F467363

General Info

Members Datasets Scaffolds Average Seq Length
594 292 579 258

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0003369|Ga0495638_0003369_5243_6127
Length 294
Sequence LQHPAAAIPHFDDAPATPSPYKCSVLISSEVDAVKQAPPYVPGHQLLAGKSVLITAAAGAGIGYSAARRSAEEGCRALMISDVHARRLEEAVERLKAETGLQAIYGQVCNVTIEDEVQALVAAAEEALGGVDVLINNAGLGGQKRVMDMSDEEWLRVLDVTLTGTFRMTRAMLPHMQRRGAGAIVNNASVLGWRAQKEQAHYAAAKAGVMAFTRCSALEAAEFGVRINAVSPSIALHDFLKKASSEELLASLAGREAFGRAAEVWEVANVMMFLASDYASYMVGEVLSVSSQQA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231017 Pseudomonas sp. GM55 Isolate Nodule
3 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2738543024 Aminobacter sp. AP02 Isolate Unclassified
12 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
13 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
14 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
15 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
167 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
242 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
243 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
244 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
245 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
259 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
260 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
263 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
266 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
267 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
268 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
271 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
272 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
273 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
274 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
275 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
276 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
291 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
292 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0.17
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.34
Rhizoplane 8.42
Rhizosphere 78.11
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2149026 2162886007 Bacteria 5324
2 SwRhRL2b_contig_2334788 2162886007 Bacteria 75171
3 JGI24752J21851_1005971 3300001976 Bacteria 1591
4 JGI24740J21852_10009422 3300001979 Bacteria 3824
5 JGI24737J22298_10008340 3300001990 Bacteria 3473
6 JGI24735J21928_10008586 3300002067 Bacteria 3299
7 JGI24748J21848_1002846 3300002074 Bacteria 1970
8 JGI24749J21850_1000150 3300002076 Bacteria 11138
9 JGI24034J26672_10000934 3300002239 Bacteria 3796
10 JGI24034J26672_10002693 3300002239 Bacteria 2448
11 JGI24034J26672_10006054 3300002239 Bacteria 1743
12 JGI24751J29686_10000002 3300002459 Bacteria 160619
13 JGI24751J29686_10021053 3300002459 Bacteria 1352
14 Ga0055536_1000120 3300003781 Bacteria 68066
15 Ga0065714_10005046 3300005288 Bacteria 5440
16 Ga0065704_10000342 3300005289 Bacteria 36460
17 Ga0065704_10002516 3300005289 Bacteria 5892
18 Ga0065704_10070166 3300005289 Bacteria 176609
19 Ga0065704_10072848 3300005289 Bacteria 7929
20 Ga0065707_10081815 3300005295 Bacteria 36952
21 Ga0065707_10082422 3300005295 Bacteria 15385
22 Ga0065707_10095831 3300005295 Bacteria 3333
23 Ga0070658_10000304 3300005327 Bacteria 42569
24 Ga0070658_10008332 3300005327 Bacteria 8338
25 Ga0070683_100262035 3300005329 Bacteria 1644
26 Ga0070670_100000012 3300005331 Bacteria 256314
27 Ga0070670_100000026 3300005331 Bacteria 187946
28 Ga0070670_100005694 3300005331 Bacteria 10524
29 Ga0070670_100028959 3300005331 Bacteria 4767
30 Ga0070670_100086870 3300005331 Bacteria 2687
31 Ga0070677_10054674 3300005333 Bacteria 1627
32 Ga0070666_10017345 3300005335 Bacteria 4615
33 Ga0070680_100279011 3300005336 Bacteria 1416
34 Ga0070661_100009928 3300005344 Bacteria 6605
35 Ga0070668_100000642 3300005347 Bacteria 23581
36 Ga0070668_100001679 3300005347 Bacteria 16043
37 Ga0070668_100021926 3300005347 Bacteria 4825
38 Ga0070668_100033923 3300005347 Bacteria 3889
39 Ga0070668_100164416 3300005347 Bacteria 1803
40 Ga0070669_100000064 3300005353 Bacteria 107033
41 Ga0070669_100000077 3300005353 Bacteria 95577
42 Ga0070669_100000199 3300005353 Bacteria 52239
43 Ga0070669_100001050 3300005353 Bacteria 20195
44 Ga0070669_100002158 3300005353 Bacteria 14232
45 Ga0070669_100006689 3300005353 Bacteria 8298
46 Ga0070669_100013893 3300005353 Bacteria 5726
47 Ga0070671_100000077 3300005355 Bacteria 62532
48 Ga0070671_100000863 3300005355 Bacteria 22137
49 Ga0070671_100001302 3300005355 Bacteria 18731
50 Ga0070671_100003136 3300005355 Bacteria 12877
51 Ga0070671_100023407 3300005355 Bacteria 5055
52 Ga0070688_100277321 3300005365 Bacteria 1203
53 Ga0070659_100023370 3300005366 Bacteria 4729
54 Ga0070667_100000002 3300005367 Bacteria 504831
55 Ga0070667_100000828 3300005367 Bacteria 28754
56 Ga0070667_100001698 3300005367 Bacteria 19689
57 Ga0070667_100002772 3300005367 Bacteria 15143
58 Ga0070667_100015584 3300005367 Bacteria 6284
59 Ga0070667_100036976 3300005367 Bacteria 4093
60 Ga0070709_10199934 3300005434 Bacteria 1415
61 Ga0070713_100003202 3300005436 Bacteria 10776
62 Ga0070713_100085797 3300005436 Bacteria 2697
63 Ga0070710_10008731 3300005437 Bacteria 4942
64 Ga0070710_10052968 3300005437 Bacteria 2284
65 Ga0070711_100006415 3300005439 Bacteria 7094
66 Ga0070705_100124955 3300005440 Bacteria 1668
67 Ga0070663_100007527 3300005455 Bacteria 6633
68 Ga0070678_100059574 3300005456 Bacteria 2807
69 Ga0070662_100044811 3300005457 Bacteria 3170
70 Ga0068867_100040064 3300005459 Bacteria 3417
71 Ga0070685_10000009 3300005466 Bacteria 166260
72 Ga0070685_10008897 3300005466 Bacteria 5177
73 Ga0070684_100137999 3300005535 Bacteria 2203
74 Ga0070672_100071928 3300005543 Bacteria 2752
75 Ga0070665_100000163 3300005548 Bacteria 121320
76 Ga0070665_100013238 3300005548 Bacteria 8309
77 Ga0070665_100026151 3300005548 Bacteria 5876
78 Ga0070665_100107348 3300005548 Bacteria 2794
79 Ga0070665_100153609 3300005548 Bacteria 2304
80 Ga0070665_100200590 3300005548 Bacteria 1995
81 Ga0068855_100003651 3300005563 Bacteria 18824
82 Ga0068855_100020494 3300005563 Bacteria 7928
83 Ga0068855_100111522 3300005563 Bacteria 3140
84 Ga0068857_100584268 3300005577 Bacteria 1055
85 Ga0068854_100000322 3300005578 Bacteria 31553
86 Ga0068854_100434966 3300005578 Bacteria 1092
87 Ga0068852_100000357 3300005616 Bacteria 30774
88 Ga0068852_100005824 3300005616 Bacteria 8850
89 Ga0068859_100022203 3300005617 Bacteria 6363
90 Ga0068859_100121149 3300005617 Bacteria 2682
91 Ga0068859_100145896 3300005617 Bacteria 2441
92 Ga0068859_100164400 3300005617 Bacteria 2299
93 Ga0068864_100000002 3300005618 Bacteria 658857
94 Ga0068864_100000010 3300005618 Bacteria 358723
95 Ga0068864_100365999 3300005618 Bacteria 1363
96 Ga0068861_100006004 3300005719 Bacteria 8255
97 Ga0068861_100015123 3300005719 Bacteria 5431
98 Ga0068861_100274352 3300005719 Bacteria 1449
99 Ga0068851_10027096 3300005834 Bacteria 2822
100 Ga0068863_100054520 3300005841 Bacteria 3788
101 Ga0068863_100197837 3300005841 Bacteria 1932
102 Ga0068863_100272119 3300005841 Bacteria 1640
103 Ga0068858_100052357 3300005842 Bacteria 3777
104 Ga0068858_100070810 3300005842 Bacteria 3233
105 Ga0068858_100118826 3300005842 Bacteria 2471
106 Ga0068860_100000450 3300005843 Bacteria 52006
107 Ga0068860_100000474 3300005843 Bacteria 49979
108 Ga0068860_100001423 3300005843 Bacteria 25915
109 Ga0068860_100021734 3300005843 Bacteria 6209
110 Ga0068860_100086783 3300005843 Bacteria 2978
111 Ga0068860_100232945 3300005843 Bacteria 1790
112 Ga0068862_100000016 3300005844 Bacteria 250031
113 Ga0068862_100000105 3300005844 Bacteria 99930
114 Ga0068862_100011447 3300005844 Bacteria 7322
115 Ga0068862_100061327 3300005844 Bacteria 3232
116 Ga0068862_100080104 3300005844 Bacteria 2831
117 Ga0070717_10165463 3300006028 Bacteria 1921
118 Ga0070717_10244363 3300006028 Bacteria 1584
119 Ga0075432_10006547 3300006058 Bacteria 3965
120 Ga0075432_10035849 3300006058 Bacteria 1723
121 Ga0070715_10000618 3300006163 Bacteria 9385
122 Ga0070716_100005358 3300006173 Bacteria 6206
123 Ga0070712_100002095 3300006175 Bacteria 12257
124 Ga0097621_100016928 3300006237 Bacteria 5526
125 Ga0075436_100087011 3300006914 Bacteria 2170
126 Ga0097620_100022203 3300006931 Bacteria 6363
127 Ga0097620_100121150 3300006931 Bacteria 2682
128 Ga0097620_100145893 3300006931 Bacteria 2441
129 Ga0097620_100164402 3300006931 Bacteria 2299
130 Ga0105251_10001177 3300009011 Bacteria 22695
131 Ga0105251_10025901 3300009011 Bacteria 2992
132 Ga0105250_10000186 3300009092 Bacteria 53643
133 Ga0105250_10004727 3300009092 Bacteria 6217
134 Ga0105240_10008858 3300009093 Bacteria 14330
135 Ga0105245_10013559 3300009098 Bacteria 7100
136 Ga0105247_10051785 3300009101 Bacteria 2530
137 Ga0114129_10075734 3300009147 Bacteria 4685
138 Ga0114129_10467360 3300009147 Bacteria 1652
139 Ga0114129_10712933 3300009147 Bacteria 1288
140 Ga0105242_10036936 3300009176 Bacteria 3922
141 Ga0105248_10003755 3300009177 Bacteria 16832
142 Ga0105248_10007376 3300009177 Bacteria 12073
143 Ga0105248_10029610 3300009177 Bacteria 6108
144 Ga0105248_10051605 3300009177 Bacteria 4615
145 Ga0105248_10079599 3300009177 Bacteria 3683
146 Ga0105248_10132984 3300009177 Bacteria 2807
147 Ga0105248_10418436 3300009177 Bacteria 1509
148 Ga0105237_10224366 3300009545 Bacteria 1879
149 Ga0105238_10004267 3300009551 Bacteria 14204
150 Ga0105249_10000004 3300009553 Bacteria 368014
151 Ga0105249_10030205 3300009553 Bacteria 4897
152 Ga0105249_10047668 3300009553 Bacteria 3905
153 Ga0105249_10095271 3300009553 Bacteria 2791
154 Ga0105148_100366 3300009978 Bacteria 5050
155 Ga0157373_10118934 3300013100 Bacteria 1857
156 Ga0157369_10068106 3300013105 Bacteria 3824
157 Ga0157378_10098766 3300013297 Bacteria 2663
158 Ga0163162_10043682 3300013306 Bacteria 4487
159 Ga0163162_10196113 3300013306 Bacteria 2148
160 Ga0157372_10032844 3300013307 Bacteria 5693
161 Ga0157375_10060892 3300013308 Bacteria 3746
162 Ga0163163_10000081 3300014325 Bacteria 104678
163 Ga0163163_10131859 3300014325 Bacteria 2539
164 Ga0163163_10320707 3300014325 Bacteria 1603
165 Ga0157380_10000025 3300014326 Bacteria 107388
166 Ga0157380_10001518 3300014326 Bacteria 15240
167 Ga0157380_10006959 3300014326 Bacteria 8003
168 Ga0157380_10180702 3300014326 Bacteria 1853
169 Ga0157379_10000207 3300014968 Bacteria 45489
170 Ga0157379_10012452 3300014968 Bacteria 7428
171 Ga0157379_10224363 3300014968 Bacteria 1703
172 Ga0163161_10001576 3300017792 Bacteria 16816
173 Ga0163161_10016614 3300017792 Bacteria 5140
174 Ga0163161_10079152 3300017792 Bacteria 2416
175 Ga0163161_10330035 3300017792 Bacteria 1208
176 Ga0209676_1000081 3300025292 Bacteria 285297
177 Ga0209050_1000232 3300025298 Bacteria 121822
178 Ga0209050_1001468 3300025298 Bacteria 25215
179 Ga0207697_10087619 3300025315 Bacteria 1317
180 Ga0207696_1000455 3300025711 Bacteria 35742
181 Ga0207696_1001933 3300025711 Bacteria 10530
182 Ga0207713_1000436 3300025735 Bacteria 43987
183 Ga0207713_1010386 3300025735 Bacteria 5153
184 Ga0207713_1037853 3300025735 Bacteria 2052
185 Ga0207692_10024356 3300025898 Bacteria 2813
186 Ga0207680_10005804 3300025903 Bacteria 5926
187 Ga0207680_10098349 3300025903 Bacteria 1875
188 Ga0207680_10108045 3300025903 Bacteria 1799
189 Ga0207680_10299123 3300025903 Bacteria 1121
190 Ga0207647_10012068 3300025904 Bacteria 6030
191 Ga0207647_10013300 3300025904 Bacteria 5710
192 Ga0207685_10034338 3300025905 Bacteria 1842
193 Ga0207699_10127061 3300025906 Bacteria 1657
194 Ga0207645_10001237 3300025907 Bacteria 21011
195 Ga0207643_10269161 3300025908 Bacteria 1054
196 Ga0207705_10000007 3300025909 Bacteria 597387
197 Ga0207654_10004912 3300025911 Bacteria 6770
198 Ga0207695_10004035 3300025913 Bacteria 20196
199 Ga0207671_10021901 3300025914 Bacteria 4842
200 Ga0207671_10088527 3300025914 Bacteria 2329
201 Ga0207693_10000379 3300025915 Bacteria 40846
202 Ga0207660_10102410 3300025917 Bacteria 2140
203 Ga0207657_10006357 3300025919 Bacteria 12272
204 Ga0207646_10151843 3300025922 Bacteria 2089
205 Ga0207646_10607910 3300025922 Bacteria 981
206 Ga0207681_10000013 3300025923 Bacteria 357411
207 Ga0207681_10000081 3300025923 Bacteria 85588
208 Ga0207681_10000255 3300025923 Bacteria 40599
209 Ga0207681_10001754 3300025923 Bacteria 13928
210 Ga0207681_10007751 3300025923 Bacteria 6578
211 Ga0207681_10023665 3300025923 Bacteria 3932
212 Ga0207681_10045258 3300025923 Bacteria 2954
213 Ga0207681_10174143 3300025923 Bacteria 1633
214 Ga0207694_10009301 3300025924 Bacteria 7416
215 Ga0207694_10019117 3300025924 Bacteria 5179
216 Ga0207650_10000002 3300025925 Bacteria 1439222
217 Ga0207650_10000008 3300025925 Bacteria 498534
218 Ga0207650_10030450 3300025925 Bacteria 3888
219 Ga0207664_10047178 3300025929 Bacteria 3383
220 Ga0207644_10000004 3300025931 Bacteria 566613
221 Ga0207644_10000020 3300025931 Bacteria 165455
222 Ga0207644_10001897 3300025931 Bacteria 13580
223 Ga0207644_10005491 3300025931 Bacteria 8256
224 Ga0207644_10016838 3300025931 Bacteria 4924
225 Ga0207644_10254375 3300025931 Bacteria 1402
226 Ga0207706_10008905 3300025933 Bacteria 9238
227 Ga0207706_10060741 3300025933 Bacteria 3329
228 Ga0207686_10059971 3300025934 Bacteria 2406
229 Ga0207670_10214601 3300025936 Bacteria 1469
230 Ga0207704_10018191 3300025938 Bacteria 3664
231 Ga0207665_10002705 3300025939 Bacteria 11892
232 Ga0207691_10001275 3300025940 Bacteria 25192
233 Ga0207711_10001343 3300025941 Bacteria 23216
234 Ga0207711_10001838 3300025941 Bacteria 19346
235 Ga0207711_10001851 3300025941 Bacteria 19297
236 Ga0207711_10031863 3300025941 Bacteria 4454
237 Ga0207711_10096446 3300025941 Bacteria 2610
238 Ga0207711_10246433 3300025941 Bacteria 1639
239 Ga0207667_10004045 3300025949 Bacteria 18017
240 Ga0207667_10008291 3300025949 Bacteria 12361
241 Ga0207667_10018025 3300025949 Bacteria 7929
242 Ga0207712_10000008 3300025961 Bacteria 527957
243 Ga0207712_10067845 3300025961 Bacteria 2554
244 Ga0207712_10077736 3300025961 Bacteria 2406
245 Ga0207712_10148305 3300025961 Bacteria 1809
246 Ga0207712_10256033 3300025961 Bacteria 1417
247 Ga0207668_10003751 3300025972 Bacteria 8946
248 Ga0207668_10004561 3300025972 Bacteria 8148
249 Ga0207668_10005445 3300025972 Bacteria 7495
250 Ga0207668_10060017 3300025972 Bacteria 2668
251 Ga0207668_10310800 3300025972 Bacteria 1304
252 Ga0207640_10000279 3300025981 Bacteria 34340
253 Ga0207640_10016415 3300025981 Bacteria 4307
254 Ga0207640_10292998 3300025981 Bacteria 1284
255 Ga0207658_10000001 3300025986 Bacteria 1439333
256 Ga0207658_10001301 3300025986 Bacteria 19696
257 Ga0207658_10003517 3300025986 Bacteria 11057
258 Ga0207658_10007936 3300025986 Bacteria 7230
259 Ga0207658_10015482 3300025986 Bacteria 5231
260 Ga0207658_10066958 3300025986 Bacteria 2704
261 Ga0207703_10010844 3300026035 Bacteria 7107
262 Ga0207703_10012379 3300026035 Bacteria 6648
263 Ga0207703_10083095 3300026035 Bacteria 2675
264 Ga0207678_10016055 3300026067 Bacteria 6576
265 Ga0207641_10005772 3300026088 Bacteria 10509
266 Ga0207641_10043161 3300026088 Bacteria 3785
267 Ga0207641_10050239 3300026088 Bacteria 3527
268 Ga0207641_10295210 3300026088 Bacteria 1529
269 Ga0207648_10006902 3300026089 Bacteria 11248
270 Ga0207676_10000001 3300026095 Bacteria 1439222
271 Ga0207676_10000012 3300026095 Bacteria 353971
272 Ga0207674_10004418 3300026116 Bacteria 16920
273 Ga0207674_10152143 3300026116 Bacteria 2270
274 Ga0207675_100000057 3300026118 Bacteria 81804
275 Ga0207675_100007183 3300026118 Bacteria 10523
276 Ga0207675_100014762 3300026118 Bacteria 7286
277 Ga0207683_10000798 3300026121 Bacteria 28764
278 Ga0207683_10763074 3300026121 Bacteria 897
279 Ga0207698_10000919 3300026142 Bacteria 17125
280 Ga0207698_10003339 3300026142 Bacteria 9657
281 Ga0207698_10213872 3300026142 Bacteria 1736
282 Ga0209971_1001080 3300027682 Bacteria 6932
283 Ga0209966_1022150 3300027695 Bacteria 1241
284 Ga0209998_10009053 3300027717 Bacteria 2062
285 Ga0209974_10009783 3300027876 Bacteria 3250
286 Ga0209974_10029862 3300027876 Bacteria 1807
287 Ga0207428_10003679 3300027907 Bacteria 14756
288 Ga0207428_10076296 3300027907 Bacteria 2625
289 Ga0207428_10171339 3300027907 Bacteria 1644
290 Ga0268266_10000205 3300028379 Bacteria 103915
291 Ga0268266_10000945 3300028379 Bacteria 36992
292 Ga0268266_10008275 3300028379 Bacteria 9268
293 Ga0268266_10011566 3300028379 Bacteria 7660
294 Ga0268266_10122578 3300028379 Bacteria 2315
295 Ga0268266_10125830 3300028379 Bacteria 2287
296 Ga0268266_10130268 3300028379 Bacteria 2249
297 Ga0268266_10155668 3300028379 Bacteria 2064
298 Ga0268266_10257209 3300028379 Bacteria 1617
299 Ga0268265_10000006 3300028380 Bacteria 466482
300 Ga0268265_10000216 3300028380 Bacteria 66604
301 Ga0268265_10004038 3300028380 Bacteria 10333
302 Ga0268265_10013639 3300028380 Bacteria 5527
303 Ga0268265_10014446 3300028380 Bacteria 5380
304 Ga0268265_10022817 3300028380 Bacteria 4403
305 Ga0268264_10000004 3300028381 Bacteria 1116842
306 Ga0268264_10001169 3300028381 Bacteria 25510
307 Ga0268264_10004485 3300028381 Bacteria 11912
308 Ga0268264_10022075 3300028381 Bacteria 5195
309 Ga0268264_10035438 3300028381 Bacteria 4108
310 Ga0268264_10043053 3300028381 Bacteria 3740
311 Ga0307517_10190725 3300028786 Bacteria 1302
312 Ga0307515_10000192 3300028794 Bacteria 149030
313 Ga0307515_10078846 3300028794 Bacteria 4324
314 Ga0307512_10015238 3300030522 Bacteria 7135
315 Ga0265331_10007423 3300031250 Bacteria 6344
316 Ga0265327_10000229 3300031251 Bacteria 113907
317 Ga0307509_10022794 3300031507 Bacteria 7047
318 Ga0307516_10046421 3300031730 Bacteria 4286
319 Ga0307405_10000504 3300031731 Bacteria 14716
320 Ga0307406_10316255 3300031901 Bacteria 1206
321 Ga0307412_10040364 3300031911 Bacteria 3019
322 Ga0307414_10006131 3300032004 Bacteria 6678
323 Ga0307414_10566588 3300032004 Bacteria 1014
324 Ga0373934_0083460 3300035086 Bacteria 1284
325 Ga0373935_0057225 3300035692 Bacteria 2487
326 Ga0373933_0062920 3300035724 Bacteria 2242
327 Ga0373933_0068470 3300035724 Bacteria 2156
328 Ga0373937_0033412 3300036401 Bacteria 4671
329 Ga0373937_0078930 3300036401 Bacteria 3042
330 Ga0439438_001613 3300041405 Bacteria 9898
331 Ga0439466_0007737 3300041411 Bacteria 4059
332 Ga0450902_000064 3300042137 Bacteria 10289
333 Ga0450903_000363 3300042138 Bacteria 9996
334 Ga0451576_0236858 3300045051 Bacteria 1906
335 Ga0466967_0009262 3300045976 Bacteria 7295
336 Ga0495627_005890 3300046453 Bacteria 4870
337 Ga0495590_0008769 3300046457 Bacteria 3846
338 Ga0495638_0001649 3300046460 Bacteria 19767
339 Ga0495638_0003369 3300046460 Bacteria 12604
340 Ga0495638_0023345 3300046460 Bacteria 4045
341 Ga0495638_0039020 3300046460 Bacteria 3016
342 Ga0495651_0031298 3300046462 Bacteria 4149
343 Ga0495653_0328959 3300046463 Bacteria 988
344 Ga0495650_0001059 3300046471 Bacteria 30518
345 Ga0495650_0012749 3300046471 Bacteria 4501
346 Ga0495580_0000466 3300046472 Bacteria 33634
347 Ga0495605_0007541 3300046474 Bacteria 6168
348 Ga0495605_0034178 3300046474 Bacteria 2575
349 Ga0495584_0068326 3300046491 Bacteria 1785
350 Ga0495585_0035350 3300046492 Bacteria 2824
351 Ga0495596_0000103 3300046500 Bacteria 60746
352 Ga0495607_0003627 3300046501 Bacteria 11724
353 Ga0495606_0006542 3300046507 Bacteria 10716
354 Ga0495608_0119934 3300046511 Bacteria 1687
355 Ga0495610_0006384 3300046512 Bacteria 8132
356 Ga0495610_0009726 3300046512 Bacteria 6046
357 Ga0495610_0031804 3300046512 Bacteria 2749
358 Ga0495616_0015454 3300046513 Bacteria 4246
359 Ga0495616_0109498 3300046513 Bacteria 1284
360 Ga0495620_0006696 3300046515 Bacteria 6311
361 Ga0495632_0002493 3300046519 Bacteria 13971
362 Ga0495632_0011723 3300046519 Bacteria 5103
363 Ga0495632_0106674 3300046519 Bacteria 1317
364 Ga0495637_0000467 3300046520 Bacteria 29562
365 Ga0495637_0026547 3300046520 Bacteria 2597
366 Ga0495637_0047797 3300046520 Bacteria 1805
367 Ga0495643_0002438 3300046522 Bacteria 14759
368 Ga0495643_0021097 3300046522 Bacteria 3743
369 Ga0495643_0029858 3300046522 Bacteria 3048
370 Ga0495644_0002086 3300046523 Bacteria 8051
371 Ga0495644_0021105 3300046523 Bacteria 2484
372 Ga0495648_0026436 3300046524 Bacteria 3907
373 Ga0495648_0045723 3300046524 Bacteria 2720
374 Ga0495654_0002758 3300046530 Bacteria 11067
375 Ga0495654_0064396 3300046530 Bacteria 1752
376 Ga0495597_0002575 3300046542 Bacteria 11330
377 Ga0495597_0072603 3300046542 Bacteria 1480
378 Ga0495668_0000610 3300046616 Bacteria 43140
379 Ga0495625_0018910 3300046660 Bacteria 5362
380 Ga0495661_0013071 3300046665 Bacteria 5585
381 Ga0495661_0045175 3300046665 Bacteria 2695
382 Ga0495599_0000339 3300046678 Bacteria 27900
383 Ga0495623_0006086 3300046679 Bacteria 7849
384 Ga0495623_0032584 3300046679 Bacteria 3349
385 Ga0495623_0075626 3300046679 Bacteria 2091
386 Ga0495670_0162524 3300046691 Bacteria 1173
387 Ga0495671_0022237 3300046692 Bacteria 3323
388 Ga0495671_0119081 3300046692 Bacteria 1288
389 Ga0495649_0017371 3300046694 Bacteria 4059
390 Ga0495589_0006215 3300046794 Bacteria 6307
391 Ga0495660_0016542 3300046810 Bacteria 4252
392 Ga0495660_0078837 3300046810 Bacteria 1730
393 Ga0495660_0129005 3300046810 Bacteria 1270
394 Ga0495604_0017565 3300047317 Bacteria 5728
395 Ga0495604_0032772 3300047317 Bacteria 4116
396 Ga0495604_0035994 3300047317 Bacteria 3905
397 Ga0495672_0008145 3300047320 Bacteria 7782
398 Ga0495672_0130979 3300047320 Bacteria 1319
399 Ga0495683_0004060 3300047323 Bacteria 8390
400 Ga0495683_0026253 3300047323 Bacteria 2980
401 Ga0495673_0044582 3300047469 Bacteria 1977
402 Ga0495681_0019780 3300047470 Bacteria 3666
403 Ga0495681_0027952 3300047470 Bacteria 2910
404 Ga0495686_0081504 3300047472 Bacteria 1976
405 Ga0495602_0044914 3300048088 Bacteria 4003
406 Ga0495626_0000803 3300048091 Bacteria 28383
407 Ga0496100_0063446 3300048903 Bacteria 2441
408 Ga0496100_0091619 3300048903 Bacteria 2075
409 Ga0496100_0234821 3300048903 Bacteria 1351
410 Ga0496101_0004403 3300048904 Bacteria 8854
411 Ga0496101_0006175 3300048904 Bacteria 7700
412 Ga0496102_0000149 3300048905 Bacteria 95638
413 Ga0496102_0000178 3300048905 Bacteria 86174
414 Ga0496102_0017774 3300048905 Bacteria 6234
415 Ga0496102_0238128 3300048905 Bacteria 1716
416 Ga0496103_0000049 3300048906 Bacteria 154466
417 Ga0496103_0000119 3300048906 Bacteria 86194
418 Ga0496103_0009374 3300048906 Bacteria 5798
419 Ga0496103_0020412 3300048906 Bacteria 3979
420 Ga0496103_0053753 3300048906 Bacteria 2496
421 Ga0496103_0121596 3300048906 Bacteria 1663
422 Ga0496104_0000165 3300048907 Bacteria 58816
423 Ga0496104_0005808 3300048907 Bacteria 10806
424 Ga0496104_0103714 3300048907 Bacteria 2724
425 Ga0496105_0000193 3300048908 Bacteria 40676
426 Ga0496105_0000384 3300048908 Bacteria 29011
427 Ga0496105_0196696 3300048908 Bacteria 1647
428 Ga0496106_0005649 3300048909 Bacteria 9255
429 Ga0496106_0291584 3300048909 Bacteria 1308
430 Ga0496107_0005680 3300048910 Bacteria 8533
431 Ga0496107_0025742 3300048910 Bacteria 4167
432 Ga0496108_0007112 3300048911 Bacteria 9066
433 Ga0496108_0023884 3300048911 Bacteria 5032
434 Ga0496108_0237754 3300048911 Bacteria 1584
435 Ga0496109_0128962 3300048912 Bacteria 2360
436 Ga0496109_0508989 3300048912 Bacteria 1136
437 Ga0496109_0584802 3300048912 Bacteria 1052
438 Ga0496110_0003920 3300048913 Bacteria 11449
439 Ga0496110_0005735 3300048913 Bacteria 9754
440 Ga0496110_0006512 3300048913 Bacteria 9264
441 Ga0496110_0117251 3300048913 Bacteria 2397
442 Ga0496111_0088124 3300048914 Bacteria 2272
443 Ga0496112_0018100 3300048915 Bacteria 6629
444 Ga0496112_0092432 3300048915 Bacteria 2995
445 Ga0496112_0203638 3300048915 Bacteria 1937
446 Ga0496112_0524401 3300048915 Bacteria 1119
447 Ga0496112_0620366 3300048915 Bacteria 1012
448 Ga0496113_0002690 3300048916 Bacteria 10426
449 Ga0496113_0008095 3300048916 Bacteria 6825
450 Ga0496113_0030410 3300048916 Bacteria 3909
451 Ga0496113_0038501 3300048916 Bacteria 3516
452 Ga0496114_0002414 3300048917 Bacteria 14245
453 Ga0496114_0022512 3300048917 Bacteria 5136
454 Ga0496115_0000253 3300048918 Bacteria 47511
455 Ga0496115_0164396 3300048918 Bacteria 1835
456 Ga0496115_0354721 3300048918 Bacteria 1196
457 Ga0496116_0000078 3300048919 Bacteria 227712
458 Ga0496116_0088573 3300048919 Bacteria 1891
459 Ga0496117_0000123 3300048920 Bacteria 169805
460 Ga0496117_0000318 3300048920 Bacteria 84351
461 Ga0496117_0007958 3300048920 Bacteria 10181
462 Ga0496117_0011681 3300048920 Bacteria 7839
463 Ga0496118_0000186 3300048921 Bacteria 108940
464 Ga0496118_0044037 3300048921 Bacteria 3499
465 Ga0496118_0149063 3300048921 Bacteria 1467
466 Ga0496118_0169669 3300048921 Bacteria 1335
467 Ga0496118_0292132 3300048921 Bacteria 900
468 Ga0496119_0000121 3300048922 Bacteria 109164
469 Ga0496119_0005200 3300048922 Bacteria 12574
470 Ga0496120_0002006 3300048923 Bacteria 22142
471 Ga0496120_0017810 3300048923 Bacteria 4592
472 Ga0496121_0001102 3300048924 Bacteria 47573
473 Ga0496121_0001167 3300048924 Bacteria 46089
474 Ga0496121_0005678 3300048924 Bacteria 15872
475 Ga0496121_0016348 3300048924 Bacteria 7667
476 Ga0496121_0130569 3300048924 Bacteria 1881
477 Ga0496122_0001958 3300048925 Bacteria 30842
478 Ga0496122_0007455 3300048925 Bacteria 12146
479 Ga0496122_0009975 3300048925 Bacteria 9888
480 Ga0496122_0016402 3300048925 Bacteria 7008
481 Ga0496122_0019308 3300048925 Bacteria 6233
482 Ga0496122_0118831 3300048925 Bacteria 1711
483 Ga0496123_0001507 3300048926 Bacteria 32271
484 Ga0496123_0001522 3300048926 Bacteria 32045
485 Ga0496123_0024635 3300048926 Bacteria 4567
486 Ga0496123_0055708 3300048926 Bacteria 2591
487 Ga0496124_0000127 3300048927 Bacteria 158376
488 Ga0496124_0000324 3300048927 Bacteria 88327
489 Ga0496124_0005269 3300048927 Bacteria 14634
490 Ga0496124_0005490 3300048927 Bacteria 14232
491 Ga0496124_0015055 3300048927 Bacteria 7438
492 Ga0496124_0016818 3300048927 Bacteria 6933
493 Ga0496124_0037494 3300048927 Bacteria 4215
494 Ga0496124_0157577 3300048927 Bacteria 1774
495 Ga0496125_0001272 3300048928 Bacteria 37495
496 Ga0496125_0011326 3300048928 Bacteria 8932
497 Ga0496125_0020549 3300048928 Bacteria 6195
498 Ga0496125_0043555 3300048928 Bacteria 3806
499 Ga0496125_0080593 3300048928 Bacteria 2490
500 Ga0496125_0144020 3300048928 Bacteria 1651
501 Ga0496125_0215726 3300048928 Bacteria 1241
502 Ga0496126_0000045 3300048929 Bacteria 331225
503 Ga0496126_0000058 3300048929 Bacteria 272530
504 Ga0496126_0001180 3300048929 Bacteria 42930
505 Ga0496126_0003207 3300048929 Bacteria 20981
506 Ga0496126_0013335 3300048929 Bacteria 8368
507 Ga0496126_0173928 3300048929 Bacteria 1833
508 Ga0496126_0297256 3300048929 Bacteria 1333
509 Ga0496126_0319861 3300048929 Bacteria 1276
510 Ga0496126_0380018 3300048929 Bacteria 1150
511 Ga0495678_001781 3300049459 Bacteria 15921
512 Ga0495682_0000947 3300049460 Bacteria 17562
513 Ga0501290_000098 3300049513 Bacteria 12826
514 Ga0501292_000006 3300049515 Bacteria 90286
515 Ga0501294_000382 3300049517 Bacteria 5395
516 Ga0501302_001651 3300049525 Bacteria 1236
517 Ga0501314_000143 3300049530 Bacteria 3555
518 Ga0501031_0100514 3300049568 Bacteria 1887
519 Ga0501032_0010074 3300049569 Bacteria 6823
520 Ga0501032_0145147 3300049569 Bacteria 1562
521 Ga0501033_0001353 3300049570 Bacteria 21844
522 Ga0501033_0003694 3300049570 Bacteria 12445
523 Ga0501033_0172491 3300049570 Bacteria 1553
524 Ga0501034_0002426 3300049571 Bacteria 22542
525 Ga0501034_0002846 3300049571 Bacteria 20161
526 Ga0501034_0005350 3300049571 Bacteria 14056
527 Ga0501034_0031029 3300049571 Bacteria 5431
528 Ga0501036_0006504 3300049572 Bacteria 9495
529 Ga0501037_0008952 3300049573 Bacteria 7335
530 Ga0501037_0222651 3300049573 Bacteria 1327
531 Ga0501038_0010873 3300049574 Bacteria 8313
532 Ga0501039_0020608 3300049575 Bacteria 5053
533 Ga0501039_0058072 3300049575 Bacteria 2996
534 Ga0501043_0006030 3300049579 Bacteria 9737
535 Ga0501046_0091470 3300049580 Bacteria 2340
536 Ga0501047_0000220 3300049581 Bacteria 68612
537 Ga0501047_0183002 3300049581 Bacteria 1961
538 Ga0501048_0461374 3300049582 Bacteria 910
539 Ga0501202_003721 3300049652 Bacteria 2628
540 Ga0501206_000800 3300049653 Bacteria 3850
541 Ga0501222_001077 3300049662 Bacteria 3871
542 Ga0501223_000006 3300049663 Bacteria 133378
543 Ga0501223_000023 3300049663 Bacteria 64396
544 Ga0501223_005080 3300049663 Bacteria 2782
545 Ga0501224_000001 3300049664 Bacteria 308131
546 Ga0501227_003797 3300049665 Bacteria 3266
547 Ga0501233_000014 3300049668 Bacteria 27843
548 Ga0501235_001084 3300049669 Bacteria 5687
549 Ga0501246_000076 3300049676 Bacteria 5467
550 Ga0501261_000041 3300049690 Bacteria 25813
551 Ga0501221_025040 3300049704 Bacteria 1202
552 Ga0501221_025690 3300049704 Bacteria 1192
553 Ga0501225_0000005 3300049705 Bacteria 133194
554 Ga0501225_0000477 3300049705 Bacteria 12480
555 Ga0501225_0001290 3300049705 Bacteria 7767
556 Ga0501225_0010780 3300049705 Bacteria 2582
557 Ga0501225_0059975 3300049705 Bacteria 1069
558 Ga0501234_000791 3300049707 Bacteria 4946
559 Ga0501245_012906 3300049708 Bacteria 1230
560 Ga0501279_000006 3300049775 Bacteria 152264
561 Ga0501280_000017 3300049776 Bacteria 54657
562 Ga0501281_00003 3300049777 Bacteria 40318
563 Ga0501282_002037 3300049778 Bacteria 2224
564 Ga0501283_001213 3300049779 Bacteria 3403
565 Ga0501035_0000815 3300049822 Bacteria 33266
566 Ga0501044_0003728 3300049823 Bacteria 17117
567 Ga0501044_0010440 3300049823 Bacteria 10080
568 Ga0501226_000050 3300049853 Bacteria 51521
569 nmdc:mga03n38_285869_c1 3300050490 Bacteria 882
570 nmdc:mga05p37_381154_c1 3300050507 Bacteria 1652
571 nmdc:mga09592_187731_c1 3300050508 Bacteria 1789
572 nmdc:mga08y16_89194_c1 3300050511 Bacteria 3214
573 nmdc:mga08x19_23046_c1 3300050514 Bacteria 3861
574 Ga0500595_029382 3300053119 Bacteria 1865
575 Ga0500618_003298 3300053125 Bacteria 5600
576 Ga0500658_0006472 3300053134 Bacteria 4345
577 Ga0500564_044426 3300053138 Bacteria 2041
578 Ga0500568_0002823 3300053139 Bacteria 10032
579 Ga0500573_0000027 3300053140 Bacteria 143529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049530 Ga0501314_000143 Ga0501314_000143_2448_3239 236
2 3300049663 Ga0501223_000023 Ga0501223_000023_12399_13190 236
3 3300049664 Ga0501224_000001 Ga0501224_000001_94844_95635 236
4 3300049668 Ga0501233_000014 Ga0501233_000014_109_900 236
5 3300049705 Ga0501225_0000477 Ga0501225_0000477_742_1533 236
6 3300049707 Ga0501234_000791 Ga0501234_000791_3082_3873 236
7 3300049853 Ga0501226_000050 Ga0501226_000050_12212_13003 236
8 3300005327 Ga0070658_10000304 Ga0070658_1000030420 240
9 3300005563 Ga0068855_100020494 Ga0068855_1000204942 240
10 3300025909 Ga0207705_10000007 Ga0207705_10000007442 240
11 3300025913 Ga0207695_10004035 Ga0207695_100040359 240
12 3300025949 Ga0207667_10018025 Ga0207667_100180252 240
13 3300026116 Ga0207674_10152143 Ga0207674_101521432 240
14 iso_pu_bacteria 2643221541 2643727930 243
15 iso_pu_bacteria 2643221606 2644043120 243
16 iso_pu_bacteria 2643221671 2644395449 243
17 3300009545 Ga0105237_10224366 Ga0105237_102243662 244
18 3300025914 Ga0207671_10088527 Ga0207671_100885272 244
19 3300048919 Ga0496116_0088573 Ga0496116_0088573_606_1397 245
20 3300009093 Ga0105240_10008858 Ga0105240_1000885810 246
21 3300050490 nmdc:mga03n38_285869_c1 nmdc:mga03n38_285869_c1_123_863 246
22 3300049569 Ga0501032_0145147 Ga0501032_0145147_569_1312 247
23 3300049579 Ga0501043_0006030 Ga0501043_0006030_2315_3058 247
24 3300049580 Ga0501046_0091470 Ga0501046_0091470_1352_2095 247
25 3300049581 Ga0501047_0000220 Ga0501047_0000220_22232_22975 247
26 3300005440 Ga0070705_100124955 Ga0070705_1001249553 248
27 3300009147 Ga0114129_10712933 Ga0114129_107129331 248
28 3300009177 Ga0105248_10029610 Ga0105248_100296106 248
29 3300009978 Ga0105148_100366 Ga0105148_1003664 248
30 3300013306 Ga0163162_10196113 Ga0163162_101961132 248
31 3300031901 Ga0307406_10316255 Ga0307406_103162552 248
32 3300041405 Ga0439438_001613 Ga0439438_001613_8839_9588 248
33 3300041411 Ga0439466_0007737 Ga0439466_0007737_585_1334 248
34 3300042137 Ga0450902_000064 Ga0450902_000064_6870_7619 248
35 3300042138 Ga0450903_000363 Ga0450903_000363_6460_7209 248
36 3300046457 Ga0495590_0008769 Ga0495590_0008769_2152_2901 248
37 3300046460 Ga0495638_0023345 Ga0495638_0023345_3105_3854 248
38 3300046460 Ga0495638_0039020 Ga0495638_0039020_2233_2982 248
39 3300046471 Ga0495650_0001059 Ga0495650_0001059_7486_8235 248
40 3300046474 Ga0495605_0034178 Ga0495605_0034178_1370_2119 248
41 3300046492 Ga0495585_0035350 Ga0495585_0035350_1333_2082 248
42 3300046500 Ga0495596_0000103 Ga0495596_0000103_17822_18571 248
43 3300046501 Ga0495607_0003627 Ga0495607_0003627_35_784 248
44 3300046507 Ga0495606_0006542 Ga0495606_0006542_9078_9827 248
45 3300046512 Ga0495610_0009726 Ga0495610_0009726_3656_4405 248
46 3300046513 Ga0495616_0015454 Ga0495616_0015454_378_1127 248
47 3300046513 Ga0495616_0109498 Ga0495616_0109498_192_941 248
48 3300046515 Ga0495620_0006696 Ga0495620_0006696_3119_3868 248
49 3300046519 Ga0495632_0002493 Ga0495632_0002493_10821_11570 248
50 3300046519 Ga0495632_0011723 Ga0495632_0011723_1753_2502 248
51 3300046520 Ga0495637_0000467 Ga0495637_0000467_10790_11539 248
52 3300046520 Ga0495637_0047797 Ga0495637_0047797_661_1410 248
53 3300046522 Ga0495643_0002438 Ga0495643_0002438_4351_5100 248
54 3300046522 Ga0495643_0021097 Ga0495643_0021097_2530_3279 248
55 3300046523 Ga0495644_0021105 Ga0495644_0021105_366_1115 248
56 3300046524 Ga0495648_0026436 Ga0495648_0026436_330_1079 248
57 3300046524 Ga0495648_0045723 Ga0495648_0045723_1687_2436 248
58 3300046530 Ga0495654_0002758 Ga0495654_0002758_6889_7638 248
59 3300046542 Ga0495597_0002575 Ga0495597_0002575_2361_3110 248
60 3300046616 Ga0495668_0000610 Ga0495668_0000610_10884_11633 248
61 3300046660 Ga0495625_0018910 Ga0495625_0018910_4211_4960 248
62 3300046665 Ga0495661_0045175 Ga0495661_0045175_1884_2633 248
63 3300046692 Ga0495671_0022237 Ga0495671_0022237_1370_2119 248
64 3300046694 Ga0495649_0017371 Ga0495649_0017371_63_812 248
65 3300046794 Ga0495589_0006215 Ga0495589_0006215_2096_2845 248
66 3300046810 Ga0495660_0016542 Ga0495660_0016542_62_811 248
67 3300046810 Ga0495660_0078837 Ga0495660_0078837_749_1498 248
68 3300046810 Ga0495660_0129005 Ga0495660_0129005_330_1079 248
69 3300047320 Ga0495672_0130979 Ga0495672_0130979_266_1015 248
70 3300047470 Ga0495681_0027952 Ga0495681_0027952_350_1099 248
71 3300048091 Ga0495626_0000803 Ga0495626_0000803_20896_21645 248
72 3300048911 Ga0496108_0237754 Ga0496108_0237754_63_809 248
73 3300048915 Ga0496112_0620366 Ga0496112_0620366_20_766 248
74 3300048916 Ga0496113_0002690 Ga0496113_0002690_4440_5186 248
75 3300048919 Ga0496116_0000078 Ga0496116_0000078_144050_144796 248
76 3300048925 Ga0496122_0001958 Ga0496122_0001958_11931_12677 248
77 3300048925 Ga0496122_0007455 Ga0496122_0007455_503_1249 248
78 3300048926 Ga0496123_0001507 Ga0496123_0001507_29634_30380 248
79 3300048926 Ga0496123_0001522 Ga0496123_0001522_7096_7842 248
80 3300048927 Ga0496124_0000127 Ga0496124_0000127_1262_2008 248
81 3300048928 Ga0496125_0020549 Ga0496125_0020549_1675_2421 248
82 3300048928 Ga0496125_0215726 Ga0496125_0215726_385_1131 248
83 3300048929 Ga0496126_0000058 Ga0496126_0000058_201788_202534 248
84 3300049459 Ga0495678_001781 Ga0495678_001781_10807_11556 248
85 3300049663 Ga0501223_000006 Ga0501223_000006_114051_114797 248
86 3300049669 Ga0501235_001084 Ga0501235_001084_2242_2988 248
87 3300049676 Ga0501246_000076 Ga0501246_000076_4267_5013 248
88 3300049705 Ga0501225_0000005 Ga0501225_0000005_4794_5540 248
89 3300050514 nmdc:mga08x19_23046_c1 nmdc:mga08x19_23046_c1_1504_2253 248
90 3300006028 Ga0070717_10165463 Ga0070717_101654632 249
91 3300025922 Ga0207646_10607910 Ga0207646_106079101 249
92 3300047317 Ga0495604_0035994 Ga0495604_0035994_100_867 249
93 3300027682 Ga0209971_1001080 Ga0209971_10010802 250
94 3300027695 Ga0209966_1022150 Ga0209966_10221502 250
95 3300027717 Ga0209998_10009053 Ga0209998_100090532 250
96 3300027876 Ga0209974_10009783 Ga0209974_100097833 250
97 3300028794 Ga0307515_10078846 Ga0307515_100788462 250
98 3300035086 Ga0373934_0083460 Ga0373934_0083460_154_924 250
99 3300035724 Ga0373933_0062920 Ga0373933_0062920_103_873 250
100 3300036401 Ga0373937_0033412 Ga0373937_0033412_2079_2849 250
101 3300046462 Ga0495651_0031298 Ga0495651_0031298_1497_2267 250
102 3300046463 Ga0495653_0328959 Ga0495653_0328959_59_829 250
103 3300046511 Ga0495608_0119934 Ga0495608_0119934_337_1107 250
104 3300046679 Ga0495623_0075626 Ga0495623_0075626_598_1368 250
105 3300048926 Ga0496123_0024635 Ga0496123_0024635_2092_2883 251
106 3300048927 Ga0496124_0016818 Ga0496124_0016818_4707_5498 251
107 3300005578 Ga0068854_100000322 Ga0068854_1000003222 252
108 3300005616 Ga0068852_100000357 Ga0068852_10000035719 252
109 3300009551 Ga0105238_10004267 Ga0105238_100042675 252
110 3300025904 Ga0207647_10012068 Ga0207647_100120682 252
111 3300025924 Ga0207694_10019117 Ga0207694_100191172 252
112 3300025981 Ga0207640_10000279 Ga0207640_1000027917 252
113 3300026142 Ga0207698_10000919 Ga0207698_100009195 252
114 3300031507 Ga0307509_10022794 Ga0307509_100227942 252
115 3300048903 Ga0496100_0234821 Ga0496100_0234821_215_1000 252
116 3300002076 JGI24749J21850_1000150 JGI24749J21850_10001503 253
117 3300002239 JGI24034J26672_10006054 JGI24034J26672_100060542 253
118 3300002459 JGI24751J29686_10000002 JGI24751J29686_100000027 253
119 3300005295 Ga0065707_10095831 Ga0065707_100958312 253
120 3300005331 Ga0070670_100000012 Ga0070670_100000012192 253
121 3300005353 Ga0070669_100000064 Ga0070669_10000006418 253
122 3300005367 Ga0070667_100000828 Ga0070667_1000008288 253
123 3300005617 Ga0068859_100121149 Ga0068859_1001211494 253
124 3300005618 Ga0068864_100000010 Ga0068864_100000010289 253
125 3300005719 Ga0068861_100274352 Ga0068861_1002743522 253
126 3300005844 Ga0068862_100000016 Ga0068862_100000016186 253
127 3300006931 Ga0097620_100121150 Ga0097620_1001211502 253
128 3300009177 Ga0105248_10003755 Ga0105248_1000375514 253
129 3300009177 Ga0105248_10418436 Ga0105248_104184363 253
130 3300009553 Ga0105249_10047668 Ga0105249_100476684 253
131 3300014326 Ga0157380_10000025 Ga0157380_1000002539 253
132 3300017792 Ga0163161_10079152 Ga0163161_100791524 253
133 3300025923 Ga0207681_10000013 Ga0207681_10000013275 253
134 3300025925 Ga0207650_10000008 Ga0207650_10000008356 253
135 3300025941 Ga0207711_10001838 Ga0207711_1000183820 253
136 3300025961 Ga0207712_10077736 Ga0207712_100777363 253
137 3300025986 Ga0207658_10007936 Ga0207658_100079367 253
138 3300026095 Ga0207676_10000012 Ga0207676_1000001241 253
139 3300026118 Ga0207675_100000057 Ga0207675_1000000571 253
140 3300028380 Ga0268265_10000006 Ga0268265_10000006386 253
141 3300035692 Ga0373935_0057225 Ga0373935_0057225_900_1679 253
142 3300046491 Ga0495584_0068326 Ga0495584_0068326_645_1409 253
143 3300046520 Ga0495637_0026547 Ga0495637_0026547_282_1046 253
144 3300046542 Ga0495597_0072603 Ga0495597_0072603_81_845 253
145 3300048921 Ga0496118_0292132 Ga0496118_0292132_92_877 253
146 3300048929 Ga0496126_0319861 Ga0496126_0319861_132_923 253
147 3300005436 Ga0070713_100085797 Ga0070713_1000857972 254
148 3300005437 Ga0070710_10052968 Ga0070710_100529682 254
149 3300025898 Ga0207692_10024356 Ga0207692_100243563 254
150 3300025929 Ga0207664_10047178 Ga0207664_100471782 254
151 3300045051 Ga0451576_0236858 Ga0451576_0236858_412_1194 254
152 3300005347 Ga0070668_100000642 Ga0070668_10000064221 255
153 3300005367 Ga0070667_100002772 Ga0070667_1000027722 255
154 3300005548 Ga0070665_100153609 Ga0070665_1001536092 255
155 3300005841 Ga0068863_100272119 Ga0068863_1002721192 255
156 3300005842 Ga0068858_100052357 Ga0068858_1000523572 255
157 3300005844 Ga0068862_100011447 Ga0068862_1000114472 255
158 3300013297 Ga0157378_10098766 Ga0157378_100987662 255
159 3300025923 Ga0207681_10045258 Ga0207681_100452582 255
160 3300025972 Ga0207668_10005445 Ga0207668_100054455 255
161 3300026035 Ga0207703_10083095 Ga0207703_100830952 255
162 3300026088 Ga0207641_10295210 Ga0207641_102952102 255
163 3300026121 Ga0207683_10763074 Ga0207683_107630741 255
164 3300028379 Ga0268266_10155668 Ga0268266_101556682 255
165 3300028380 Ga0268265_10013639 Ga0268265_100136392 255
166 3300028794 Ga0307515_10000192 Ga0307515_1000019218 255
167 iso_pu_bacteria 8057101203 8057104829 255
168 3300031730 Ga0307516_10046421 Ga0307516_100464214 256
169 iso_pu_bacteria 2511231017 2511334187 256
170 iso_pu_bacteria 2643221563 2643832291 256
171 iso_pu_bacteria 2643221608 2644053914 256
172 iso_pu_bacteria 2882806704 2882806939 256
173 iso_pu_bacteria 2751185782 2753265790 257
174 iso_pu_bacteria 2895880812 2895885796 257
175 3300005295 Ga0065707_10082422 Ga0065707_1008242210 258
176 3300005719 Ga0068861_100015123 Ga0068861_1000151234 258
177 3300009092 Ga0105250_10000186 Ga0105250_1000018637 258
178 3300014326 Ga0157380_10006959 Ga0157380_100069595 258
179 3300014968 Ga0157379_10000207 Ga0157379_100002079 258
180 3300025711 Ga0207696_1000455 Ga0207696_100045515 258
181 3300026118 Ga0207675_100014762 Ga0207675_1000147625 258
182 3300027876 Ga0209974_10029862 Ga0209974_100298623 258
183 3300048921 Ga0496118_0169669 Ga0496118_0169669_407_1183 258
184 3300053134 Ga0500658_0006472 Ga0500658_0006472_1705_2481 258
185 3300001979 JGI24740J21852_10009422 JGI24740J21852_100094223 259
186 3300001990 JGI24737J22298_10008340 JGI24737J22298_100083402 259
187 3300002067 JGI24735J21928_10008586 JGI24735J21928_100085862 259
188 3300005327 Ga0070658_10008332 Ga0070658_100083323 259
189 3300005329 Ga0070683_100262035 Ga0070683_1002620351 259
190 3300005344 Ga0070661_100009928 Ga0070661_1000099287 259
191 3300005366 Ga0070659_100023370 Ga0070659_1000233702 259
192 3300005455 Ga0070663_100007527 Ga0070663_1000075273 259
193 3300005535 Ga0070684_100137999 Ga0070684_1001379993 259
194 3300005563 Ga0068855_100003651 Ga0068855_1000036512 259
195 3300005577 Ga0068857_100584268 Ga0068857_1005842682 259
196 3300005578 Ga0068854_100434966 Ga0068854_1004349661 259
197 3300005616 Ga0068852_100005824 Ga0068852_1000058246 259
198 3300005834 Ga0068851_10027096 Ga0068851_100270962 259
199 3300013100 Ga0157373_10118934 Ga0157373_101189341 259
200 3300013105 Ga0157369_10068106 Ga0157369_100681063 259
201 3300013307 Ga0157372_10032844 Ga0157372_100328442 259
202 3300025298 Ga0209050_1001468 Ga0209050_100146813 259
203 3300025904 Ga0207647_10013300 Ga0207647_100133006 259
204 3300025911 Ga0207654_10004912 Ga0207654_100049126 259
205 3300025914 Ga0207671_10021901 Ga0207671_100219011 259
206 3300025919 Ga0207657_10006357 Ga0207657_100063573 259
207 3300025924 Ga0207694_10009301 Ga0207694_100093012 259
208 3300025933 Ga0207706_10060741 Ga0207706_100607412 259
209 3300025949 Ga0207667_10004045 Ga0207667_1000404518 259
210 3300025949 Ga0207667_10008291 Ga0207667_100082918 259
211 3300025981 Ga0207640_10016415 Ga0207640_100164153 259
212 3300026067 Ga0207678_10016055 Ga0207678_100160555 259
213 3300026116 Ga0207674_10004418 Ga0207674_100044183 259
214 3300026142 Ga0207698_10003339 Ga0207698_1000333910 259
215 3300026142 Ga0207698_10213872 Ga0207698_102138722 259
216 3300053140 Ga0500573_0000027 Ga0500573_0000027_41992_42771 259
217 iso_pu_bacteria 2515154088 2515494364 259
218 iso_pu_bacteria 2515154137 2515757451 259
219 iso_pu_bacteria 2515154203 2516088930 259
220 3300003781 Ga0055536_1000120 Ga0055536_100012011 260
221 3300005288 Ga0065714_10005046 Ga0065714_100050464 260
222 3300005331 Ga0070670_100000026 Ga0070670_1000000267 260
223 3300005333 Ga0070677_10054674 Ga0070677_100546742 260
224 3300005335 Ga0070666_10017345 Ga0070666_100173454 260
225 3300005336 Ga0070680_100279011 Ga0070680_1002790112 260
226 3300005347 Ga0070668_100021926 Ga0070668_1000219262 260
227 3300005353 Ga0070669_100001050 Ga0070669_10000105017 260
228 3300005353 Ga0070669_100006689 Ga0070669_1000066892 260
229 3300005355 Ga0070671_100000077 Ga0070671_10000007757 260
230 3300005355 Ga0070671_100003136 Ga0070671_10000313611 260
231 3300005367 Ga0070667_100000002 Ga0070667_100000002156 260
232 3300005367 Ga0070667_100036976 Ga0070667_1000369763 260
233 3300005434 Ga0070709_10199934 Ga0070709_101999341 260
234 3300005436 Ga0070713_100003202 Ga0070713_1000032025 260
235 3300005437 Ga0070710_10008731 Ga0070710_100087313 260
236 3300005439 Ga0070711_100006415 Ga0070711_1000064154 260
237 3300005456 Ga0070678_100059574 Ga0070678_1000595743 260
238 3300005457 Ga0070662_100044811 Ga0070662_1000448112 260
239 3300005459 Ga0068867_100040064 Ga0068867_1000400643 260
240 3300005466 Ga0070685_10000009 Ga0070685_10000009101 260
241 3300005543 Ga0070672_100071928 Ga0070672_1000719284 260
242 3300005548 Ga0070665_100200590 Ga0070665_1002005902 260
243 3300005563 Ga0068855_100111522 Ga0068855_1001115222 260
244 3300005618 Ga0068864_100000002 Ga0068864_100000002322 260
245 3300005719 Ga0068861_100006004 Ga0068861_1000060044 260
246 3300005841 Ga0068863_100054520 Ga0068863_1000545203 260
247 3300005843 Ga0068860_100000450 Ga0068860_10000045040 260
248 3300006028 Ga0070717_10244363 Ga0070717_102443632 260
249 3300006058 Ga0075432_10006547 Ga0075432_100065474 260
250 3300006058 Ga0075432_10035849 Ga0075432_100358491 260
251 3300006163 Ga0070715_10000618 Ga0070715_100006183 260
252 3300006173 Ga0070716_100005358 Ga0070716_1000053586 260
253 3300006175 Ga0070712_100002095 Ga0070712_1000020954 260
254 3300006237 Ga0097621_100016928 Ga0097621_1000169283 260
255 3300006914 Ga0075436_100087011 Ga0075436_1000870113 260
256 3300009098 Ga0105245_10013559 Ga0105245_100135594 260
257 3300009147 Ga0114129_10467360 Ga0114129_104673602 260
258 3300009176 Ga0105242_10036936 Ga0105242_100369363 260
259 3300013308 Ga0157375_10060892 Ga0157375_100608923 260
260 3300014325 Ga0163163_10000081 Ga0163163_1000008123 260
261 3300014968 Ga0157379_10012452 Ga0157379_100124526 260
262 3300025292 Ga0209676_1000081 Ga0209676_100008129 260
263 3300025903 Ga0207680_10005804 Ga0207680_100058045 260
264 3300025903 Ga0207680_10108045 Ga0207680_101080452 260
265 3300025905 Ga0207685_10034338 Ga0207685_100343383 260
266 3300025906 Ga0207699_10127061 Ga0207699_101270613 260
267 3300025907 Ga0207645_10001237 Ga0207645_100012375 260
268 3300025908 Ga0207643_10269161 Ga0207643_102691612 260
269 3300025915 Ga0207693_10000379 Ga0207693_100003793 260
270 3300025917 Ga0207660_10102410 Ga0207660_101024103 260
271 3300025923 Ga0207681_10023665 Ga0207681_100236652 260
272 3300025925 Ga0207650_10000002 Ga0207650_10000002317 260
273 3300025931 Ga0207644_10000020 Ga0207644_10000020152 260
274 3300025931 Ga0207644_10016838 Ga0207644_100168384 260
275 3300025933 Ga0207706_10008905 Ga0207706_100089053 260
276 3300025934 Ga0207686_10059971 Ga0207686_100599713 260
277 3300025938 Ga0207704_10018191 Ga0207704_100181913 260
278 3300025939 Ga0207665_10002705 Ga0207665_100027053 260
279 3300025940 Ga0207691_10001275 Ga0207691_1000127521 260
280 3300025941 Ga0207711_10001343 Ga0207711_100013433 260
281 3300025972 Ga0207668_10060017 Ga0207668_100600172 260
282 3300025981 Ga0207640_10292998 Ga0207640_102929982 260
283 3300025986 Ga0207658_10000001 Ga0207658_100000011035 260
284 3300026088 Ga0207641_10043161 Ga0207641_100431613 260
285 3300026088 Ga0207641_10050239 Ga0207641_100502393 260
286 3300026089 Ga0207648_10006902 Ga0207648_1000690210 260
287 3300026095 Ga0207676_10000001 Ga0207676_10000001317 260
288 3300026118 Ga0207675_100007183 Ga0207675_1000071834 260
289 3300026121 Ga0207683_10000798 Ga0207683_1000079823 260
290 3300027907 Ga0207428_10003679 Ga0207428_100036794 260
291 3300027907 Ga0207428_10076296 Ga0207428_100762963 260
292 3300027907 Ga0207428_10171339 Ga0207428_101713392 260
293 3300028379 Ga0268266_10000945 Ga0268266_1000094514 260
294 3300028379 Ga0268266_10011566 Ga0268266_100115667 260
295 3300028379 Ga0268266_10130268 Ga0268266_101302683 260
296 3300028380 Ga0268265_10004038 Ga0268265_100040381 260
297 3300028381 Ga0268264_10000004 Ga0268264_10000004321 260
298 3300028786 Ga0307517_10190725 Ga0307517_101907251 260
299 3300030522 Ga0307512_10015238 Ga0307512_100152386 260
300 3300031250 Ga0265331_10007423 Ga0265331_100074233 260
301 3300031251 Ga0265327_10000229 Ga0265327_10000229104 260
302 3300031731 Ga0307405_10000504 Ga0307405_100005049 260
303 3300031911 Ga0307412_10040364 Ga0307412_100403643 260
304 3300032004 Ga0307414_10006131 Ga0307414_100061313 260
305 3300032004 Ga0307414_10566588 Ga0307414_105665881 260
306 3300035724 Ga0373933_0068470 Ga0373933_0068470_481_1269 260
307 3300036401 Ga0373937_0078930 Ga0373937_0078930_1009_1797 260
308 3300045976 Ga0466967_0009262 Ga0466967_0009262_3819_4607 260
309 3300046453 Ga0495627_005890 Ga0495627_005890_3169_3954 260
310 3300046460 Ga0495638_0001649 Ga0495638_0001649_5787_6572 260
311 3300046471 Ga0495650_0012749 Ga0495650_0012749_3084_3869 260
312 3300046472 Ga0495580_0000466 Ga0495580_0000466_18264_19052 260
313 3300046474 Ga0495605_0007541 Ga0495605_0007541_3006_3791 260
314 3300046512 Ga0495610_0006384 Ga0495610_0006384_6742_7527 260
315 3300046512 Ga0495610_0031804 Ga0495610_0031804_1318_2103 260
316 3300046519 Ga0495632_0106674 Ga0495632_0106674_173_958 260
317 3300046522 Ga0495643_0029858 Ga0495643_0029858_509_1291 260
318 3300046523 Ga0495644_0002086 Ga0495644_0002086_3116_3901 260
319 3300046530 Ga0495654_0064396 Ga0495654_0064396_192_977 260
320 3300046665 Ga0495661_0013071 Ga0495661_0013071_192_977 260
321 3300046678 Ga0495599_0000339 Ga0495599_0000339_832_1617 260
322 3300046679 Ga0495623_0006086 Ga0495623_0006086_673_1458 260
323 3300046679 Ga0495623_0032584 Ga0495623_0032584_2514_3302 260
324 3300046691 Ga0495670_0162524 Ga0495670_0162524_197_982 260
325 3300046692 Ga0495671_0119081 Ga0495671_0119081_312_1097 260
326 3300047317 Ga0495604_0017565 Ga0495604_0017565_4805_5590 260
327 3300047317 Ga0495604_0032772 Ga0495604_0032772_1697_2485 260
328 3300047320 Ga0495672_0008145 Ga0495672_0008145_3445_4230 260
329 3300047323 Ga0495683_0004060 Ga0495683_0004060_2959_3744 260
330 3300047323 Ga0495683_0026253 Ga0495683_0026253_1441_2226 260
331 3300047469 Ga0495673_0044582 Ga0495673_0044582_1001_1786 260
332 3300047470 Ga0495681_0019780 Ga0495681_0019780_2133_2918 260
333 3300048088 Ga0495602_0044914 Ga0495602_0044914_3046_3831 260
334 3300048904 Ga0496101_0004403 Ga0496101_0004403_6042_6830 260
335 3300048906 Ga0496103_0053753 Ga0496103_0053753_1150_1938 260
336 3300048907 Ga0496104_0103714 Ga0496104_0103714_1269_2057 260
337 3300048913 Ga0496110_0005735 Ga0496110_0005735_2609_3397 260
338 3300048917 Ga0496114_0022512 Ga0496114_0022512_801_1589 260
339 3300048928 Ga0496125_0144020 Ga0496125_0144020_31_819 260
340 3300048929 Ga0496126_0380018 Ga0496126_0380018_291_1079 260
341 3300049460 Ga0495682_0000947 Ga0495682_0000947_6465_7250 260
342 3300049513 Ga0501290_000098 Ga0501290_000098_2259_3047 260
343 3300049515 Ga0501292_000006 Ga0501292_000006_81156_81944 260
344 3300049517 Ga0501294_000382 Ga0501294_000382_3987_4775 260
345 3300049525 Ga0501302_001651 Ga0501302_001651_126_914 260
346 3300049568 Ga0501031_0100514 Ga0501031_0100514_786_1568 260
347 3300049569 Ga0501032_0010074 Ga0501032_0010074_2736_3518 260
348 3300049570 Ga0501033_0001353 Ga0501033_0001353_7658_8440 260
349 3300049570 Ga0501033_0003694 Ga0501033_0003694_5959_6741 260
350 3300049570 Ga0501033_0172491 Ga0501033_0172491_342_1124 260
351 3300049571 Ga0501034_0002426 Ga0501034_0002426_5693_6475 260
352 3300049571 Ga0501034_0005350 Ga0501034_0005350_6482_7264 260
353 3300049571 Ga0501034_0031029 Ga0501034_0031029_3807_4592 260
354 3300049572 Ga0501036_0006504 Ga0501036_0006504_4897_5679 260
355 3300049573 Ga0501037_0008952 Ga0501037_0008952_927_1709 260
356 3300049573 Ga0501037_0222651 Ga0501037_0222651_320_1105 260
357 3300049574 Ga0501038_0010873 Ga0501038_0010873_7018_7800 260
358 3300049575 Ga0501039_0020608 Ga0501039_0020608_1656_2438 260
359 3300049575 Ga0501039_0058072 Ga0501039_0058072_1706_2509 260
360 3300049581 Ga0501047_0183002 Ga0501047_0183002_416_1201 260
361 3300049582 Ga0501048_0461374 Ga0501048_0461374_113_895 260
362 3300049652 Ga0501202_003721 Ga0501202_003721_390_1178 260
363 3300049653 Ga0501206_000800 Ga0501206_000800_1064_1852 260
364 3300049662 Ga0501222_001077 Ga0501222_001077_1439_2227 260
365 3300049663 Ga0501223_005080 Ga0501223_005080_1893_2681 260
366 3300049665 Ga0501227_003797 Ga0501227_003797_385_1173 260
367 3300049690 Ga0501261_000041 Ga0501261_000041_23266_24054 260
368 3300049704 Ga0501221_025690 Ga0501221_025690_63_851 260
369 3300049705 Ga0501225_0010780 Ga0501225_0010780_348_1136 260
370 3300049708 Ga0501245_012906 Ga0501245_012906_304_1092 260
371 3300049775 Ga0501279_000006 Ga0501279_000006_23087_23875 260
372 3300049776 Ga0501280_000017 Ga0501280_000017_30239_31027 260
373 3300049777 Ga0501281_00003 Ga0501281_00003_33957_34745 260
374 3300049778 Ga0501282_002037 Ga0501282_002037_111_899 260
375 3300049779 Ga0501283_001213 Ga0501283_001213_1939_2727 260
376 3300049822 Ga0501035_0000815 Ga0501035_0000815_21739_22521 260
377 3300049823 Ga0501044_0003728 Ga0501044_0003728_15409_16191 260
378 3300049823 Ga0501044_0010440 Ga0501044_0010440_5680_6462 260
379 3300050507 nmdc:mga05p37_381154_c1 nmdc:mga05p37_381154_c1_351_1133 260
380 3300050508 nmdc:mga09592_187731_c1 nmdc:mga09592_187731_c1_809_1591 260
381 3300050511 nmdc:mga08y16_89194_c1 nmdc:mga08y16_89194_c1_1083_1865 260
382 3300053119 Ga0500595_029382 Ga0500595_029382_903_1694 260
383 3300053138 Ga0500564_044426 Ga0500564_044426_769_1557 260
384 3300053139 Ga0500568_0002823 Ga0500568_0002823_3292_4074 260
385 iso_pu_bacteria 2738543024 2739306785 260
386 2162886007 SwRhRL2b_contig_2149026 SwRhRL2b_0162.00000630 261
387 2162886007 SwRhRL2b_contig_2334788 SwRhRL2b_0502.00011180 261
388 3300001976 JGI24752J21851_1005971 JGI24752J21851_10059712 261
389 3300002074 JGI24748J21848_1002846 JGI24748J21848_10028463 261
390 3300002239 JGI24034J26672_10000934 JGI24034J26672_100009343 261
391 3300002239 JGI24034J26672_10002693 JGI24034J26672_100026931 261
392 3300002459 JGI24751J29686_10021053 JGI24751J29686_100210532 261
393 3300005289 Ga0065704_10000342 Ga0065704_100003427 261
394 3300005289 Ga0065704_10002516 Ga0065704_100025163 261
395 3300005289 Ga0065704_10070166 Ga0065704_10070166101 261
396 3300005289 Ga0065704_10072848 Ga0065704_100728486 261
397 3300005295 Ga0065707_10081815 Ga0065707_1008181519 261
398 3300005331 Ga0070670_100005694 Ga0070670_1000056947 261
399 3300005331 Ga0070670_100028959 Ga0070670_1000289591 261
400 3300005331 Ga0070670_100086870 Ga0070670_1000868702 261
401 3300005347 Ga0070668_100001679 Ga0070668_10000167910 261
402 3300005347 Ga0070668_100033923 Ga0070668_1000339234 261
403 3300005347 Ga0070668_100164416 Ga0070668_1001644162 261
404 3300005353 Ga0070669_100000077 Ga0070669_10000007717 261
405 3300005353 Ga0070669_100000199 Ga0070669_10000019932 261
406 3300005353 Ga0070669_100002158 Ga0070669_1000021589 261
407 3300005353 Ga0070669_100013893 Ga0070669_1000138933 261
408 3300005355 Ga0070671_100000863 Ga0070671_10000086310 261
409 3300005355 Ga0070671_100001302 Ga0070671_10000130210 261
410 3300005355 Ga0070671_100023407 Ga0070671_1000234072 261
411 3300005365 Ga0070688_100277321 Ga0070688_1002773212 261
412 3300005367 Ga0070667_100001698 Ga0070667_1000016986 261
413 3300005367 Ga0070667_100015584 Ga0070667_1000155846 261
414 3300005466 Ga0070685_10008897 Ga0070685_100088975 261
415 3300005548 Ga0070665_100000163 Ga0070665_10000016357 261
416 3300005548 Ga0070665_100013238 Ga0070665_1000132385 261
417 3300005548 Ga0070665_100026151 Ga0070665_1000261512 261
418 3300005548 Ga0070665_100107348 Ga0070665_1001073482 261
419 3300005617 Ga0068859_100022203 Ga0068859_1000222034 261
420 3300005617 Ga0068859_100145896 Ga0068859_1001458962 261
421 3300005617 Ga0068859_100164400 Ga0068859_1001644002 261
422 3300005618 Ga0068864_100365999 Ga0068864_1003659991 261
423 3300005841 Ga0068863_100197837 Ga0068863_1001978372 261
424 3300005842 Ga0068858_100070810 Ga0068858_1000708102 261
425 3300005842 Ga0068858_100118826 Ga0068858_1001188264 261
426 3300005843 Ga0068860_100000474 Ga0068860_10000047413 261
427 3300005843 Ga0068860_100001423 Ga0068860_10000142315 261
428 3300005843 Ga0068860_100021734 Ga0068860_1000217342 261
429 3300005843 Ga0068860_100086783 Ga0068860_1000867834 261
430 3300005843 Ga0068860_100232945 Ga0068860_1002329451 261
431 3300005844 Ga0068862_100000105 Ga0068862_100000105102 261
432 3300005844 Ga0068862_100061327 Ga0068862_1000613274 261
433 3300005844 Ga0068862_100080104 Ga0068862_1000801042 261
434 3300006931 Ga0097620_100022203 Ga0097620_1000222034 261
435 3300006931 Ga0097620_100145893 Ga0097620_1001458932 261
436 3300006931 Ga0097620_100164402 Ga0097620_1001644022 261
437 3300009011 Ga0105251_10001177 Ga0105251_1000117716 261
438 3300009011 Ga0105251_10025901 Ga0105251_100259013 261
439 3300009092 Ga0105250_10004727 Ga0105250_100047273 261
440 3300009101 Ga0105247_10051785 Ga0105247_100517853 261
441 3300009147 Ga0114129_10075734 Ga0114129_100757344 261
442 3300009177 Ga0105248_10007376 Ga0105248_100073769 261
443 3300009177 Ga0105248_10051605 Ga0105248_100516055 261
444 3300009177 Ga0105248_10079599 Ga0105248_100795994 261
445 3300009177 Ga0105248_10132984 Ga0105248_101329844 261
446 3300009553 Ga0105249_10000004 Ga0105249_10000004162 261
447 3300009553 Ga0105249_10030205 Ga0105249_100302052 261
448 3300009553 Ga0105249_10095271 Ga0105249_100952712 261
449 3300013306 Ga0163162_10043682 Ga0163162_100436822 261
450 3300014325 Ga0163163_10131859 Ga0163163_101318592 261
451 3300014325 Ga0163163_10320707 Ga0163163_103207073 261
452 3300014326 Ga0157380_10001518 Ga0157380_1000151816 261
453 3300014326 Ga0157380_10180702 Ga0157380_101807022 261
454 3300014968 Ga0157379_10224363 Ga0157379_102243632 261
455 3300017792 Ga0163161_10001576 Ga0163161_1000157616 261
456 3300017792 Ga0163161_10016614 Ga0163161_100166142 261
457 3300017792 Ga0163161_10330035 Ga0163161_103300352 261
458 3300025298 Ga0209050_1000232 Ga0209050_1000232102 261
459 3300025315 Ga0207697_10087619 Ga0207697_100876192 261
460 3300025711 Ga0207696_1001933 Ga0207696_10019337 261
461 3300025735 Ga0207713_1000436 Ga0207713_100043624 261
462 3300025735 Ga0207713_1010386 Ga0207713_10103864 261
463 3300025735 Ga0207713_1037853 Ga0207713_10378532 261
464 3300025903 Ga0207680_10098349 Ga0207680_100983492 261
465 3300025903 Ga0207680_10299123 Ga0207680_102991232 261
466 3300025922 Ga0207646_10151843 Ga0207646_101518432 261
467 3300025923 Ga0207681_10000081 Ga0207681_1000008149 261
468 3300025923 Ga0207681_10000255 Ga0207681_1000025530 261
469 3300025923 Ga0207681_10001754 Ga0207681_100017544 261
470 3300025923 Ga0207681_10007751 Ga0207681_100077514 261
471 3300025923 Ga0207681_10174143 Ga0207681_101741432 261
472 3300025925 Ga0207650_10030450 Ga0207650_100304502 261
473 3300025931 Ga0207644_10000004 Ga0207644_10000004594 261
474 3300025931 Ga0207644_10001897 Ga0207644_100018976 261
475 3300025931 Ga0207644_10005491 Ga0207644_100054916 261
476 3300025931 Ga0207644_10254375 Ga0207644_102543752 261
477 3300025936 Ga0207670_10214601 Ga0207670_102146013 261
478 3300025941 Ga0207711_10001851 Ga0207711_1000185116 261
479 3300025941 Ga0207711_10031863 Ga0207711_100318632 261
480 3300025941 Ga0207711_10096446 Ga0207711_100964462 261
481 3300025941 Ga0207711_10246433 Ga0207711_102464332 261
482 3300025961 Ga0207712_10000008 Ga0207712_10000008293 261
483 3300025961 Ga0207712_10067845 Ga0207712_100678452 261
484 3300025961 Ga0207712_10148305 Ga0207712_101483052 261
485 3300025961 Ga0207712_10256033 Ga0207712_102560332 261
486 3300025972 Ga0207668_10003751 Ga0207668_100037518 261
487 3300025972 Ga0207668_10004561 Ga0207668_100045614 261
488 3300025972 Ga0207668_10310800 Ga0207668_103108002 261
489 3300025986 Ga0207658_10001301 Ga0207658_100013016 261
490 3300025986 Ga0207658_10003517 Ga0207658_100035178 261
491 3300025986 Ga0207658_10015482 Ga0207658_100154826 261
492 3300025986 Ga0207658_10066958 Ga0207658_100669583 261
493 3300026035 Ga0207703_10010844 Ga0207703_100108446 261
494 3300026035 Ga0207703_10012379 Ga0207703_100123792 261
495 3300026088 Ga0207641_10005772 Ga0207641_100057727 261
496 3300028379 Ga0268266_10000205 Ga0268266_1000020545 261
497 3300028379 Ga0268266_10008275 Ga0268266_100082757 261
498 3300028379 Ga0268266_10122578 Ga0268266_101225782 261
499 3300028379 Ga0268266_10125830 Ga0268266_101258302 261
500 3300028379 Ga0268266_10257209 Ga0268266_102572091 261
501 3300028380 Ga0268265_10000216 Ga0268265_1000021660 261
502 3300028380 Ga0268265_10014446 Ga0268265_100144465 261
503 3300028380 Ga0268265_10022817 Ga0268265_100228174 261
504 3300028381 Ga0268264_10001169 Ga0268264_100011698 261
505 3300028381 Ga0268264_10004485 Ga0268264_1000448513 261
506 3300028381 Ga0268264_10022075 Ga0268264_100220756 261
507 3300028381 Ga0268264_10035438 Ga0268264_100354385 261
508 3300028381 Ga0268264_10043053 Ga0268264_100430532 261
509 3300046460 Ga0495638_0003369 Ga0495638_0003369_5243_6127 261
510 3300047472 Ga0495686_0081504 Ga0495686_0081504_592_1383 261
511 3300048903 Ga0496100_0063446 Ga0496100_0063446_53_838 261
512 3300048903 Ga0496100_0091619 Ga0496100_0091619_1265_2050 261
513 3300048904 Ga0496101_0006175 Ga0496101_0006175_3877_4662 261
514 3300048905 Ga0496102_0000149 Ga0496102_0000149_88631_89416 261
515 3300048905 Ga0496102_0000178 Ga0496102_0000178_52205_52996 261
516 3300048905 Ga0496102_0017774 Ga0496102_0017774_750_1541 261
517 3300048905 Ga0496102_0238128 Ga0496102_0238128_698_1483 261
518 3300048906 Ga0496103_0000049 Ga0496103_0000049_149389_150174 261
519 3300048906 Ga0496103_0000119 Ga0496103_0000119_53594_54385 261
520 3300048906 Ga0496103_0009374 Ga0496103_0009374_1804_2598 261
521 3300048906 Ga0496103_0020412 Ga0496103_0020412_1975_2766 261
522 3300048906 Ga0496103_0121596 Ga0496103_0121596_837_1622 261
523 3300048907 Ga0496104_0000165 Ga0496104_0000165_15396_16181 261
524 3300048907 Ga0496104_0005808 Ga0496104_0005808_7237_8028 261
525 3300048908 Ga0496105_0000193 Ga0496105_0000193_33370_34161 261
526 3300048908 Ga0496105_0000384 Ga0496105_0000384_7399_8184 261
527 3300048908 Ga0496105_0196696 Ga0496105_0196696_408_1199 261
528 3300048909 Ga0496106_0005649 Ga0496106_0005649_6865_7650 261
529 3300048909 Ga0496106_0291584 Ga0496106_0291584_335_1120 261
530 3300048910 Ga0496107_0005680 Ga0496107_0005680_2553_3338 261
531 3300048910 Ga0496107_0025742 Ga0496107_0025742_702_1487 261
532 3300048911 Ga0496108_0007112 Ga0496108_0007112_6020_6811 261
533 3300048911 Ga0496108_0023884 Ga0496108_0023884_1119_1910 261
534 3300048912 Ga0496109_0128962 Ga0496109_0128962_1426_2217 261
535 3300048912 Ga0496109_0508989 Ga0496109_0508989_149_940 261
536 3300048912 Ga0496109_0584802 Ga0496109_0584802_41_832 261
537 3300048913 Ga0496110_0003920 Ga0496110_0003920_8667_9458 261
538 3300048913 Ga0496110_0006512 Ga0496110_0006512_5223_6014 261
539 3300048913 Ga0496110_0117251 Ga0496110_0117251_855_1646 261
540 3300048914 Ga0496111_0088124 Ga0496111_0088124_1224_2015 261
541 3300048915 Ga0496112_0018100 Ga0496112_0018100_4501_5286 261
542 3300048915 Ga0496112_0092432 Ga0496112_0092432_592_1383 261
543 3300048915 Ga0496112_0203638 Ga0496112_0203638_55_840 261
544 3300048915 Ga0496112_0524401 Ga0496112_0524401_88_879 261
545 3300048916 Ga0496113_0008095 Ga0496113_0008095_2487_3272 261
546 3300048916 Ga0496113_0030410 Ga0496113_0030410_58_849 261
547 3300048916 Ga0496113_0038501 Ga0496113_0038501_756_1547 261
548 3300048917 Ga0496114_0002414 Ga0496114_0002414_466_1257 261
549 3300048918 Ga0496115_0000253 Ga0496115_0000253_38984_39775 261
550 3300048918 Ga0496115_0164396 Ga0496115_0164396_699_1484 261
551 3300048918 Ga0496115_0354721 Ga0496115_0354721_222_1007 261
552 3300048920 Ga0496117_0000123 Ga0496117_0000123_145844_146629 261
553 3300048920 Ga0496117_0000318 Ga0496117_0000318_51631_52422 261
554 3300048920 Ga0496117_0007958 Ga0496117_0007958_5972_6763 261
555 3300048920 Ga0496117_0011681 Ga0496117_0011681_3550_4344 261
556 3300048921 Ga0496118_0000186 Ga0496118_0000186_52260_53051 261
557 3300048921 Ga0496118_0044037 Ga0496118_0044037_519_1310 261
558 3300048921 Ga0496118_0149063 Ga0496118_0149063_174_968 261
559 3300048922 Ga0496119_0000121 Ga0496119_0000121_99880_100665 261
560 3300048922 Ga0496119_0005200 Ga0496119_0005200_4004_4795 261
561 3300048923 Ga0496120_0002006 Ga0496120_0002006_15288_16073 261
562 3300048923 Ga0496120_0017810 Ga0496120_0017810_655_1446 261
563 3300048924 Ga0496121_0001102 Ga0496121_0001102_10066_10857 261
564 3300048924 Ga0496121_0001167 Ga0496121_0001167_15429_16220 261
565 3300048924 Ga0496121_0005678 Ga0496121_0005678_11448_12233 261
566 3300048924 Ga0496121_0016348 Ga0496121_0016348_4217_5011 261
567 3300048924 Ga0496121_0130569 Ga0496121_0130569_170_961 261
568 3300048925 Ga0496122_0009975 Ga0496122_0009975_6772_7563 261
569 3300048925 Ga0496122_0016402 Ga0496122_0016402_4470_5255 261
570 3300048925 Ga0496122_0019308 Ga0496122_0019308_339_1130 261
571 3300048925 Ga0496122_0118831 Ga0496122_0118831_497_1288 261
572 3300048926 Ga0496123_0055708 Ga0496123_0055708_1590_2381 261
573 3300048927 Ga0496124_0000324 Ga0496124_0000324_31921_32712 261
574 3300048927 Ga0496124_0005269 Ga0496124_0005269_3119_3904 261
575 3300048927 Ga0496124_0005490 Ga0496124_0005490_10842_11633 261
576 3300048927 Ga0496124_0015055 Ga0496124_0015055_846_1637 261
577 3300048927 Ga0496124_0037494 Ga0496124_0037494_2349_3143 261
578 3300048927 Ga0496124_0157577 Ga0496124_0157577_79_873 261
579 3300048928 Ga0496125_0001272 Ga0496125_0001272_33486_34277 261
580 3300048928 Ga0496125_0011326 Ga0496125_0011326_3545_4336 261
581 3300048928 Ga0496125_0043555 Ga0496125_0043555_41_826 261
582 3300048928 Ga0496125_0080593 Ga0496125_0080593_1078_1869 261
583 3300048929 Ga0496126_0000045 Ga0496126_0000045_180860_181645 261
584 3300048929 Ga0496126_0001180 Ga0496126_0001180_31922_32713 261
585 3300048929 Ga0496126_0003207 Ga0496126_0003207_3287_4078 261
586 3300048929 Ga0496126_0013335 Ga0496126_0013335_5812_6597 261
587 3300048929 Ga0496126_0173928 Ga0496126_0173928_527_1318 261
588 3300048929 Ga0496126_0297256 Ga0496126_0297256_130_924 261
589 3300049571 Ga0501034_0002846 Ga0501034_0002846_3298_4086 261
590 3300049704 Ga0501221_025040 Ga0501221_025040_115_906 261
591 3300049705 Ga0501225_0001290 Ga0501225_0001290_3070_3861 261
592 3300049705 Ga0501225_0059975 Ga0501225_0059975_73_864 261
593 3300053125 Ga0500618_003298 Ga0500618_003298_870_1655 261
594 iso_pu_bacteria 8002285264 8002286006 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

291

0.96

PF00106

adh_short

short chain dehydrogenase

50

248

0.94

PF08659

KR

KR domain

50

246

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9706 15 256
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9694 15 256
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9673 14 256
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9667 15 256
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.966 6 261
ID Description Score Start End Superfamily
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9694 13 256 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 6 256 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9673 15 256 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9667 15 256 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 18 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5E7HHB1-F1-model_v4 deleted 0.9868 4 261
AF-A0A5C7Q9A7-F1-model_v4 SDR family oxidoreductase 0.9826 1 230 GO:0016616
GO:0030497
AF-A0A4R4WYM3-F1-model_v4 SDR family oxidoreductase 0.9798 6 261 GO:0016616
GO:0030497
AF-A0A4Q3D3P7-F1-model_v4 SDR family oxidoreductase 0.9776 54 261 GO:0016616
GO:0030497
AF-A0A7K0M5I6-F1-model_v4 SDR family oxidoreductase 0.9766 28 261 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
91.29 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map