040754_368_817	137
51	3300049742	Ga0501080_1515350	Ga0501080_1515350_59_508	137
52	3300049743	Ga0501081_0739311	Ga0501081_0739311_23_472	137
53	3300049744	Ga0501083_0058060	Ga0501083_0058060_1281_1730	137
54	3300049823	Ga0501044_0717622	Ga0501044_0717622_261_710	137
55	3300049824	Ga0501045_0053202	Ga0501045_0053202_835_1284	137
56	3300050508	nmdc:mga09592_287406_c1	nmdc:mga09592_287406_c1_705_1154	137
57	3300050509	nmdc:mga0qj67_14423_c1	nmdc:mga0qj67_14423_c1_821_1270	137
58	3300050510	nmdc:mga06r32_261093_c1	nmdc:mga06r32_261093_c1_46_495	137
59	3300054114	Ga0501084_0009975	Ga0501084_0009975_5376_5825	137
60	3300060353	Ga0501082_0069529	Ga0501082_0069529_2375_2824	137
61	3300061734	Ga0530510_0278471	Ga0530510_0278471_315_764	137
62	3300061734	Ga0530510_0438838	Ga0530510_0438838_462_911	137
63	3300005467	Ga0070706_100396335	Ga0070706_1003963352	138
64	3300042436	Ga0439435_0114753	Ga0439435_0114753_212_661	138
65	3300050510	nmdc:mga06r32_20785_c1	nmdc:mga06r32_20785_c1_1247_1732	138
66	3300005445	Ga0070708_101582531	Ga0070708_1015825311	139
67	3300049743	Ga0501081_0522229	Ga0501081_0522229_69_512	142
68	3300059421	Ga0590071_000267	Ga0590071_000267_10035_10478	142
69	3300059423	Ga0590074_002358	Ga0590074_002358_947_1390	142
70	3300059424	Ga0590075_001928	Ga0590075_001928_2833_3276	142
71	3300059426	Ga0590077_001436	Ga0590077_001436_4804_5247	142
72	3300005535	Ga0070684_100373508	Ga0070684_1003735082	143
73	3300006844	Ga0075428_100074758	Ga0075428_1000747584	143
74	3300006846	Ga0075430_100056574	Ga0075430_1000565742	143
75	3300006880	Ga0075429_100111632	Ga0075429_1001116321	143
76	3300009094	Ga0111539_10003931	Ga0111539_1000393113	143
77	3300009147	Ga0114129_10136767	Ga0114129_101367673	143
78	3300014325	Ga0163163_10258993	Ga0163163_102589932	143
79	3300027907	Ga0207428_10001923	Ga0207428_1000192313	143
80	3300044712	Ga0453684_2252766	Ga0453684_2252766_70_516	143
81	3300046472	Ga0495580_0331481	Ga0495580_0331481_566_1012	143
82	3300047315	Ga0495581_0348218	Ga0495581_0348218_266_712	143
83	3300048907	Ga0496104_1366861	Ga0496104_1366861_74_520	143
84	3300048908	Ga0496105_0411717	Ga0496105_0411717_85_531	143
85	3300050507	nmdc:mga05p37_623900_c1	nmdc:mga05p37_623900_c1_453_899	143
86	3300050508	nmdc:mga09592_22997_c1	nmdc:mga09592_22997_c1_882_1328	143
87	3300050509	nmdc:mga0qj67_442204_c1	nmdc:mga0qj67_442204_c1_133_579	143
88	3300050510	nmdc:mga06r32_1651276_c1	nmdc:mga06r32_1651276_c1_119_565	143
89	3300050511	nmdc:mga08y16_12435_c1	nmdc:mga08y16_12435_c1_2345_2791	143
90	3300025941	Ga0207711_10336610	Ga0207711_103366102	144
91	3300025942	Ga0207689_10759780	Ga0207689_107597801	144
92	3300025981	Ga0207640_10367465	Ga0207640_103674652	144
93	3300030745	Ga0316182_1383427	Ga0316182_13834272	144
94	3300049573	Ga0501037_0342852	Ga0501037_0342852_215_664	144
95	3300050507	nmdc:mga05p37_3_c1	nmdc:mga05p37_3_c1_172089_172538	144
96	3300005290	Ga0065712_10057244	Ga0065712_100572441	145
97	3300005364	Ga0070673_100706537	Ga0070673_1007065371	145
98	3300005577	Ga0068857_100981215	Ga0068857_1009812152	145
99	3300005617	Ga0068859_100113669	Ga0068859_1001136692	145
100	3300006844	Ga0075428_101144768	Ga0075428_1011447681	145
101	3300006931	Ga0097620_100113672	Ga0097620_1001136722	145
102	3300009094	Ga0111539_10015325	Ga0111539_100153253	145
103	3300014325	Ga0163163_10561946	Ga0163163_105619462	145
104	3300026116	Ga0207674_10412126	Ga0207674_104121261	145
105	3300027907	Ga0207428_10152222	Ga0207428_101522221	145
106	3300050511	nmdc:mga08y16_172578_c1	nmdc:mga08y16_172578_c1_681_1133	145
107	3300009147	Ga0114129_10103872	Ga0114129_101038722	146
108	3300049572	Ga0501036_1673493	Ga0501036_1673493_40_480	146
109	3300049741	Ga0501079_0696687	Ga0501079_0696687_232_672	146
110	3300049743	Ga0501081_0153957	Ga0501081_0153957_98_538	146
111	3300050507	nmdc:mga05p37_78130_c1	nmdc:mga05p37_78130_c1_2977_3417	146
112	3300050512	nmdc:mga0n895_42460_c1	nmdc:mga0n895_42460_c1_3278_3718	146
113	3300050515	nmdc:mga0a205_1495_c1	nmdc:mga0a205_1495_c1_18778_19218	146
114	3300005365	Ga0070688_100469176	Ga0070688_1004691762	147
115	3300005543	Ga0070672_100263071	Ga0070672_1002630712	147
116	3300005844	Ga0068862_101782376	Ga0068862_1017823761	147
117	3300009176	Ga0105242_11768748	Ga0105242_117687481	147
118	3300026023	Ga0207677_10884956	Ga0207677_108849561	147
119	3300028380	Ga0268265_10938153	Ga0268265_109381531	147
120	3300005329	Ga0070683_100671298	Ga0070683_1006712982	148
121	3300005330	Ga0070690_100072741	Ga0070690_1000727413	148
122	3300005331	Ga0070670_100099111	Ga0070670_1000991112	148
123	3300005331	Ga0070670_100452090	Ga0070670_1004520902	148
124	3300005333	Ga0070677_10172380	Ga0070677_101723802	148
125	3300005334	Ga0068869_100202119	Ga0068869_1002021191	148
126	3300005336	Ga0070680_101071376	Ga0070680_1010713761	148
127	3300005343	Ga0070687_100254700	Ga0070687_1002547001	148
128	3300005344	Ga0070661_100827208	Ga0070661_1008272081	148
129	3300005354	Ga0070675_100280667	Ga0070675_1002806672	148
130	3300005355	Ga0070671_100019293	Ga0070671_1000192933	148
131	3300005356	Ga0070674_100089975	Ga0070674_1000899753	148
132	3300005364	Ga0070673_100211375	Ga0070673_1002113752	148
133	3300005434	Ga0070709_10112778	Ga0070709_101127781	148
134	3300005438	Ga0070701_10106489	Ga0070701_101064892	148
135	3300005441	Ga0070700_100579114	Ga0070700_1005791142	148
136	3300005444	Ga0070694_100235556	Ga0070694_1002355562	148
137	3300005444	Ga0070694_100801590	Ga0070694_1008015902	148
138	3300005455	Ga0070663_100024710	Ga0070663_1000247104	148
139	3300005457	Ga0070662_100088661	Ga0070662_1000886612	148
140	3300005535	Ga0070684_101779299	Ga0070684_1017792991	148
141	3300005543	Ga0070672_100040674	Ga0070672_1000406744	148
142	3300005543	Ga0070672_100580518	Ga0070672_1005805182	148
143	3300005544	Ga0070686_100090087	Ga0070686_1000900872	148
144	3300005546	Ga0070696_101677923	Ga0070696_1016779231	148
145	3300005549	Ga0070704_100186091	Ga0070704_1001860912	148
146	3300005564	Ga0070664_100032040	Ga0070664_1000320404	148
147	3300005578	Ga0068854_100884233	Ga0068854_1008842332	148
148	3300005615	Ga0070702_100258750	Ga0070702_1002587502	148
149	3300005618	Ga0068864_100099258	Ga0068864_1000992583	148
150	3300005618	Ga0068864_101096789	Ga0068864_1010967891	148
151	3300005719	Ga0068861_100009784	Ga0068861_1000097842	148
152	3300005840	Ga0068870_10201622	Ga0068870_102016224	148
153	3300005841	Ga0068863_100255762	Ga0068863_1002557624	148
154	3300005844	Ga0068862_100120342	Ga0068862_1001203422	148
155	3300006051	Ga0075364_10056478	Ga0075364_100564783	148
156	3300006237	Ga0097621_100087045	Ga0097621_1000870452	148
157	3300006237	Ga0097621_101283895	Ga0097621_1012838952	148
158	3300006358	Ga0068871_101226125	Ga0068871_1012261251	148
159	3300006852	Ga0075433_10000042	Ga0075433_1000004218	148
160	3300006852	Ga0075433_10000874	Ga0075433_100008749	148
161	3300006852	Ga0075433_10050727	Ga0075433_100507274	148
162	3300006852	Ga0075433_10326224	Ga0075433_103262242	148
163	3300006871	Ga0075434_100001063	Ga0075434_1000010639	148
164	3300006871	Ga0075434_100016467	Ga0075434_1000164675	148
165	3300006871	Ga0075434_100025150	Ga0075434_1000251505	148
166	3300006871	Ga0075434_100188306	Ga0075434_1001883062	148
167	3300007076	Ga0075435_100654399	Ga0075435_1006543992	148
168	3300007076	Ga0075435_101260746	Ga0075435_1012607461	148
169	3300009098	Ga0105245_10608424	Ga0105245_106084242	148
170	3300009101	Ga0105247_11073068	Ga0105247_110730681	148
171	3300009147	Ga0114129_10040695	Ga0114129_100406952	148
172	3300009177	Ga0105248_10061782	Ga0105248_100617823	148
173	3300009551	Ga0105238_10369079	Ga0105238_103690792	148
174	3300013297	Ga0157378_10610456	Ga0157378_106104562	148
175	3300013308	Ga0157375_10188111	Ga0157375_101881112	148
176	3300014325	Ga0163163_10086769	Ga0163163_100867694	148
177	3300014325	Ga0163163_10392831	Ga0163163_103928312	148
178	3300014326	Ga0157380_10325032	Ga0157380_103250322	148
179	3300014326	Ga0157380_11826281	Ga0157380_118262812	148
180	3300014969	Ga0157376_10440115	Ga0157376_104401152	148
181	3300017792	Ga0163161_10326226	Ga0163161_103262262	148
182	3300017792	Ga0163161_11140430	Ga0163161_111404301	148
183	3300025915	Ga0207693_10557747	Ga0207693_105577472	148
184	3300025918	Ga0207662_10089717	Ga0207662_100897172	148
185	3300025920	Ga0207649_10584987	Ga0207649_105849872	148
186	3300025925	Ga0207650_10075584	Ga0207650_100755844	148
187	3300025925	Ga0207650_10158799	Ga0207650_101587992	148
188	3300025926	Ga0207659_10469966	Ga0207659_104699662	148
189	3300025928	Ga0207700_10617028	Ga0207700_106170282	148
190	3300025931	Ga0207644_10345317	Ga0207644_103453173	148
191	3300025933	Ga0207706_10069074	Ga0207706_100690742	148
192	3300025933	Ga0207706_10355540	Ga0207706_103555404	148
193	3300025938	Ga0207704_10310428	Ga0207704_103104282	148
194	3300025940	Ga0207691_10017783	Ga0207691_100177835	148
195	3300025940	Ga0207691_10397287	Ga0207691_103972871	148
196	3300025941	Ga0207711_10151589	Ga0207711_101515893	148
197	3300025942	Ga0207689_10789767	Ga0207689_107897672	148
198	3300026023	Ga0207677_11169195	Ga0207677_111691951	148
199	3300026067	Ga0207678_10049226	Ga0207678_100492265	148
200	3300026075	Ga0207708_11308687	Ga0207708_113086871	148
201	3300026088	Ga0207641_11609769	Ga0207641_116097691	148
202	3300026095	Ga0207676_10268766	Ga0207676_102687662	148
203	3300026118	Ga0207675_100170992	Ga0207675_1001709924	148
204	3300028380	Ga0268265_10109066	Ga0268265_101090662	148
205	3300031548	Ga0307408_100590213	Ga0307408_1005902132	148
206	3300032126	Ga0307415_101207549	Ga0307415_1012075492	148
207	3300038443	Ga0395901_0307342	Ga0395901_0307342_33_479	148
208	3300048913	Ga0496110_0543618	Ga0496110_0543618_225_671	148
209	3300050491	nmdc:mga00v17_183558_c1	nmdc:mga00v17_183558_c1_23_469	148
210	3300050507	nmdc:mga05p37_10678_c1	nmdc:mga05p37_10678_c1_4669_5115	148
211	3300050512	nmdc:mga0n895_479221_c1	nmdc:mga0n895_479221_c1_695_1141	148
212	3300050513	nmdc:mga0rr50_256174_c1	nmdc:mga0rr50_256174_c1_851_1297	148
213	3300050515	nmdc:mga0a205_252835_c1	nmdc:mga0a205_252835_c1_453_899	148
214	3300053129	Ga0500628_236571	Ga0500628_236571_38_484	148
215	3300005289	Ga0065704_10030966	Ga0065704_100309661	149
216	3300005289	Ga0065704_10285878	Ga0065704_102858781	149
217	3300005290	Ga0065712_10068334	Ga0065712_100683343	149
218	3300005290	Ga0065712_10069287	Ga0065712_100692873	149
219	3300005290	Ga0065712_10094091	Ga0065712_100940912	149
220	3300005293	Ga0065715_10000495	Ga0065715_100004955	149
221	3300005293	Ga0065715_10027854	Ga0065715_100278541	149
222	3300005293	Ga0065715_10290232	Ga0065715_102902322	149
223	3300005295	Ga0065707_10086558	Ga0065707_100865585	149
224	3300005295	Ga0065707_10318304	Ga0065707_103183041	149
225	3300005328	Ga0070676_10198699	Ga0070676_101986991	149
226	3300005330	Ga0070690_100059747	Ga0070690_1000597473	149
227	3300005330	Ga0070690_100092130	Ga0070690_1000921302	149
228	3300005331	Ga0070670_100056317	Ga0070670_1000563172	149
229	3300005331	Ga0070670_100138886	Ga0070670_1001388861	149
230	3300005331	Ga0070670_101384434	Ga0070670_1013844341	149
231	3300005331	Ga0070670_101603264	Ga0070670_1016032641	149
232	3300005334	Ga0068869_100090262	Ga0068869_1000902623	149
233	3300005334	Ga0068869_100259093	Ga0068869_1002590932	149
234	3300005335	Ga0070666_10054180	Ga0070666_100541802	149
235	3300005336	Ga0070680_100781635	Ga0070680_1007816351	149
236	3300005337	Ga0070682_100000059	Ga0070682_10000005952	149
237	3300005340	Ga0070689_100189254	Ga0070689_1001892541	149
238	3300005340	Ga0070689_100210655	Ga0070689_1002106552	149
239	3300005340	Ga0070689_100672029	Ga0070689_1006720291	149
240	3300005340	Ga0070689_101197090	Ga0070689_1011970902	149
241	3300005341	Ga0070691_10462148	Ga0070691_104621481	149
242	3300005343	Ga0070687_100111084	Ga0070687_1001110841	149
243	3300005343	Ga0070687_100197804	Ga0070687_1001978042	149
244	3300005343	Ga0070687_100697683	Ga0070687_1006976831	149
245	3300005347	Ga0070668_100016155	Ga0070668_1000161554	149
246	3300005353	Ga0070669_100008642	Ga0070669_1000086422	149
247	3300005353	Ga0070669_100138896	Ga0070669_1001388962	149
248	3300005353	Ga0070669_101912441	Ga0070669_1019124411	149
249	3300005354	Ga0070675_100000419	Ga0070675_10000041920	149
250	3300005354	Ga0070675_100007036	Ga0070675_1000070364	149
251	3300005354	Ga0070675_100129777	Ga0070675_1001297772	149
252	3300005354	Ga0070675_100355825	Ga0070675_1003558251	149
253	3300005354	Ga0070675_100796797	Ga0070675_1007967972	149
254	3300005355	Ga0070671_100230731	Ga0070671_1002307311	149
255	3300005356	Ga0070674_100068536	Ga0070674_1000685362	149
256	3300005356	Ga0070674_100072966	Ga0070674_1000729662	149
257	3300005356	Ga0070674_100241947	Ga0070674_1002419471	149
258	3300005356	Ga0070674_100479928	Ga0070674_1004799281	149
259	3300005364	Ga0070673_100023245	Ga0070673_1000232452	149
260	3300005364	Ga0070673_100635458	Ga0070673_1006354582	149
261	3300005365	Ga0070688_100011858	Ga0070688_1000118583	149
262	3300005365	Ga0070688_100053037	Ga0070688_1000530372	149
263	3300005365	Ga0070688_100281698	Ga0070688_1002816982	149
264	3300005367	Ga0070667_100150712	Ga0070667_1001507122	149
265	3300005438	Ga0070701_10032942	Ga0070701_100329422	149
266	3300005440	Ga0070705_100131241	Ga0070705_1001312412	149
267	3300005441	Ga0070700_100007106	Ga0070700_1000071066	149
268	3300005441	Ga0070700_100318817	Ga0070700_1003188171	149
269	3300005441	Ga0070700_100675677	Ga0070700_1006756771	149
270	3300005444	Ga0070694_100088578	Ga0070694_1000885781	149
271	3300005444	Ga0070694_100163358	Ga0070694_1001633582	149
272	3300005444	Ga0070694_100582864	Ga0070694_1005828642	149
273	3300005444	Ga0070694_100935855	Ga0070694_1009358551	149
274	3300005445	Ga0070708_100120999	Ga0070708_1001209992	149
275	3300005456	Ga0070678_100409390	Ga0070678_1004093902	149
276	3300005457	Ga0070662_100094430	Ga0070662_1000944302	149
277	3300005459	Ga0068867_100089994	Ga0068867_1000899941	149
278	3300005459	Ga0068867_100231157	Ga0068867_1002311571	149
279	3300005459	Ga0068867_101091876	Ga0068867_1010918761	149
280	3300005467	Ga0070706_100021636	Ga0070706_1000216361	149
281	3300005468	Ga0070707_101115956	Ga0070707_1011159562	149
282	3300005471	Ga0070698_101024429	Ga0070698_1010244291	149
283	3300005471	Ga0070698_101149899	Ga0070698_1011498991	149
284	3300005518	Ga0070699_100970975	Ga0070699_1009709751	149
285	3300005536	Ga0070697_100000293	Ga0070697_10000029319	149
286	3300005539	Ga0068853_101043328	Ga0068853_1010433281	149
287	3300005543	Ga0070672_100050613	Ga0070672_1000506134	149
288	3300005543	Ga0070672_100423328	Ga0070672_1004233282	149
289	3300005543	Ga0070672_100529553	Ga0070672_1005295531	149
290	3300005544	Ga0070686_100005534	Ga0070686_1000055345	149
291	3300005544	Ga0070686_100021629	Ga0070686_1000216294	149
292	3300005544	Ga0070686_100271605	Ga0070686_1002716051	149
293	3300005544	Ga0070686_100402336	Ga0070686_1004023361	149
294	3300005544	Ga0070686_100422326	Ga0070686_1004223261	149
295	3300005545	Ga0070695_100129279	Ga0070695_1001292791	149
296	3300005545	Ga0070695_100733574	Ga0070695_1007335741	149
297	3300005545	Ga0070695_100975307	Ga0070695_1009753071	149
298	3300005546	Ga0070696_100116920	Ga0070696_1001169202	149
299	3300005546	Ga0070696_100161343	Ga0070696_1001613431	149
300	3300005549	Ga0070704_100034334	Ga0070704_1000343341	149
301	3300005549	Ga0070704_100106047	Ga0070704_1001060472	149
302	3300005549	Ga0070704_100236280	Ga0070704_1002362802	149
303	3300005549	Ga0070704_100485422	Ga0070704_1004854222	149
304	3300005549	Ga0070704_100750034	Ga0070704_1007500341	149
305	3300005564	Ga0070664_100442402	Ga0070664_1004424022	149
306	3300005577	Ga0068857_100164863	Ga0068857_1001648632	149
307	3300005577	Ga0068857_100415955	Ga0068857_1004159552	149
308	3300005577	Ga0068857_100811259	Ga0068857_1008112591	149
309	3300005578	Ga0068854_100302250	Ga0068854_1003022502	149
310	3300005615	Ga0070702_100481940	Ga0070702_1004819401	149
311	3300005617	Ga0068859_100002378	Ga0068859_1000023787	149
312	3300005617	Ga0068859_100093617	Ga0068859_1000936172	149
313	3300005617	Ga0068859_100451569	Ga0068859_1004515691	149
314	3300005617	Ga0068859_100897462	Ga0068859_1008974621	149
315	3300005617	Ga0068859_101438596	Ga0068859_1014385961	149
316	3300005618	Ga0068864_100047696	Ga0068864_1000476964	149
317	3300005618	Ga0068864_100402332	Ga0068864_1004023321	149
318	3300005618	Ga0068864_101339259	Ga0068864_1013392592	149
319	3300005718	Ga0068866_10091269	Ga0068866_100912692	149
320	3300005719	Ga0068861_100008375	Ga0068861_1000083755	149
321	3300005719	Ga0068861_100018429	Ga0068861_1000184292	149
322	3300005719	Ga0068861_100033870	Ga0068861_1000338703	149
323	3300005719	Ga0068861_102346836	Ga0068861_1023468361	149
324	3300005840	Ga0068870_10247287	Ga0068870_102472871	149
325	3300005840	Ga0068870_10347511	Ga0068870_103475111	149
326	3300005841	Ga0068863_100587263	Ga0068863_1005872632	149
327	3300005841	Ga0068863_101813126	Ga0068863_1018131261	149
328	3300005842	Ga0068858_100112626	Ga0068858_1001126262	149
329	3300005842	Ga0068858_102002054	Ga0068858_1020020541	149
330	3300005843	Ga0068860_100271414	Ga0068860_1002714142	149
331	3300005843	Ga0068860_101676153	Ga0068860_1016761531	149
332	3300005844	Ga0068862_100168973	Ga0068862_1001689732	149
333	3300005844	Ga0068862_100293122	Ga0068862_1002931221	149
334	3300005844	Ga0068862_100316420	Ga0068862_1003164202	149
335	3300005844	Ga0068862_100436672	Ga0068862_1004366721	149
336	3300005983	Ga0081540_1220361	Ga0081540_12203611	149
337	3300006237	Ga0097621_100002263	Ga0097621_1000022634	149
338	3300006358	Ga0068871_100287265	Ga0068871_1002872652	149
339	3300006844	Ga0075428_100070892	Ga0075428_1000708924	149
340	3300006844	Ga0075428_100802738	Ga0075428_1008027382	149
341	3300006846	Ga0075430_100021997	Ga0075430_1000219973	149
342	3300006846	Ga0075430_100197150	Ga0075430_1001971501	149
343	3300006847	Ga0075431_100081098	Ga0075431_1000810982	149
344	3300006852	Ga0075433_10184037	Ga0075433_101840372	149
345	3300006852	Ga0075433_10966277	Ga0075433_109662771	149
346	3300006852	Ga0075433_11136085	Ga0075433_111360852	149
347	3300006880	Ga0075429_100564975	Ga0075429_1005649752	149
348	3300006880	Ga0075429_100609393	Ga0075429_1006093932	149
349	3300006881	Ga0068865_101078561	Ga0068865_1010785612	149
350	3300006931	Ga0097620_100002378	Ga0097620_1000023787	149
351	3300006931	Ga0097620_100093614	Ga0097620_1000936142	149
352	3300006931	Ga0097620_100451565	Ga0097620_1004515651	149
353	3300006931	Ga0097620_100897426	Ga0097620_1008974261	149
354	3300006931	Ga0097620_101438637	Ga0097620_1014386371	149
355	3300009092	Ga0105250_10117034	Ga0105250_101170342	149
356	3300009094	Ga0111539_10013361	Ga0111539_100133612	149
357	3300009094	Ga0111539_10026016	Ga0111539_100260162	149
358	3300009094	Ga0111539_10068844	Ga0111539_100688444	149
359	3300009094	Ga0111539_10075091	Ga0111539_100750912	149
360	3300009094	Ga0111539_10103089	Ga0111539_101030892	149
361	3300009094	Ga0111539_10677769	Ga0111539_106777692	149
362	3300009094	Ga0111539_12259403	Ga0111539_122594031	149
363	3300009098	Ga0105245_10151151	Ga0105245_101511512	149
364	3300009098	Ga0105245_10492144	Ga0105245_104921441	149
365	3300009147	Ga0114129_10053949	Ga0114129_100539496	149
366	3300009147	Ga0114129_10629673	Ga0114129_106296732	149
367	3300009147	Ga0114129_10827272	Ga0114129_108272722	149
368	3300009147	Ga0114129_11733719	Ga0114129_117337191	149
369	3300009148	Ga0105243_10375198	Ga0105243_103751982	149
370	3300009148	Ga0105243_10899452	Ga0105243_108994522	149
371	3300009148	Ga0105243_12336496	Ga0105243_123364961	149
372	3300009174	Ga0105241_10013504	Ga0105241_100135042	149
373	3300009176	Ga0105242_10346258	Ga0105242_103462582	149
374	3300009176	Ga0105242_10883691	Ga0105242_108836912	149
375	3300009551	Ga0105238_11487645	Ga0105238_114876452	149
376	3300009553	Ga0105249_10000201	Ga0105249_1000020117	149
377	3300009553	Ga0105249_10101186	Ga0105249_101011862	149
378	3300009553	Ga0105249_10202045	Ga0105249_102020452	149
379	3300009553	Ga0105249_10263038	Ga0105249_102630382	149
380	3300011119	Ga0105246_10192438	Ga0105246_101924382	149
381	3300011119	Ga0105246_11334494	Ga0105246_113344941	149
382	3300013102	Ga0157371_10281302	Ga0157371_102813022	149
383	3300013296	Ga0157374_10679229	Ga0157374_106792291	149
384	3300013297	Ga0157378_10066715	Ga0157378_100667152	149
385	3300013297	Ga0157378_10106521	Ga0157378_101065212	149
386	3300013297	Ga0157378_10328191	Ga0157378_103281912	149
387	3300013297	Ga0157378_10343270	Ga0157378_103432701	149
388	3300013297	Ga0157378_10897486	Ga0157378_108974862	149
389	3300013297	Ga0157378_11937207	Ga0157378_119372071	149
390	3300013306	Ga0163162_10000128	Ga0163162_1000012817	149
391	3300013306	Ga0163162_10594826	Ga0163162_105948261	149
392	3300013308	Ga0157375_10040407	Ga0157375_100404072	149
393	3300013308	Ga0157375_10567470	Ga0157375_105674701	149
394	3300014325	Ga0163163_10154750	Ga0163163_101547501	149
395	3300014326	Ga0157380_10005208	Ga0157380_100052082	149
396	3300014326	Ga0157380_10139984	Ga0157380_101399842	149
397	3300014326	Ga0157380_10441735	Ga0157380_104417352	149
398	3300014745	Ga0157377_10018431	Ga0157377_100184312	149
399	3300014745	Ga0157377_10172809	Ga0157377_101728092	149
400	3300014969	Ga0157376_10045130	Ga0157376_100451301	149
401	3300017792	Ga0163161_10016306	Ga0163161_100163063	149
402	3300025315	Ga0207697_10123927	Ga0207697_101239272	149
403	3300025901	Ga0207688_10271856	Ga0207688_102718561	149
404	3300025901	Ga0207688_10314220	Ga0207688_103142202	149
405	3300025903	Ga0207680_10644411	Ga0207680_106444111	149
406	3300025908	Ga0207643_10106057	Ga0207643_101060571	149
407	3300025918	Ga0207662_10041067	Ga0207662_100410672	149
408	3300025918	Ga0207662_10129893	Ga0207662_101298932	149
409	3300025923	Ga0207681_10004181	Ga0207681_100041811	149
410	3300025923	Ga0207681_10014725	Ga0207681_100147255	149
411	3300025923	Ga0207681_11641772	Ga0207681_116417721	149
412	3300025925	Ga0207650_10046358	Ga0207650_100463582	149
413	3300025925	Ga0207650_10113115	Ga0207650_101131153	149
414	3300025925	Ga0207650_11143192	Ga0207650_111431921	149
415	3300025926	Ga0207659_10001276	Ga0207659_100012769	149
416	3300025926	Ga0207659_10001773	Ga0207659_100017737	149
417	3300025926	Ga0207659_10026791	Ga0207659_100267914	149
418	3300025926	Ga0207659_10624829	Ga0207659_106248291	149
419	3300025926	Ga0207659_10693257	Ga0207659_106932571	149
420	3300025927	Ga0207687_10190981	Ga0207687_101909812	149
421	3300025927	Ga0207687_10213720	Ga0207687_102137201	149
422	3300025931	Ga0207644_10777672	Ga0207644_107776722	149
423	3300025933	Ga0207706_10094615	Ga0207706_100946152	149
424	3300025935	Ga0207709_10017685	Ga0207709_100176853	149
425	3300025935	Ga0207709_10604925	Ga0207709_106049251	149
426	3300025935	Ga0207709_11312364	Ga0207709_113123641	149
427	3300025936	Ga0207670_10161723	Ga0207670_101617231	149
428	3300025936	Ga0207670_10232695	Ga0207670_102326952	149
429	3300025936	Ga0207670_10328191	Ga0207670_103281912	149
430	3300025937	Ga0207669_10117437	Ga0207669_101174371	149
431	3300025938	Ga0207704_10114591	Ga0207704_101145912	149
432	3300025940	Ga0207691_10002560	Ga0207691_100025609	149
433	3300025940	Ga0207691_10056171	Ga0207691_100561712	149
434	3300025941	Ga0207711_10142408	Ga0207711_101424082	149
435	3300025941	Ga0207711_10893234	Ga0207711_108932341	149
436	3300025942	Ga0207689_10023742	Ga0207689_100237421	149
437	3300025942	Ga0207689_10246164	Ga0207689_102461642	149
438	3300025960	Ga0207651_10054004	Ga0207651_100540042	149
439	3300025960	Ga0207651_10210675	Ga0207651_102106752	149
440	3300025961	Ga0207712_10000330	Ga0207712_1000033025	149
441	3300025961	Ga0207712_10025816	Ga0207712_100258161	149
442	3300025961	Ga0207712_10297770	Ga0207712_102977702	149
443	3300025961	Ga0207712_11641433	Ga0207712_116414331	149
444	3300025972	Ga0207668_10007655	Ga0207668_100076554	149
445	3300025981	Ga0207640_10935142	Ga0207640_109351421	149
446	3300025986	Ga0207658_10379243	Ga0207658_103792431	149
447	3300025986	Ga0207658_10539669	Ga0207658_105396692	149
448	3300026023	Ga0207677_10203250	Ga0207677_102032501	149
449	3300026075	Ga0207708_10001112	Ga0207708_100011123	149
450	3300026075	Ga0207708_10124377	Ga0207708_101243771	149
451	3300026075	Ga0207708_10748465	Ga0207708_107484651	149
452	3300026088	Ga0207641_10221427	Ga0207641_102214272	149
453	3300026088	Ga0207641_10481575	Ga0207641_104815752	149
454	3300026088	Ga0207641_10530900	Ga0207641_105309001	149
455	3300026089	Ga0207648_10007333	Ga0207648_100073332	149
456	3300026089	Ga0207648_10194114	Ga0207648_101941142	149
457	3300026089	Ga0207648_10282933	Ga0207648_102829332	149
458	3300026089	Ga0207648_10313523	Ga0207648_103135232	149
459	3300026095	Ga0207676_10493216	Ga0207676_104932162	149
460	3300026095	Ga0207676_11115020	Ga0207676_111150202	149
461	3300026095	Ga0207676_11997686	Ga0207676_119976861	149
462	3300026116	Ga0207674_10182697	Ga0207674_101826972	149
463	3300026116	Ga0207674_10899999	Ga0207674_108999992	149
464	3300026118	Ga0207675_100002007	Ga0207675_10000200712	149
465	3300026118	Ga0207675_100004930	Ga0207675_1000049306	149
466	3300026118	Ga0207675_100090975	Ga0207675_1000909754	149
467	3300026118	Ga0207675_100193346	Ga0207675_1001933462	149
468	3300026118	Ga0207675_100273554	Ga0207675_1002735542	149
469	3300026118	Ga0207675_100915171	Ga0207675_1009151711	149
470	3300026121	Ga0207683_10237968	Ga0207683_102379682	149
471	3300026121	Ga0207683_10298218	Ga0207683_102982182	149
472	3300026121	Ga0207683_10307454	Ga0207683_103074542	149
473	3300026121	Ga0207683_10394348	Ga0207683_103943482	149
474	3300027907	Ga0207428_10005976	Ga0207428_100059768	149
475	3300027907	Ga0207428_10023316	Ga0207428_100233165	149
476	3300027907	Ga0207428_10027991	Ga0207428_100279914	149
477	3300027907	Ga0207428_10084780	Ga0207428_100847802	149
478	3300027907	Ga0207428_10116430	Ga0207428_101164302	149
479	3300027907	Ga0207428_10608673	Ga0207428_106086732	149
480	3300028379	Ga0268266_10457747	Ga0268266_104577472	149
481	3300028379	Ga0268266_11129513	Ga0268266_111295131	149
482	3300028380	Ga0268265_10031751	Ga0268265_100317512	149
483	3300028380	Ga0268265_10209592	Ga0268265_102095922	149
484	3300028380	Ga0268265_10262870	Ga0268265_102628701	149
485	3300028380	Ga0268265_10635329	Ga0268265_106353291	149
486	3300028381	Ga0268264_10071942	Ga0268264_100719421	149
487	3300028381	Ga0268264_10087740	Ga0268264_100877402	149
488	3300028381	Ga0268264_11610444	Ga0268264_116104441	149
489	3300031731	Ga0307405_10896534	Ga0307405_108965341	149
490	3300031911	Ga0307412_10466723	Ga0307412_104667232	149
491	3300032002	Ga0307416_100332446	Ga0307416_1003324462	149
492	3300032002	Ga0307416_101722044	Ga0307416_1017220441	149
493	3300037068	Ga0373925_0721668	Ga0373925_0721668_184_633	149
494	3300037471	Ga0395905_0392759	Ga0395905_0392759_322_771	149
495	3300038443	Ga0395901_1058390	Ga0395901_1058390_246_695	149
496	3300041999	Ga0439433_0008414	Ga0439433_0008414_589_1038	149
497	3300042015	Ga0439462_0063924	Ga0439462_0063924_491_940	149
498	3300042156	Ga0439446_0060396	Ga0439446_0060396_587_1036	149
499	3300046473	Ga0495582_0205195	Ga0495582_0205195_172_621	149
500	3300046525	Ga0495663_0000150	Ga0495663_0000150_19427_19876	149
501	3300046537	Ga0495598_0000410	Ga0495598_0000410_6866_7315	149
502	3300046537	Ga0495598_0007619	Ga0495598_0007619_601_1050	149
503	3300046539	Ga0495621_0000571	Ga0495621_0000571_7611_8060	149
504	3300046539	Ga0495621_0009323	Ga0495621_0009323_372_821	149
505	3300046539	Ga0495621_0087804	Ga0495621_0087804_113_562	149
506	3300046615	Ga0495656_0009621	Ga0495656_0009621_1130_1579	149
507	3300046664	Ga0495659_0305558	Ga0495659_0305558_115_564	149
508	3300046664	Ga0495659_0416339	Ga0495659_0416339_99_548	149
509	3300046683	Ga0495658_0081827	Ga0495658_0081827_1362_1811	149
510	3300046691	Ga0495670_0112943	Ga0495670_0112943_762_1211	149
511	3300047320	Ga0495672_0060080	Ga0495672_0060080_1007_1456	149
512	3300048090	Ga0495615_0035162	Ga0495615_0035162_513_962	149
513	3300048090	Ga0495615_0135646	Ga0495615_0135646_121_570	149
514	3300048911	Ga0496108_1599008	Ga0496108_1599008_14_463	149
515	3300048912	Ga0496109_0244818	Ga0496109_0244818_1015_1464	149
516	3300048916	Ga0496113_0273555	Ga0496113_0273555_42_491	149
517	3300048916	Ga0496113_1015783	Ga0496113_1015783_93_542	149
518	3300049575	Ga0501039_0275982	Ga0501039_0275982_801_1250	149
519	3300049577	Ga0501041_0713141	Ga0501041_0713141_169_618	149
520	3300049583	Ga0501067_0042798	Ga0501067_0042798_1677_2126	149
521	3300049585	Ga0501069_0114061	Ga0501069_0114061_323_772	149
522	3300050507	nmdc:mga05p37_372662_c1	nmdc:mga05p37_372662_c1_338_787	149
523	3300050507	nmdc:mga05p37_432002_c1	nmdc:mga05p37_432002_c1_26_475	149
524	3300050508	nmdc:mga09592_144657_c1	nmdc:mga09592_144657_c1_55_504	149
525	3300050508	nmdc:mga09592_570688_c1	nmdc:mga09592_570688_c1_453_902	149
526	3300050510	nmdc:mga06r32_154808_c1	nmdc:mga06r32_154808_c1_404_853	149
527	3300050511	nmdc:mga08y16_2079_c1	nmdc:mga08y16_2079_c1_10614_11063	149
528	3300050511	nmdc:mga08y16_265880_c1	nmdc:mga08y16_265880_c1_1008_1457	149
529	3300050511	nmdc:mga08y16_441036_c1	nmdc:mga08y16_441036_c1_273_722	149
530	3300050511	nmdc:mga08y16_5878_c1	nmdc:mga08y16_5878_c1_9900_10349	149
531	3300050511	nmdc:mga08y16_643947_c1	nmdc:mga08y16_643947_c1_573_1022	149
532	3300050512	nmdc:mga0n895_365011_c1	nmdc:mga0n895_365011_c1_320_769	149
533	3300050513	nmdc:mga0rr50_1198347_c1	nmdc:mga0rr50_1198347_c1_156_605	149
534	3300050513	nmdc:mga0rr50_485631_c1	nmdc:mga0rr50_485631_c1_245_694	149
535	3300050515	nmdc:mga0a205_214692_c1	nmdc:mga0a205_214692_c1_850_1299	149
536	3300050515	nmdc:mga0a205_60169_c1	nmdc:mga0a205_60169_c1_2652_3101	149
537	3300053129	Ga0500628_009177	Ga0500628_009177_576_1025	149
538	3300060353	Ga0501082_0269793	Ga0501082_0269793_372_821	149
539	3300061734	Ga0530510_0299690	Ga0530510_0299690_592_1041	149
540	3300005331	Ga0070670_100096219	Ga0070670_1000962192	150
541	3300005334	Ga0068869_100135274	Ga0068869_1001352741	150
542	3300025925	Ga0207650_10134663	Ga0207650_101346631	150
543	3300025942	Ga0207689_10066483	Ga0207689_100664831	150
544	3300026118	Ga0207675_101593037	Ga0207675_1015930371	150
545	3300050512	nmdc:mga0n895_45698_c1	nmdc:mga0n895_45698_c1_3630_4091	151
546	3300050515	nmdc:mga0a205_2879_c1	nmdc:mga0a205_2879_c1_4812_5273	151
547	3300005355	Ga0070671_100002555	Ga0070671_1000025552	153
548	3300025931	Ga0207644_10002223	Ga0207644_100022237	153
549	3300005439	Ga0070711_100284159	Ga0070711_1002841592	155
550	3300009147	Ga0114129_10249532	Ga0114129_102495322	155
551	3300009177	Ga0105248_12207283	Ga0105248_122072831	155
552	3300014969	Ga0157376_10566380	Ga0157376_105663802	155
553	3300009094	Ga0111539_10374758	Ga0111539_103747582	156
554	3300050511	nmdc:mga08y16_1037132_c1	nmdc:mga08y16_1037132_c1_47_517	156
555	3300050511	nmdc:mga08y16_293472_c1	nmdc:mga08y16_293472_c1_372_857	156
556	3300048915	Ga0496112_0298795	Ga0496112_0298795_416_895	159
557	3300005337	Ga0070682_100928211	Ga0070682_1009282111	160
558	3300005340	Ga0070689_100486456	Ga0070689_1004864561	160
559	3300005340	Ga0070689_100804235	Ga0070689_1008042352	160
560	3300005615	Ga0070702_101068615	Ga0070702_1010686151	160
561	3300005617	Ga0068859_100525718	Ga0068859_1005257182	160
562	3300005841	Ga0068863_100341974	Ga0068863_1003419742	160
563	3300006931	Ga0097620_100525696	Ga0097620_1005256962	160
564	3300009094	Ga0111539_10003028	Ga0111539_100030289	160
565	3300009176	Ga0105242_10684477	Ga0105242_106844772	160
566	3300009177	Ga0105248_10043039	Ga0105248_100430392	160
567	3300013296	Ga0157374_11333097	Ga0157374_113330971	160
568	3300013297	Ga0157378_10898546	Ga0157378_108985461	160
569	3300013306	Ga0163162_10243700	Ga0163162_102437002	160
570	3300013308	Ga0157375_10121286	Ga0157375_101212862	160
571	3300014745	Ga0157377_10913157	Ga0157377_109131571	160
572	3300025936	Ga0207670_10070967	Ga0207670_100709672	160
573	3300050511	nmdc:mga08y16_1544172_c1	nmdc:mga08y16_1544172_c1_107_595	160
574	2162886012	MBSR1b_contig_2157287	MBSR1b_0563.00004260	161
575	3300005340	Ga0070689_100393501	Ga0070689_1003935012	161
576	3300005543	Ga0070672_100518363	Ga0070672_1005183632	161
577	3300006844	Ga0075428_100390485	Ga0075428_1003904852	161
578	3300009094	Ga0111539_10044021	Ga0111539_100440212	161
579	3300009094	Ga0111539_10232545	Ga0111539_102325452	161
580	3300009176	Ga0105242_10360845	Ga0105242_103608452	161
581	3300009176	Ga0105242_12577468	Ga0105242_125774681	161
582	3300009177	Ga0105248_10140990	Ga0105248_101409902	161
583	3300009553	Ga0105249_10746096	Ga0105249_107460962	161
584	3300009553	Ga0105249_11202970	Ga0105249_112029702	161
585	3300009553	Ga0105249_11255060	Ga0105249_112550601	161
586	3300014326	Ga0157380_10143435	Ga0157380_101434352	161
587	3300014326	Ga0157380_11955340	Ga0157380_119553401	161
588	3300014745	Ga0157377_10202980	Ga0157377_102029802	161
589	3300025923	Ga0207681_11587436	Ga0207681_115874361	161
590	3300025937	Ga0207669_10613221	Ga0207669_106132212	161
591	3300025940	Ga0207691_10500442	Ga0207691_105004422	161
592	3300025972	Ga0207668_10453596	Ga0207668_104535962	161
593	3300049587	Ga0501071_1156218	Ga0501071_1156218_53_538	161
594	3300050511	nmdc:mga08y16_41760_c1	nmdc:mga08y16_41760_c1_2827_3312	161
595	3300050511	nmdc:mga08y16_721791_c1	nmdc:mga08y16_721791_c1_170_655	161
596	3300050515	nmdc:mga0a205_918625_c1	nmdc:mga0a205_918625_c1_147_632	161

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5uen-assembly1.cif.gz_A	crystal structure of the human adenosine a1 receptor a1ar-bril in complex with the covalent antagonist du172 at 3.2a resolution	0.2787	19	159
7np7-assembly1.cif.gz_D7	structure of an intact esx-5 inner membrane complex, composite c1 model	0.2577	8	155
7np7-assembly1.cif.gz_D7	structure of an intact esx-5 inner membrane complex, composite c1 model	0.24	8	155
5uen-assembly1.cif.gz_A	crystal structure of the human adenosine a1 receptor a1ar-bril in complex with the covalent antagonist du172 at 3.2a resolution	0.2388	19	159

ID	Description	Score	Start	End	Superfamily
af_P69212_3_109_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.7394	88	160	1.10.3730.20
af_Q5Z9P4_8_127_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.7233	82	159	1.10.3730.20
af_P27844_148_285_1.25.10.10	Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant	0.5538	17	154	1.25.10.10
af_P27844_148_285_1.25.10.10	Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant	0.5338	17	154	1.25.10.10
af_P69212_3_109_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.5206	88	160	1.10.3730.20

ID	Description	Score	Start	End	GO Terms
AF-A0A2V8DIZ8-F1-model_v4	EamA domain-containing protein	0.9773	13	144	GO:0016020
AF-A0A2V8DIZ8-F1-model_v4	EamA domain-containing protein	0.956	13	144	GO:0016020
AF-A0A518B2J1-F1-model_v4	Uncharacterized protein	0.9456	13	158	GO:0016020
AF-A0A2V9JY16-F1-model_v4	EamA domain-containing protein	0.9432	6	159	GO:0016020
AF-A0A2D6HKL3-F1-model_v4	EamA domain-containing protein	0.9275	22	158	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
85.45	0.7	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467516

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map