metagRoot

F467298

General Info

Members	Datasets	Scaffolds	Average Seq Length
594	306	560	233

Family's Representative Sequence

Representative Sequence	3300005331\|Ga0070670_100073283\|Ga0070670_1000732832
Length	259
Sequence	MLLSEGLLEPPWKPPVKRNGVNGMNLYVDPAQRARHLLVVDDDDRIRELLKAYLARAGFRVSAANGGPAARKLLEALDFDLAVFDVMMPGEDGLSLTRWLRDQRGAGGRTPVLMLTARGEAGDRIEGLKVGADDYLAKPFEPEELLLRIEAILRRAQDRPQAGAALSLGRCRFDPGRGELECDGQPVRLTEAEVALLRQLARTPHEPVDRLELARGSVDPSGRAVDVQVTRLRRKIEDDPKAPRYLQTVRGVGYRLAPD

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
3	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
4	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
5	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
6	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
7	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
8	2643221574	Brevundimonas sp. Root608	Isolate	Unclassified
9	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
10	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
11	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
12	2643221614	Phenylobacterium sp. Root77	Isolate	Unclassified
13	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
14	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
15	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
16	2643221663	Brevundimonas sp. Root1279	Isolate	Unclassified
17	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
18	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
19	2643221699	Brevundimonas sp. Root1423	Isolate	Unclassified
20	2739367756	Asticcacaulis sp. CF398	Isolate	Unclassified
21	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
22	2818991435	Caulobacter henricii 536	Isolate	Unclassified
23	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
24	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
25	2849560528	Caulobacter zeae 410	Isolate	Unclassified
26	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
27	2851153111	Caulobacter radicis 736	Isolate	Unclassified
28	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
29	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
30	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
31	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
32	2928972540	Brevundimonas sp. 1080	Isolate	Rhizosphere
33	2941485952	Brevundimonas faecalis 2814	Isolate	Rhizosphere
34	2977240413	Brevundimonas vesicularis SORGH_AS 431	Isolate	Unclassified
35	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
36	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
37	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
38	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
39	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
40	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
41	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
42	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
43	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
44	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
45	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
46	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
47	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
48	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
49	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
50	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
51	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
52	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
53	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
54	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
55	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
56	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
57	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
58	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
59	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
60	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
61	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
62	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
63	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
64	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
65	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
66	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
67	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
68	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
69	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
70	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
71	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
72	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
73	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
74	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
75	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
76	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
77	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
78	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
79	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
80	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
81	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
82	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
83	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
84	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
86	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
87	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
88	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
89	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
90	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
91	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
94	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
95	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
96	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
97	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
98	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
105	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
106	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
107	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
108	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
116	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
155	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
156	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
157	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
158	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
159	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
160	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
161	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
162	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
163	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
164	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
165	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
166	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
167	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
168	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
169	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
170	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
171	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
172	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
173	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
174	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
175	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
176	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
177	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
178	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
179	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
180	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
181	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
182	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
183	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
184	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
185	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
186	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
187	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
188	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
189	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
190	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
191	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
192	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
193	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
194	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
195	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
196	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
197	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
198	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
199	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
200	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
201	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
202	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
203	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
204	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
205	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
206	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
207	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
208	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
209	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
210	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
211	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
212	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
213	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
214	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
215	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
216	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
217	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
218	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
219	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
220	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
221	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
222	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
223	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
224	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
225	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
226	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
227	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
228	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
229	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
230	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
231	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
232	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
233	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
234	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
235	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
236	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
237	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
238	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
239	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
240	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
241	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
242	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
243	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
244	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
245	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
246	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
247	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
248	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
249	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
250	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
251	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
252	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
253	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
254	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
260	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
261	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
263	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
264	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
265	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
266	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
267	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
268	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
269	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
270	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
271	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
272	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
273	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
274	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
275	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
276	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
277	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
278	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
279	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
280	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
281	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
282	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
283	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
284	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
285	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
286	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
287	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
288	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
289	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
290	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
291	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
292	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
293	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
294	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
295	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
296	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
297	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
298	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
299	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
300	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
301	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
302	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
303	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
304	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
305	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
306	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	93.94
Metatranscriptomes	0.34
Isolates	5.72

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	19.36
Nodule	0
Rhizoplane	2.36
Rhizosphere	67.85
Stem	0
Stem Tuber	0
Unclassified	10.44

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10030285	3300003215	Bacteria	1843
2	rootH2_10019219	3300003320	Bacteria	1611
3	rootH2_10028357	3300003320	Bacteria	4812
4	rootL2_10005023	3300003322	Bacteria	10863
5	rootL2_10014315	3300003322	Bacteria	3558
6	rootL2_10022557	3300003322	Bacteria	1152
7	rootH1_10073470	3300003323	Bacteria	2529
8	Ga0006562J51391_1023027	3300003578	Bacteria	3950
9	Ga0055537_1003143	3300003773	Bacteria	5172
10	Ga0055524_1016468	3300003775	Bacteria	2651
11	Ga0055536_1005613	3300003781	Bacteria	6079
12	Ga0055536_1005776	3300003781	Bacteria	5962
13	Ga0055536_1005867	3300003781	Bacteria	5893
14	Ga0055528_1007473	3300003790	Bacteria	4828
15	Ga0055530_10001660	3300003791	Bacteria	15828
16	Ga0055530_10007010	3300003791	Bacteria	4855
17	Ga0055530_10008157	3300003791	Bacteria	4247
18	Ga0055531_10000948	3300003794	Bacteria	23325
19	Ga0055531_10001668	3300003794	Bacteria	15997
20	Ga0065165_1000930	3300005262	Bacteria	37471
21	Ga0065165_1004643	3300005262	Bacteria	8325
22	Ga0065165_1061791	3300005262	Bacteria	1024
23	Ga0070658_10175916	3300005327	Bacteria	1800
24	Ga0070658_10238955	3300005327	Bacteria	1539
25	Ga0070670_100000035	3300005331	Bacteria	157570
26	Ga0070670_100073283	3300005331	Bacteria	2941
27	Ga0068869_100018066	3300005334	Bacteria	4794
28	Ga0070666_10183318	3300005335	Bacteria	1469
29	Ga0070680_100003673	3300005336	Bacteria	11460
30	Ga0070680_100021398	3300005336	Bacteria	5140
31	Ga0070680_100499284	3300005336	Bacteria	1041
32	Ga0070660_100181474	3300005339	Bacteria	1703
33	Ga0070660_100384103	3300005339	Bacteria	1159
34	Ga0070661_100292185	3300005344	Bacteria	1267
35	Ga0070668_100002182	3300005347	Bacteria	14344
36	Ga0070668_100002428	3300005347	Bacteria	13704
37	Ga0070668_100003111	3300005347	Bacteria	12253
38	Ga0070668_100014023	3300005347	Bacteria	5993
39	Ga0070668_100015462	3300005347	Bacteria	5705
40	Ga0070668_100026264	3300005347	Bacteria	4417
41	Ga0070668_100177005	3300005347	Bacteria	1740
42	Ga0070669_100550506	3300005353	Bacteria	962
43	Ga0070671_100156016	3300005355	Bacteria	1928
44	Ga0070671_100389098	3300005355	Bacteria	1192
45	Ga0070659_100019781	3300005366	Bacteria	5110
46	Ga0070659_100170713	3300005366	Bacteria	1781
47	Ga0070667_100000711	3300005367	Bacteria	32094
48	Ga0070667_100078225	3300005367	Bacteria	2825
49	Ga0070667_100086913	3300005367	Bacteria	2683
50	Ga0070667_100120588	3300005367	Bacteria	2281
51	Ga0070662_100029305	3300005457	Bacteria	3841
52	Ga0070681_10047081	3300005458	Bacteria	4310
53	Ga0070681_10076959	3300005458	Bacteria	3294
54	Ga0070679_100008280	3300005530	Bacteria	9782
55	Ga0070679_100090368	3300005530	Bacteria	3050
56	Ga0070679_100255508	3300005530	Bacteria	1708
57	Ga0070679_100651637	3300005530	Bacteria	996
58	Ga0068853_100029429	3300005539	Bacteria	4630
59	Ga0068853_100209795	3300005539	Bacteria	1775
60	Ga0068853_100409088	3300005539	Bacteria	1271
61	Ga0068853_100535467	3300005539	Bacteria	1108
62	Ga0070672_100658083	3300005543	Bacteria	915
63	Ga0070665_100000433	3300005548	Bacteria	60988
64	Ga0070665_100001010	3300005548	Bacteria	35486
65	Ga0070665_100002102	3300005548	Bacteria	22306
66	Ga0070665_100053244	3300005548	Bacteria	4059
67	Ga0070665_100107211	3300005548	Bacteria	2796
68	Ga0070665_100176416	3300005548	Bacteria	2138
69	Ga0068855_100022709	3300005563	Bacteria	7517
70	Ga0068855_100149360	3300005563	Bacteria	2657
71	Ga0068855_100245024	3300005563	Bacteria	2001
72	Ga0070664_100149837	3300005564	Bacteria	2059
73	Ga0068856_100286908	3300005614	Bacteria	1663
74	Ga0068856_100313354	3300005614	Bacteria	1587
75	Ga0068852_100116531	3300005616	Bacteria	2438
76	Ga0068852_101066313	3300005616	Bacteria	828
77	Ga0068859_100002125	3300005617	Bacteria	20174
78	Ga0068859_100525756	3300005617	Bacteria	1278
79	Ga0068859_100601165	3300005617	Bacteria	1193
80	Ga0068859_100899550	3300005617	Bacteria	970
81	Ga0068864_100000102	3300005618	Bacteria	82743
82	Ga0068864_100000165	3300005618	Bacteria	60874
83	Ga0068864_100192469	3300005618	Bacteria	1870
84	Ga0068864_100230788	3300005618	Bacteria	1712
85	Ga0068861_100041336	3300005719	Bacteria	3453
86	Ga0068861_100378407	3300005719	Bacteria	1250
87	Ga0068863_100000128	3300005841	Bacteria	79841
88	Ga0068863_100002006	3300005841	Bacteria	20201
89	Ga0068863_100009403	3300005841	Bacteria	9543
90	Ga0068863_100158922	3300005841	Bacteria	2164
91	Ga0068863_100389893	3300005841	Bacteria	1361
92	Ga0068858_100000117	3300005842	Bacteria	83778
93	Ga0068858_100018471	3300005842	Bacteria	6528
94	Ga0068858_100086101	3300005842	Bacteria	2923
95	Ga0068860_100000100	3300005843	Bacteria	144580
96	Ga0068860_100000157	3300005843	Bacteria	110717
97	Ga0068860_100013081	3300005843	Bacteria	8144
98	Ga0068860_100360386	3300005843	Bacteria	1432
99	Ga0068862_100000368	3300005844	Bacteria	48907
100	Ga0068862_100003705	3300005844	Bacteria	13061
101	Ga0068862_100004740	3300005844	Bacteria	11445
102	Ga0068862_100053321	3300005844	Bacteria	3461
103	Ga0068862_100067209	3300005844	Bacteria	3090
104	Ga0070717_10143435	3300006028	Bacteria	2061
105	Ga0075368_10012058	3300006042	Bacteria	3156
106	Ga0075364_10000571	3300006051	Bacteria	18956
107	Ga0075362_10053906	3300006177	Bacteria	1806
108	Ga0075367_10002075	3300006178	Bacteria	8975
109	Ga0075369_10015535	3300006186	Bacteria	3057
110	Ga0075369_10074365	3300006186	Bacteria	1499
111	Ga0075370_10035355	3300006353	Bacteria	2804
112	Ga0075370_10121372	3300006353	Bacteria	1521
113	Ga0068865_100000107	3300006881	Bacteria	43014
114	Ga0097620_100002125	3300006931	Bacteria	20174
115	Ga0097620_100525789	3300006931	Bacteria	1278
116	Ga0097620_100601253	3300006931	Bacteria	1193
117	Ga0097620_100899471	3300006931	Bacteria	970
118	Ga0105250_10021869	3300009092	Bacteria	2581
119	Ga0105240_10050218	3300009093	Bacteria	5260
120	Ga0105240_10174092	3300009093	Bacteria	2546
121	Ga0105240_10239028	3300009093	Bacteria	2107
122	Ga0105240_10425389	3300009093	Bacteria	1491
123	Ga0105240_10507185	3300009093	Bacteria	1341
124	Ga0105241_10442706	3300009174	Bacteria	1148
125	Ga0105242_10369014	3300009176	Bacteria	1331
126	Ga0105248_10000106	3300009177	Bacteria	93898
127	Ga0105248_10026225	3300009177	Bacteria	6484
128	Ga0105248_10031769	3300009177	Bacteria	5899
129	Ga0105248_10041501	3300009177	Bacteria	5158
130	Ga0105248_10041689	3300009177	Bacteria	5147
131	Ga0105248_10281102	3300009177	Bacteria	1874
132	Ga0105237_10327343	3300009545	Bacteria	1536
133	Ga0105237_10788416	3300009545	Bacteria	957
134	Ga0105238_10008880	3300009551	Bacteria	10059
135	Ga0105238_10039354	3300009551	Bacteria	4794
136	Ga0105249_10000525	3300009553	Bacteria	35250
137	Ga0105249_10063507	3300009553	Bacteria	3393
138	Ga0105249_10153929	3300009553	Bacteria	2216
139	Ga0157373_10003275	3300013100	Bacteria	12233
140	Ga0157373_10009299	3300013100	Bacteria	7267
141	Ga0157371_10104425	3300013102	Bacteria	2011
142	Ga0157370_10025476	3300013104	Bacteria	5856
143	Ga0157369_10009787	3300013105	Bacteria	10965
144	Ga0157369_10445690	3300013105	Bacteria	1341
145	Ga0157369_10448921	3300013105	Bacteria	1335
146	Ga0163162_10013185	3300013306	Bacteria	8072
147	Ga0163162_10240155	3300013306	Bacteria	1943
148	Ga0157372_10079365	3300013307	Bacteria	3712
149	Ga0163163_10003142	3300014325	Bacteria	14001
150	Ga0163163_10022780	3300014325	Bacteria	5936
151	Ga0163163_10071178	3300014325	Bacteria	3465
152	Ga0163163_10084654	3300014325	Bacteria	3177
153	Ga0163163_10538872	3300014325	Bacteria	1230
154	Ga0163163_10624486	3300014325	Bacteria	1141
155	Ga0157380_10543327	3300014326	Bacteria	1138
156	Ga0157380_10697954	3300014326	Bacteria	1019
157	Ga0157379_10009657	3300014968	Bacteria	8397
158	Ga0157379_10128027	3300014968	Bacteria	2285
159	Ga0157379_10219977	3300014968	Bacteria	1721
160	Ga0157379_10363270	3300014968	Bacteria	1327
161	Ga0183365_10001	3300015684	Bacteria	2090444
162	Ga0163161_10550372	3300017792	Bacteria	946
163	Ga0206353_11002220	3300020082	Bacteria	1055
164	Ga0213872_10004736	3300021361	Bacteria	7134
165	Ga0213876_10031840	3300021384	Bacteria	2782
166	Ga0213876_10087868	3300021384	Bacteria	1646
167	Ga0209026_1002628	3300025250	Bacteria	6547
168	Ga0209026_1025249	3300025250	Bacteria	897
169	Ga0209565_1000422	3300025263	Bacteria	34325
170	Ga0209673_1001190	3300025273	Bacteria	27981
171	Ga0209675_1004954	3300025291	Bacteria	5742
172	Ga0209676_1000252	3300025292	Bacteria	113425
173	Ga0209676_1000467	3300025292	Bacteria	67659
174	Ga0209676_1000560	3300025292	Bacteria	56233
175	Ga0209564_1001269	3300025295	Bacteria	27780
176	Ga0209564_1029350	3300025295	Bacteria	1733
177	Ga0209758_1000334	3300025297	Bacteria	88149
178	Ga0209758_1002117	3300025297	Bacteria	20977
179	Ga0209758_1003299	3300025297	Bacteria	14941
180	Ga0209050_1000130	3300025298	Bacteria	186070
181	Ga0209050_1000461	3300025298	Bacteria	72912
182	Ga0209050_1001568	3300025298	Bacteria	23778
183	Ga0209256_1005129	3300025299	Bacteria	7753
184	Ga0209051_1002223	3300025303	Bacteria	14319
185	Ga0209257_1000036	3300025304	Bacteria	616006
186	Ga0209257_1000059	3300025304	Bacteria	378097
187	Ga0209257_1000060	3300025304	Bacteria	372267
188	Ga0209257_1000406	3300025304	Bacteria	83846
189	Ga0209257_1001256	3300025304	Bacteria	31336
190	Ga0209257_1010869	3300025304	Bacteria	4505
191	Ga0207696_1016173	3300025711	Bacteria	2503
192	Ga0207710_10040132	3300025900	Bacteria	2073
193	Ga0207710_10215203	3300025900	Bacteria	952
194	Ga0207643_10267433	3300025908	Bacteria	1057
195	Ga0207705_10000859	3300025909	Bacteria	24922
196	Ga0207705_10165676	3300025909	Bacteria	1662
197	Ga0207705_10285686	3300025909	Bacteria	1263
198	Ga0207705_10537669	3300025909	Bacteria	908
199	Ga0207654_10047582	3300025911	Bacteria	2451
200	Ga0207707_10076720	3300025912	Bacteria	2917
201	Ga0207695_10005699	3300025913	Bacteria	16425
202	Ga0207695_10017731	3300025913	Bacteria	8265
203	Ga0207695_10055587	3300025913	Bacteria	4123
204	Ga0207695_10085386	3300025913	Bacteria	3185
205	Ga0207695_10160577	3300025913	Bacteria	2179
206	Ga0207660_10005314	3300025917	Bacteria	8373
207	Ga0207657_10027665	3300025919	Bacteria	5189
208	Ga0207657_10069319	3300025919	Bacteria	2993
209	Ga0207649_10264689	3300025920	Bacteria	1244
210	Ga0207652_10167069	3300025921	Bacteria	1973
211	Ga0207694_10092208	3300025924	Bacteria	2391
212	Ga0207694_10094843	3300025924	Bacteria	2358
213	Ga0207650_10000350	3300025925	Bacteria	44409
214	Ga0207650_10093214	3300025925	Bacteria	2305
215	Ga0207644_10333155	3300025931	Bacteria	1229
216	Ga0207690_10000159	3300025932	Bacteria	52852
217	Ga0207690_10038229	3300025932	Bacteria	3122
218	Ga0207690_10066631	3300025932	Bacteria	2467
219	Ga0207704_10001045	3300025938	Bacteria	12287
220	Ga0207691_10701056	3300025940	Bacteria	854
221	Ga0207711_10000098	3300025941	Bacteria	92296
222	Ga0207711_10003343	3300025941	Bacteria	13904
223	Ga0207711_10010082	3300025941	Bacteria	7855
224	Ga0207711_10023616	3300025941	Bacteria	5148
225	Ga0207711_10153594	3300025941	Bacteria	2079
226	Ga0207689_10074013	3300025942	Bacteria	2799
227	Ga0207679_10002652	3300025945	Bacteria	11042
228	Ga0207667_10004660	3300025949	Bacteria	16802
229	Ga0207667_10019407	3300025949	Bacteria	7590
230	Ga0207667_10032201	3300025949	Bacteria	5652
231	Ga0207712_10001643	3300025961	Bacteria	15061
232	Ga0207712_10093167	3300025961	Bacteria	2222
233	Ga0207712_10396384	3300025961	Bacteria	1159
234	Ga0207668_10000025	3300025972	Bacteria	131733
235	Ga0207668_10000035	3300025972	Bacteria	119182
236	Ga0207668_10001848	3300025972	Bacteria	12357
237	Ga0207668_10002965	3300025972	Bacteria	9950
238	Ga0207668_10013045	3300025972	Bacteria	5105
239	Ga0207668_10017696	3300025972	Bacteria	4471
240	Ga0207668_10034922	3300025972	Bacteria	3343
241	Ga0207658_10000300	3300025986	Bacteria	51413
242	Ga0207658_10001621	3300025986	Bacteria	17264
243	Ga0207658_10028144	3300025986	Bacteria	3956
244	Ga0207703_10002585	3300026035	Bacteria	15635
245	Ga0207703_10004356	3300026035	Bacteria	11636
246	Ga0207703_10012853	3300026035	Bacteria	6529
247	Ga0207703_10779628	3300026035	Bacteria	912
248	Ga0207639_10021268	3300026041	Bacteria	4658
249	Ga0207639_10359296	3300026041	Bacteria	1303
250	Ga0207639_10387379	3300026041	Bacteria	1256
251	Ga0207639_10753562	3300026041	Bacteria	905
252	Ga0207702_10178848	3300026078	Bacteria	1952
253	Ga0207702_10233061	3300026078	Bacteria	1722
254	Ga0207702_10242073	3300026078	Bacteria	1690
255	Ga0207641_10000005	3300026088	Bacteria	470841
256	Ga0207641_10000777	3300026088	Bacteria	34097
257	Ga0207641_10000994	3300026088	Bacteria	29003
258	Ga0207641_10093921	3300026088	Bacteria	2630
259	Ga0207676_10000066	3300026095	Bacteria	105425
260	Ga0207676_10000145	3300026095	Bacteria	61785
261	Ga0207676_10131512	3300026095	Bacteria	2128
262	Ga0207676_10150870	3300026095	Bacteria	2001
263	Ga0207676_10377067	3300026095	Bacteria	1319
264	Ga0207675_100043776	3300026118	Bacteria	4181
265	Ga0207675_100236031	3300026118	Bacteria	1766
266	Ga0207675_100435900	3300026118	Bacteria	1296
267	Ga0207698_10276860	3300026142	Bacteria	1550
268	Ga0209999_1006049	3300027543	Bacteria	2174
269	Ga0209983_1027260	3300027665	Bacteria	1210
270	Ga0268266_10000003	3300028379	Bacteria	1701703
271	Ga0268266_10000814	3300028379	Bacteria	41101
272	Ga0268266_10002311	3300028379	Bacteria	20672
273	Ga0268266_10061572	3300028379	Bacteria	3237
274	Ga0268266_10290893	3300028379	Bacteria	1521
275	Ga0268265_10002522	3300028380	Bacteria	13705
276	Ga0268265_10006621	3300028380	Bacteria	7843
277	Ga0268265_10007485	3300028380	Bacteria	7373
278	Ga0268265_10010073	3300028380	Bacteria	6380
279	Ga0268265_10050149	3300028380	Bacteria	3143
280	Ga0268265_10050898	3300028380	Bacteria	3124
281	Ga0268264_10000002	3300028381	Bacteria	1153045
282	Ga0268264_10000211	3300028381	Bacteria	117108
283	Ga0268264_10013056	3300028381	Bacteria	6827
284	Ga0268264_10027891	3300028381	Bacteria	4616
285	Ga0268264_10275884	3300028381	Bacteria	1573
286	Ga0265326_10006638	3300028558	Bacteria	3579
287	Ga0265319_1050593	3300028563	Bacteria	1372
288	Ga0265334_10023127	3300028573	Bacteria	2529
289	Ga0307517_10003359	3300028786	Bacteria	24912
290	Ga0307517_10037096	3300028786	Bacteria	5456
291	Ga0307515_10081441	3300028794	Bacteria	4205
292	Ga0307515_10203945	3300028794	Bacteria	1844
293	Ga0307515_10414460	3300028794	Bacteria	969
294	Ga0265338_10009404	3300028800	Bacteria	11662
295	Ga0265338_10081296	3300028800	Bacteria	2718
296	Ga0265338_10114888	3300028800	Bacteria	2159
297	Ga0265338_10159721	3300028800	Bacteria	1742
298	Ga0265338_10174503	3300028800	Bacteria	1645
299	Ga0265327_10000454	3300031251	Bacteria	73503
300	Ga0265327_10002802	3300031251	Bacteria	17599
301	Ga0265327_10003349	3300031251	Bacteria	15456
302	Ga0265327_10053692	3300031251	Bacteria	2090
303	Ga0307513_10000053	3300031456	Bacteria	149356
304	Ga0307513_10000790	3300031456	Bacteria	45976
305	Ga0307513_10005351	3300031456	Bacteria	16974
306	Ga0307513_10011269	3300031456	Bacteria	11127
307	Ga0265314_10051810	3300031711	Bacteria	2857
308	Ga0307516_10000019	3300031730	Bacteria	196679
309	Ga0307413_10031058	3300031824	Bacteria	3009
310	Ga0307406_10008222	3300031901	Bacteria	5815
311	Ga0307412_10186005	3300031911	Bacteria	1567
312	Ga0307414_10658507	3300032004	Bacteria	944
313	Ga0307510_10059645	3300033180	Bacteria	3937
314	Ga0307510_10109845	3300033180	Bacteria	2505
315	Ga0373944_0016071	3300035089	Bacteria	2105
316	Ga0373936_0020958	3300035113	Bacteria	2541
317	Ga0373943_0035044	3300035170	Bacteria	2397
318	Ga0373931_0115357	3300035691	Bacteria	1529
319	Ga0373927_0001359	3300035695	Bacteria	18441
320	Ga0373947_0228136	3300035725	Bacteria	1226
321	Ga0373925_0000032	3300037068	Bacteria	145357
322	Ga0395899_0000016	3300037312	Bacteria	468322
323	Ga0395899_0000680	3300037312	Bacteria	34408
324	Ga0395899_0102680	3300037312	Bacteria	2063
325	Ga0395899_0166208	3300037312	Bacteria	1556
326	Ga0395900_0000111	3300037418	Bacteria	145390
327	Ga0395900_0009668	3300037418	Bacteria	9887
328	Ga0395898_0005748	3300037466	Bacteria	13347
329	Ga0395898_0012341	3300037466	Bacteria	8837
330	Ga0395898_0217027	3300037466	Bacteria	1824
331	Ga0395898_0230834	3300037466	Bacteria	1765
332	Ga0395905_0000123	3300037471	Bacteria	127888
333	Ga0395905_0038988	3300037471	Bacteria	4457
334	Ga0395905_0062149	3300037471	Bacteria	3493
335	Ga0395901_0000032	3300038443	Bacteria	235172
336	Ga0395901_0163116	3300038443	Bacteria	2340
337	Ga0395901_1087890	3300038443	Bacteria	770
338	Ga0436365_0058512	3300039437	Bacteria	2749
339	Ga0436365_1241636	3300039437	Bacteria	1248
340	Ga0436365_1365943	3300039437	Bacteria	4989
341	Ga0436360_0734566	3300039438	Bacteria	1062
342	Ga0436361_0200270	3300039447	Bacteria	32952
343	Ga0436361_0214579	3300039447	Bacteria	4478
344	Ga0436361_0251567	3300039447	Bacteria	853
345	Ga0436361_0557066	3300039447	Bacteria	1334
346	Ga0439435_0001945	3300042436	Bacteria	3972
347	Ga0439459_0051355	3300042438	Bacteria	906
348	Ga0450916_002091	3300042530	Bacteria	2075
349	Ga0466969_0000087	3300044656	Bacteria	47665
350	Ga0466966_0000698	3300044684	Bacteria	21359
351	Ga0466966_0114586	3300044684	Bacteria	1660
352	Ga0466961_0001686	3300044693	Bacteria	13748
353	Ga0466961_0075056	3300044693	Bacteria	2144
354	Ga0466961_0398995	3300044693	Bacteria	835
355	Ga0466964_0097557	3300044706	Bacteria	1290
356	Ga0466971_0001894	3300044719	Bacteria	8891
357	Ga0466970_0013518	3300044765	Bacteria	4186
358	Ga0466957_0008043	3300044842	Bacteria	5981
359	Ga0466957_0053120	3300044842	Bacteria	2470
360	Ga0466959_0000052	3300045049	Bacteria	81493
361	Ga0466959_0036986	3300045049	Bacteria	3606
362	Ga0466958_0002496	3300045836	Bacteria	9273
363	Ga0495627_002718	3300046453	Bacteria	8266
364	Ga0495590_0000795	3300046457	Bacteria	14381
365	Ga0495629_0039331	3300046459	Bacteria	3329
366	Ga0495638_0000478	3300046460	Bacteria	47960
367	Ga0495638_0001119	3300046460	Bacteria	26080
368	Ga0495638_0003434	3300046460	Bacteria	12476
369	Ga0495638_0058885	3300046460	Bacteria	2379
370	Ga0495638_0068195	3300046460	Bacteria	2182
371	Ga0495638_0096240	3300046460	Bacteria	1777
372	Ga0495638_0127105	3300046460	Bacteria	1501
373	Ga0495650_0000024	3300046471	Bacteria	496674
374	Ga0495650_0079659	3300046471	Bacteria	1266
375	Ga0495585_0100319	3300046492	Bacteria	1549
376	Ga0495607_0076708	3300046501	Bacteria	1848
377	Ga0495583_0000005	3300046506	Bacteria	636894
378	Ga0495583_0014367	3300046506	Bacteria	4373
379	Ga0495606_0008388	3300046507	Bacteria	8990
380	Ga0495606_0084999	3300046507	Bacteria	1958
381	Ga0495606_0106574	3300046507	Bacteria	1697
382	Ga0495610_0000078	3300046512	Bacteria	116266
383	Ga0495610_0002350	3300046512	Bacteria	15984
384	Ga0495610_0007123	3300046512	Bacteria	7537
385	Ga0495616_0000384	3300046513	Bacteria	34424
386	Ga0495620_0039578	3300046515	Bacteria	2082
387	Ga0495620_0057000	3300046515	Bacteria	1641
388	Ga0495631_0007728	3300046518	Bacteria	5456
389	Ga0495631_0136314	3300046518	Bacteria	1054
390	Ga0495632_0001324	3300046519	Bacteria	20859
391	Ga0495637_0006471	3300046520	Bacteria	5876
392	Ga0495637_0022138	3300046520	Bacteria	2903
393	Ga0495637_0035293	3300046520	Bacteria	2185
394	Ga0495643_0084869	3300046522	Bacteria	1643
395	Ga0495643_0088257	3300046522	Bacteria	1603
396	Ga0495648_0000887	3300046524	Bacteria	31432
397	Ga0495642_0075077	3300046528	Bacteria	1418
398	Ga0495654_0000026	3300046530	Bacteria	234940
399	Ga0495654_0112878	3300046530	Bacteria	1238
400	Ga0495621_0019472	3300046539	Bacteria	2217
401	Ga0495597_0005464	3300046542	Bacteria	6722
402	Ga0495597_0100626	3300046542	Bacteria	1219
403	Ga0495622_0023435	3300046557	Bacteria	2878
404	Ga0495633_0001662	3300046558	Bacteria	16775
405	Ga0495668_0000100	3300046616	Bacteria	137684
406	Ga0495668_0049601	3300046616	Bacteria	2328
407	Ga0495668_0085121	3300046616	Bacteria	1734
408	Ga0495668_0108959	3300046616	Bacteria	1515
409	Ga0495668_0131530	3300046616	Bacteria	1369
410	Ga0495668_0132065	3300046616	Bacteria	1366
411	Ga0495668_0144499	3300046616	Bacteria	1302
412	Ga0495625_0002592	3300046660	Bacteria	19355
413	Ga0495625_0050107	3300046660	Bacteria	2998
414	Ga0495625_0084280	3300046660	Bacteria	2207
415	Ga0495625_0089218	3300046660	Bacteria	2134
416	Ga0495625_0144658	3300046660	Bacteria	1601
417	Ga0495625_0158858	3300046660	Bacteria	1515
418	Ga0495625_0221274	3300046660	Bacteria	1240
419	Ga0495669_0000012	3300046684	Bacteria	157373
420	Ga0495669_0000250	3300046684	Bacteria	31432
421	Ga0495669_0048198	3300046684	Bacteria	1905
422	Ga0495669_0056559	3300046684	Bacteria	1768
423	Ga0495649_0001828	3300046694	Bacteria	15616
424	Ga0495660_0001804	3300046810	Bacteria	14101
425	Ga0495674_0061313	3300047319	Bacteria	3279
426	Ga0495672_0002493	3300047320	Bacteria	16840
427	Ga0495672_0068153	3300047320	Bacteria	2024
428	Ga0495683_0124456	3300047323	Bacteria	1221
429	Ga0495687_063975	3300047443	Bacteria	1504
430	Ga0495679_016734	3300047446	Bacteria	2645
431	Ga0495685_134099	3300047447	Bacteria	809
432	Ga0495673_0000346	3300047469	Bacteria	58325
433	Ga0495673_0002003	3300047469	Bacteria	14993
434	Ga0495673_0023954	3300047469	Bacteria	2959
435	Ga0495686_0008224	3300047472	Bacteria	7690
436	Ga0495686_0011007	3300047472	Bacteria	6398
437	Ga0495686_0031338	3300047472	Bacteria	3448
438	Ga0495686_0078472	3300047472	Bacteria	2020
439	Ga0495686_0148187	3300047472	Bacteria	1379
440	Ga0495686_0233793	3300047472	Bacteria	1039
441	Ga0495686_0290233	3300047472	Bacteria	906
442	Ga0495593_0160434	3300047673	Bacteria	1135
443	Ga0495602_0232155	3300048088	Bacteria	1385
444	Ga0496101_0080700	3300048904	Bacteria	2404
445	Ga0496102_0031506	3300048905	Bacteria	4757
446	Ga0496102_0112055	3300048905	Bacteria	2544
447	Ga0496103_0026960	3300048906	Bacteria	3479
448	Ga0496104_0133002	3300048907	Bacteria	2390
449	Ga0496106_0167641	3300048909	Bacteria	1739
450	Ga0496107_0007239	3300048910	Bacteria	7645
451	Ga0496107_0386213	3300048910	Bacteria	1041
452	Ga0496108_0041924	3300048911	Bacteria	3821
453	Ga0496110_0256485	3300048913	Bacteria	1592
454	Ga0496115_0004287	3300048918	Bacteria	10327
455	Ga0496115_0035341	3300048918	Bacteria	3953
456	Ga0496115_0142983	3300048918	Bacteria	1973
457	Ga0496115_0253426	3300048918	Bacteria	1448
458	Ga0496116_0065515	3300048919	Bacteria	2330
459	Ga0496117_0173573	3300048920	Bacteria	1248
460	Ga0496118_0066912	3300048921	Bacteria	2620
461	Ga0496119_0004972	3300048922	Bacteria	12987
462	Ga0496121_0000059	3300048924	Bacteria	278177
463	Ga0496121_0004872	3300048924	Bacteria	17628
464	Ga0496122_0002860	3300048925	Bacteria	23639
465	Ga0496123_0001072	3300048926	Bacteria	41355
466	Ga0496123_0189799	3300048926	Bacteria	1064
467	Ga0496124_0013512	3300048927	Bacteria	7966
468	Ga0496124_0090823	3300048927	Bacteria	2490
469	Ga0496125_0001101	3300048928	Bacteria	41572
470	Ga0496126_0004127	3300048929	Bacteria	17575
471	Ga0495678_001522	3300049459	Bacteria	17980
472	Ga0501032_0091574	3300049569	Bacteria	2017
473	Ga0501033_0003034	3300049570	Bacteria	13973
474	Ga0501033_0190353	3300049570	Bacteria	1468
475	Ga0501034_0007621	3300049571	Bacteria	11518
476	Ga0501034_0046132	3300049571	Bacteria	4403
477	Ga0501037_0048481	3300049573	Bacteria	3112
478	Ga0501047_0002933	3300049581	Bacteria	16195
479	Ga0501047_0055894	3300049581	Bacteria	3817
480	Ga0501048_0589242	3300049582	Bacteria	798
481	Ga0501257_001885	3300049686	Bacteria	4362
482	Ga0501035_0002868	3300049822	Bacteria	16644
483	Ga0501035_0075881	3300049822	Bacteria	2973
484	Ga0501035_0159992	3300049822	Bacteria	1950
485	Ga0501035_0345124	3300049822	Bacteria	1247
486	Ga0501044_0000588	3300049823	Bacteria	44117
487	Ga0501044_0002607	3300049823	Bacteria	20483
488	Ga0501044_0095539	3300049823	Bacteria	2995
489	Ga0501044_0335700	3300049823	Bacteria	1433
490	nmdc:mga00v17_165_c2	3300050491	Bacteria	34234
491	nmdc:mga0k408_36439_c1	3300050493	Bacteria	2824
492	nmdc:mga04h51_9415_c1	3300050495	Bacteria	2649
493	nmdc:mga07m45_27726_c1	3300050496	Bacteria	3123
494	nmdc:mga07m45_47384_c1	3300050496	Bacteria	2416
495	nmdc:mga0sz30_2184_c1	3300050516	Bacteria	6995
496	nmdc:mga0sz30_27614_c1	3300050516	Bacteria	2331
497	Ga0500635_0000048	3300053080	Bacteria	80957
498	Ga0500635_0001456	3300053080	Bacteria	5687
499	Ga0500578_0000913	3300053086	Bacteria	33199
500	Ga0500578_0056542	3300053086	Bacteria	2509
501	Ga0500643_000316	3300053087	Bacteria	39239
502	Ga0500643_006111	3300053087	Bacteria	5088
503	Ga0500643_021181	3300053087	Bacteria	2111
504	Ga0500644_0000598	3300053088	Bacteria	13780
505	Ga0500644_0023180	3300053088	Bacteria	1882
506	Ga0500647_0125783	3300053091	Bacteria	1211
507	Ga0500651_0071351	3300053093	Bacteria	2161
508	Ga0500566_0016038	3300053094	Bacteria	4401
509	Ga0500641_0000367	3300053096	Bacteria	16747
510	Ga0500641_0025863	3300053096	Bacteria	2274
511	Ga0500554_001300	3300053102	Bacteria	4837
512	Ga0500554_134045	3300053102	Bacteria	837
513	Ga0500555_000530	3300053103	Bacteria	15216
514	Ga0500556_0002301	3300053104	Bacteria	6275
515	Ga0500556_0044078	3300053104	Bacteria	1586
516	Ga0500562_000587	3300053108	Bacteria	8727
517	Ga0500562_001393	3300053108	Bacteria	5957
518	Ga0500562_008552	3300053108	Bacteria	2585
519	Ga0500569_003811	3300053109	Bacteria	3121
520	Ga0500594_0001884	3300053118	Bacteria	4544
521	Ga0500595_004073	3300053119	Bacteria	6642
522	Ga0500595_004424	3300053119	Bacteria	6311
523	Ga0500595_025877	3300053119	Bacteria	2028
524	Ga0500595_067027	3300053119	Bacteria	1072
525	Ga0500607_053361	3300053121	Bacteria	2143
526	Ga0500608_000246	3300053122	Bacteria	21323
527	Ga0500608_000699	3300053122	Bacteria	12288
528	Ga0500608_000723	3300053122	Bacteria	12096
529	Ga0500614_002953	3300053123	Bacteria	3715
530	Ga0500618_000058	3300053125	Bacteria	97628
531	Ga0500658_0009981	3300053134	Bacteria	3503
532	Ga0500559_0000140	3300053136	Bacteria	56230
533	Ga0500559_0005025	3300053136	Bacteria	6140
534	Ga0500559_0007935	3300053136	Bacteria	4679
535	Ga0500559_0072627	3300053136	Bacteria	1551
536	Ga0500564_000369	3300053138	Bacteria	12797
537	Ga0500568_0167435	3300053139	Bacteria	810
538	Ga0500573_0083994	3300053140	Bacteria	1807
539	Ga0500577_0002825	3300053142	Bacteria	4460
540	Ga0500590_095285	3300053148	Bacteria	1438
541	Ga0500603_004265	3300053150	Bacteria	3058
542	Ga0500616_0026824	3300053153	Bacteria	3185
543	Ga0500616_0039670	3300053153	Bacteria	2537
544	Ga0500619_012134	3300053154	Bacteria	2241
545	Ga0500622_0002561	3300053156	Bacteria	13019
546	Ga0500622_0017044	3300053156	Bacteria	3872
547	Ga0500622_0081572	3300053156	Bacteria	1619
548	Ga0500622_0213648	3300053156	Bacteria	869
549	Ga0500622_0225179	3300053156	Bacteria	838
550	Ga0500627_0019880	3300053158	Bacteria	2683
551	Ga0500638_059695	3300053162	Bacteria	1834
552	Ga0500576_123255	3300053725	Bacteria	1017
553	Ga0500611_007243	3300053727	Bacteria	1657
554	Ga0500645_001079	3300053730	Bacteria	15058
555	Ga0500645_001315	3300053730	Bacteria	12887
556	Ga0500645_004793	3300053730	Bacteria	5116
557	Ga0500609_005287	3300053731	Bacteria	1764
558	Ga0500596_005719	3300053735	Bacteria	2158
559	Ga0500601_011833	3300053737	Bacteria	982
560	Ga0466962_0262402	3300061719	Bacteria	850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053136	Ga0500559_0072627	Ga0500559_0072627_214_915	209
2	3300020082	Ga0206353_11002220	Ga0206353_110022201	210
3	iso_pu_bacteria	2643221699	2644550024	211
4	3300005344	Ga0070661_100292185	Ga0070661_1002921852	213
5	3300005458	Ga0070681_10047081	Ga0070681_100470814	213
6	3300005530	Ga0070679_100090368	Ga0070679_1000903682	213
7	3300005563	Ga0068855_100149360	Ga0068855_1001493602	213
8	3300025913	Ga0207695_10005699	Ga0207695_100056999	213
9	3300053122	Ga0500608_000699	Ga0500608_000699_9049_9762	217
10	3300021384	Ga0213876_10087868	Ga0213876_100878682	218
11	3300039437	Ga0436365_1365943	Ga0436365_1365943_3835_4548	218
12	3300028794	Ga0307515_10081441	Ga0307515_100814412	219
13	3300046457	Ga0495590_0000795	Ga0495590_0000795_1382_2083	219
14	3300046460	Ga0495638_0001119	Ga0495638_0001119_12265_12966	219
15	3300046471	Ga0495650_0079659	Ga0495650_0079659_322_1023	219
16	3300046512	Ga0495610_0007123	Ga0495610_0007123_4595_5296	219
17	3300046518	Ga0495631_0007728	Ga0495631_0007728_3442_4143	219
18	3300046520	Ga0495637_0022138	Ga0495637_0022138_550_1251	219
19	3300046542	Ga0495597_0100626	Ga0495597_0100626_11_712	219
20	3300047472	Ga0495686_0078472	Ga0495686_0078472_580_1281	219
21	3300049459	Ga0495678_001522	Ga0495678_001522_2191_2892	219
22	3300053086	Ga0500578_0000913	Ga0500578_0000913_16623_17324	219
23	3300053087	Ga0500643_021181	Ga0500643_021181_44_745	219
24	3300053088	Ga0500644_0000598	Ga0500644_0000598_66_767	219
25	3300053088	Ga0500644_0023180	Ga0500644_0023180_526_1227	219
26	3300053118	Ga0500594_0001884	Ga0500594_0001884_1599_2300	219
27	3300053156	Ga0500622_0002561	Ga0500622_0002561_1384_2085	219
28	3300003781	Ga0055536_1005776	Ga0055536_10057763	221
29	3300003781	Ga0055536_1005867	Ga0055536_10058673	221
30	3300003791	Ga0055530_10007010	Ga0055530_100070102	221
31	3300003791	Ga0055530_10008157	Ga0055530_100081572	221
32	3300003794	Ga0055531_10001668	Ga0055531_100016683	221
33	3300005335	Ga0070666_10183318	Ga0070666_101833182	221
34	3300005347	Ga0070668_100026264	Ga0070668_1000262642	221
35	3300005355	Ga0070671_100389098	Ga0070671_1003890981	221
36	3300005367	Ga0070667_100078225	Ga0070667_1000782253	221
37	3300005719	Ga0068861_100041336	Ga0068861_1000413363	221
38	3300005843	Ga0068860_100013081	Ga0068860_1000130815	221
39	3300005844	Ga0068862_100004740	Ga0068862_1000047407	221
40	3300009177	Ga0105248_10000106	Ga0105248_1000010684	221
41	3300009553	Ga0105249_10063507	Ga0105249_100635072	221
42	3300025292	Ga0209676_1000467	Ga0209676_10004679	221
43	3300025292	Ga0209676_1000560	Ga0209676_10005609	221
44	3300025298	Ga0209050_1000461	Ga0209050_100046162	221
45	3300025298	Ga0209050_1001568	Ga0209050_100156817	221
46	3300025303	Ga0209051_1002223	Ga0209051_10022232	221
47	3300025304	Ga0209257_1001256	Ga0209257_100125624	221
48	3300025304	Ga0209257_1010869	Ga0209257_10108693	221
49	3300025925	Ga0207650_10093214	Ga0207650_100932142	221
50	3300025931	Ga0207644_10333155	Ga0207644_103331551	221
51	3300025972	Ga0207668_10017696	Ga0207668_100176963	221
52	3300026118	Ga0207675_100043776	Ga0207675_1000437763	221
53	3300028380	Ga0268265_10006621	Ga0268265_100066214	221
54	3300028381	Ga0268264_10013056	Ga0268264_100130565	221
55	3300046460	Ga0495638_0096240	Ga0495638_0096240_29_730	221
56	3300046507	Ga0495606_0106574	Ga0495606_0106574_396_1097	221
57	3300046522	Ga0495643_0084869	Ga0495643_0084869_226_927	221
58	3300046616	Ga0495668_0000100	Ga0495668_0000100_121630_122331	221
59	3300046660	Ga0495625_0084280	Ga0495625_0084280_26_727	221
60	3300047472	Ga0495686_0011007	Ga0495686_0011007_2523_3224	221
61	3300048918	Ga0496115_0004287	Ga0496115_0004287_1901_2611	221
62	3300048918	Ga0496115_0035341	Ga0496115_0035341_3028_3729	221
63	3300050493	nmdc:mga0k408_36439_c1	nmdc:mga0k408_36439_c1_1491_2192	221
64	3300053122	Ga0500608_000723	Ga0500608_000723_163_864	221
65	3300053136	Ga0500559_0007935	Ga0500559_0007935_1028_1729	221
66	3300053156	Ga0500622_0213648	Ga0500622_0213648_142_843	221
67	3300015684	Ga0183365_10001	Ga0183365_100011843	222
68	3300028800	Ga0265338_10174503	Ga0265338_101745032	222
69	3300046539	Ga0495621_0019472	Ga0495621_0019472_632_1300	222
70	3300046694	Ga0495649_0001828	Ga0495649_0001828_10855_11535	222
71	3300049570	Ga0501033_0190353	Ga0501033_0190353_421_1122	222
72	3300049571	Ga0501034_0007621	Ga0501034_0007621_3742_4455	222
73	3300053140	Ga0500573_0083994	Ga0500573_0083994_621_1301	222
74	3300028800	Ga0265338_10081296	Ga0265338_100812963	223
75	3300047472	Ga0495686_0290233	Ga0495686_0290233_67_753	223
76	3300046524	Ga0495648_0000887	Ga0495648_0000887_30687_31388	224
77	3300047469	Ga0495673_0002003	Ga0495673_0002003_1632_2333	224
78	3300049569	Ga0501032_0091574	Ga0501032_0091574_1118_1810	224
79	3300049822	Ga0501035_0345124	Ga0501035_0345124_19_711	224
80	3300049823	Ga0501044_0095539	Ga0501044_0095539_407_1099	224
81	3300053138	Ga0500564_000369	Ga0500564_000369_5725_6426	224
82	3300005353	Ga0070669_100550506	Ga0070669_1005505061	225
83	3300005543	Ga0070672_100658083	Ga0070672_1006580831	225
84	3300009176	Ga0105242_10369014	Ga0105242_103690141	225
85	3300025940	Ga0207691_10701056	Ga0207691_107010561	225
86	3300028563	Ga0265319_1050593	Ga0265319_10505932	225
87	3300028800	Ga0265338_10114888	Ga0265338_101148882	225
88	3300035113	Ga0373936_0020958	Ga0373936_0020958_1504_2202	225
89	3300039447	Ga0436361_0200270	Ga0436361_0200270_12310_13011	225
90	3300046528	Ga0495642_0075077	Ga0495642_0075077_412_1098	225
91	3300046684	Ga0495669_0000012	Ga0495669_0000012_56799_57485	225
92	3300046684	Ga0495669_0000250	Ga0495669_0000250_5708_6409	225
93	3300005327	Ga0070658_10175916	Ga0070658_101759162	226
94	3300005366	Ga0070659_100019781	Ga0070659_1000197812	226
95	3300005530	Ga0070679_100651637	Ga0070679_1006516371	226
96	3300005539	Ga0068853_100029429	Ga0068853_1000294292	226
97	3300005617	Ga0068859_100899550	Ga0068859_1008995502	226
98	3300006028	Ga0070717_10143435	Ga0070717_101434352	226
99	3300006881	Ga0068865_100000107	Ga0068865_10000010733	226
100	3300006931	Ga0097620_100899471	Ga0097620_1008994712	226
101	3300009545	Ga0105237_10327343	Ga0105237_103273432	226
102	3300009551	Ga0105238_10008880	Ga0105238_100088809	226
103	3300013105	Ga0157369_10445690	Ga0157369_104456901	226
104	3300021361	Ga0213872_10004736	Ga0213872_100047362	226
105	3300025909	Ga0207705_10165676	Ga0207705_101656762	226
106	3300025924	Ga0207694_10092208	Ga0207694_100922081	226
107	3300025932	Ga0207690_10066631	Ga0207690_100666312	226
108	3300025938	Ga0207704_10001045	Ga0207704_1000104515	226
109	3300025941	Ga0207711_10000098	Ga0207711_100000988	226
110	3300026035	Ga0207703_10779628	Ga0207703_107796282	226
111	3300026041	Ga0207639_10021268	Ga0207639_100212682	226
112	3300028381	Ga0268264_10275884	Ga0268264_102758842	226
113	3300028558	Ga0265326_10006638	Ga0265326_100066381	226
114	3300028573	Ga0265334_10023127	Ga0265334_100231273	226
115	3300028800	Ga0265338_10009404	Ga0265338_100094043	226
116	3300028800	Ga0265338_10159721	Ga0265338_101597212	226
117	3300031251	Ga0265327_10000454	Ga0265327_1000045419	226
118	3300031251	Ga0265327_10003349	Ga0265327_1000334917	226
119	3300031251	Ga0265327_10053692	Ga0265327_100536923	226
120	3300031711	Ga0265314_10051810	Ga0265314_100518103	226
121	3300037312	Ga0395899_0000016	Ga0395899_0000016_456911_457606	226
122	3300037312	Ga0395899_0000680	Ga0395899_0000680_13662_14360	226
123	3300037312	Ga0395899_0102680	Ga0395899_0102680_699_1391	226
124	3300037418	Ga0395900_0000111	Ga0395900_0000111_34032_34730	226
125	3300037466	Ga0395898_0005748	Ga0395898_0005748_7277_7975	226
126	3300037471	Ga0395905_0038988	Ga0395905_0038988_2215_2913	226
127	3300038443	Ga0395901_0000032	Ga0395901_0000032_189148_189846	226
128	3300039447	Ga0436361_0214579	Ga0436361_0214579_2653_3345	226
129	3300039447	Ga0436361_0251567	Ga0436361_0251567_76_765	226
130	3300039447	Ga0436361_0557066	Ga0436361_0557066_429_1121	226
131	3300044684	Ga0466966_0114586	Ga0466966_0114586_477_1169	226
132	3300045049	Ga0466959_0036986	Ga0466959_0036986_2845_3537	226
133	3300047319	Ga0495674_0061313	Ga0495674_0061313_1178_1888	226
134	3300049581	Ga0501047_0002933	Ga0501047_0002933_1287_1988	226
135	3300049581	Ga0501047_0055894	Ga0501047_0055894_768_1469	226
136	3300049582	Ga0501048_0589242	Ga0501048_0589242_51_752	226
137	3300049823	Ga0501044_0335700	Ga0501044_0335700_288_989	226
138	3300053119	Ga0500595_004424	Ga0500595_004424_1794_2492	226
139	3300053119	Ga0500595_025877	Ga0500595_025877_1219_1917	226
140	iso_pu_bacteria	2739367756	2739790273	226
141	3300003320	rootH2_10019219	rootH2_100192192	227
142	3300003320	rootH2_10028357	rootH2_100283576	227
143	3300003322	rootL2_10014315	rootL2_100143152	227
144	3300003323	rootH1_10073470	rootH1_100734702	227
145	3300005614	Ga0068856_100286908	Ga0068856_1002869082	227
146	3300014325	Ga0163163_10022780	Ga0163163_100227806	227
147	3300026078	Ga0207702_10178848	Ga0207702_101788482	227
148	3300037471	Ga0395905_0000123	Ga0395905_0000123_89174_89866	227
149	3300044656	Ga0466969_0000087	Ga0466969_0000087_10086_10778	227
150	3300044684	Ga0466966_0000698	Ga0466966_0000698_14766_15458	227
151	3300044693	Ga0466961_0001686	Ga0466961_0001686_5598_6290	227
152	3300044693	Ga0466961_0075056	Ga0466961_0075056_951_1643	227
153	3300044719	Ga0466971_0001894	Ga0466971_0001894_7790_8482	227
154	3300044765	Ga0466970_0013518	Ga0466970_0013518_3211_3903	227
155	3300044842	Ga0466957_0008043	Ga0466957_0008043_409_1101	227
156	3300045049	Ga0466959_0000052	Ga0466959_0000052_13051_13743	227
157	3300045836	Ga0466958_0002496	Ga0466958_0002496_4846_5538	227
158	3300046616	Ga0495668_0108959	Ga0495668_0108959_391_1113	227
159	3300048926	Ga0496123_0189799	Ga0496123_0189799_155_868	227
160	3300049686	Ga0501257_001885	Ga0501257_001885_3574_4281	227
161	3300049822	Ga0501035_0002868	Ga0501035_0002868_8713_9414	227
162	3300049822	Ga0501035_0159992	Ga0501035_0159992_230_931	227
163	3300053080	Ga0500635_0001456	Ga0500635_0001456_3595_4296	227
164	3300061719	Ga0466962_0262402	Ga0466962_0262402_141_833	227
165	3300003791	Ga0055530_10001660	Ga0055530_100016604	228
166	3300003794	Ga0055531_10000948	Ga0055531_1000094816	228
167	3300005262	Ga0065165_1004643	Ga0065165_10046438	228
168	3300005262	Ga0065165_1061791	Ga0065165_10617912	228
169	3300005327	Ga0070658_10238955	Ga0070658_102389551	228
170	3300005336	Ga0070680_100003673	Ga0070680_1000036732	228
171	3300005336	Ga0070680_100021398	Ga0070680_1000213984	228
172	3300005339	Ga0070660_100181474	Ga0070660_1001814742	228
173	3300005339	Ga0070660_100384103	Ga0070660_1003841031	228
174	3300005347	Ga0070668_100014023	Ga0070668_1000140237	228
175	3300005347	Ga0070668_100015462	Ga0070668_1000154622	228
176	3300005366	Ga0070659_100170713	Ga0070659_1001707132	228
177	3300005457	Ga0070662_100029305	Ga0070662_1000293055	228
178	3300005458	Ga0070681_10076959	Ga0070681_100769592	228
179	3300005530	Ga0070679_100008280	Ga0070679_10000828011	228
180	3300005539	Ga0068853_100409088	Ga0068853_1004090882	228
181	3300005539	Ga0068853_100535467	Ga0068853_1005354672	228
182	3300005548	Ga0070665_100000433	Ga0070665_10000043350	228
183	3300005563	Ga0068855_100022709	Ga0068855_10002270910	228
184	3300005616	Ga0068852_100116531	Ga0068852_1001165312	228
185	3300005616	Ga0068852_101066313	Ga0068852_1010663132	228
186	3300005617	Ga0068859_100601165	Ga0068859_1006011651	228
187	3300005618	Ga0068864_100192469	Ga0068864_1001924693	228
188	3300005618	Ga0068864_100230788	Ga0068864_1002307883	228
189	3300005841	Ga0068863_100158922	Ga0068863_1001589222	228
190	3300005841	Ga0068863_100389893	Ga0068863_1003898932	228
191	3300005843	Ga0068860_100000100	Ga0068860_10000010087	228
192	3300005844	Ga0068862_100003705	Ga0068862_1000037052	228
193	3300006177	Ga0075362_10053906	Ga0075362_100539062	228
194	3300006353	Ga0075370_10121372	Ga0075370_101213722	228
195	3300006931	Ga0097620_100601253	Ga0097620_1006012532	228
196	3300009093	Ga0105240_10174092	Ga0105240_101740923	228
197	3300009093	Ga0105240_10239028	Ga0105240_102390282	228
198	3300009093	Ga0105240_10507185	Ga0105240_105071852	228
199	3300009174	Ga0105241_10442706	Ga0105241_104427062	228
200	3300009177	Ga0105248_10041501	Ga0105248_100415018	228
201	3300009545	Ga0105237_10788416	Ga0105237_107884161	228
202	3300009551	Ga0105238_10039354	Ga0105238_100393543	228
203	3300013100	Ga0157373_10003275	Ga0157373_1000327513	228
204	3300013105	Ga0157369_10448921	Ga0157369_104489211	228
205	3300013306	Ga0163162_10240155	Ga0163162_102401553	228
206	3300013307	Ga0157372_10079365	Ga0157372_100793653	228
207	3300014325	Ga0163163_10071178	Ga0163163_100711782	228
208	3300014325	Ga0163163_10084654	Ga0163163_100846543	228
209	3300014968	Ga0157379_10219977	Ga0157379_102199773	228
210	3300017792	Ga0163161_10550372	Ga0163161_105503721	228
211	3300021384	Ga0213876_10031840	Ga0213876_100318403	228
212	3300025297	Ga0209758_1000334	Ga0209758_100033414	228
213	3300025298	Ga0209050_1000130	Ga0209050_100013083	228
214	3300025304	Ga0209257_1000059	Ga0209257_1000059278	228
215	3300025304	Ga0209257_1000406	Ga0209257_100040669	228
216	3300025908	Ga0207643_10267433	Ga0207643_102674332	228
217	3300025909	Ga0207705_10000859	Ga0207705_1000085919	228
218	3300025909	Ga0207705_10285686	Ga0207705_102856862	228
219	3300025911	Ga0207654_10047582	Ga0207654_100475822	228
220	3300025912	Ga0207707_10076720	Ga0207707_100767204	228
221	3300025913	Ga0207695_10017731	Ga0207695_100177315	228
222	3300025913	Ga0207695_10160577	Ga0207695_101605772	228
223	3300025917	Ga0207660_10005314	Ga0207660_1000531410	228
224	3300025919	Ga0207657_10027665	Ga0207657_100276652	228
225	3300025919	Ga0207657_10069319	Ga0207657_100693192	228
226	3300025921	Ga0207652_10167069	Ga0207652_101670692	228
227	3300025924	Ga0207694_10094843	Ga0207694_100948433	228
228	3300025932	Ga0207690_10000159	Ga0207690_1000015935	228
229	3300025932	Ga0207690_10038229	Ga0207690_100382291	228
230	3300025949	Ga0207667_10004660	Ga0207667_1000466011	228
231	3300025949	Ga0207667_10032201	Ga0207667_100322018	228
232	3300025972	Ga0207668_10001848	Ga0207668_1000184811	228
233	3300025972	Ga0207668_10034922	Ga0207668_100349223	228
234	3300026041	Ga0207639_10387379	Ga0207639_103873792	228
235	3300026041	Ga0207639_10753562	Ga0207639_107535621	228
236	3300026078	Ga0207702_10233061	Ga0207702_102330612	228
237	3300026095	Ga0207676_10131512	Ga0207676_101315123	228
238	3300026095	Ga0207676_10150870	Ga0207676_101508702	228
239	3300026095	Ga0207676_10377067	Ga0207676_103770672	228
240	3300026142	Ga0207698_10276860	Ga0207698_102768602	228
241	3300027543	Ga0209999_1006049	Ga0209999_10060492	228
242	3300027665	Ga0209983_1027260	Ga0209983_10272602	228
243	3300028379	Ga0268266_10000003	Ga0268266_10000003557	228
244	3300028380	Ga0268265_10002522	Ga0268265_100025229	228
245	3300028380	Ga0268265_10050149	Ga0268265_100501493	228
246	3300028381	Ga0268264_10000002	Ga0268264_10000002751	228
247	3300028786	Ga0307517_10003359	Ga0307517_1000335910	228
248	3300031456	Ga0307513_10011269	Ga0307513_100112699	228
249	3300031730	Ga0307516_10000019	Ga0307516_10000019151	228
250	3300033180	Ga0307510_10059645	Ga0307510_100596453	228
251	3300035089	Ga0373944_0016071	Ga0373944_0016071_1342_2034	228
252	3300035691	Ga0373931_0115357	Ga0373931_0115357_405_1115	228
253	3300035695	Ga0373927_0001359	Ga0373927_0001359_11839_12531	228
254	3300035725	Ga0373947_0228136	Ga0373947_0228136_243_935	228
255	3300037068	Ga0373925_0000032	Ga0373925_0000032_137342_138034	228
256	3300037466	Ga0395898_0230834	Ga0395898_0230834_834_1544	228
257	3300039437	Ga0436365_0058512	Ga0436365_0058512_1256_1963	228
258	3300039438	Ga0436360_0734566	Ga0436360_0734566_338_1045	228
259	3300044842	Ga0466957_0053120	Ga0466957_0053120_1271_1975	228
260	3300046616	Ga0495668_0049601	Ga0495668_0049601_144_854	228
261	3300047320	Ga0495672_0068153	Ga0495672_0068153_49_759	228
262	3300047472	Ga0495686_0031338	Ga0495686_0031338_1883_2593	228
263	3300048904	Ga0496101_0080700	Ga0496101_0080700_497_1216	228
264	3300048905	Ga0496102_0112055	Ga0496102_0112055_1507_2226	228
265	3300048907	Ga0496104_0133002	Ga0496104_0133002_899_1618	228
266	3300048910	Ga0496107_0386213	Ga0496107_0386213_86_790	228
267	3300048911	Ga0496108_0041924	Ga0496108_0041924_112_831	228
268	3300048913	Ga0496110_0256485	Ga0496110_0256485_569_1288	228
269	3300048918	Ga0496115_0253426	Ga0496115_0253426_593_1291	228
270	3300049573	Ga0501037_0048481	Ga0501037_0048481_103_807	228
271	3300049822	Ga0501035_0075881	Ga0501035_0075881_414_1118	228
272	3300049823	Ga0501044_0002607	Ga0501044_0002607_10442_11146	228
273	3300050496	nmdc:mga07m45_47384_c1	nmdc:mga07m45_47384_c1_1189_1896	228
274	3300053096	Ga0500641_0025863	Ga0500641_0025863_43_750	228
275	3300053108	Ga0500562_008552	Ga0500562_008552_1249_1950	228
276	3300053119	Ga0500595_067027	Ga0500595_067027_69_776	228
277	iso_pu_bacteria	2643221598	2643998423	228
278	3300005331	Ga0070670_100000035	Ga0070670_100000035122	229
279	3300005331	Ga0070670_100073283	Ga0070670_1000732832	229
280	3300005336	Ga0070680_100499284	Ga0070680_1004992842	229
281	3300005347	Ga0070668_100002182	Ga0070668_10000218211	229
282	3300005347	Ga0070668_100002428	Ga0070668_10000242816	229
283	3300005347	Ga0070668_100003111	Ga0070668_1000031114	229
284	3300005355	Ga0070671_100156016	Ga0070671_1001560162	229
285	3300005367	Ga0070667_100000711	Ga0070667_10000071122	229
286	3300005367	Ga0070667_100086913	Ga0070667_1000869132	229
287	3300005367	Ga0070667_100120588	Ga0070667_1001205881	229
288	3300005530	Ga0070679_100255508	Ga0070679_1002555082	229
289	3300005548	Ga0070665_100001010	Ga0070665_10000101038	229
290	3300005548	Ga0070665_100002102	Ga0070665_10000210223	229
291	3300005548	Ga0070665_100053244	Ga0070665_1000532444	229
292	3300005548	Ga0070665_100107211	Ga0070665_1001072112	229
293	3300005563	Ga0068855_100245024	Ga0068855_1002450242	229
294	3300005614	Ga0068856_100313354	Ga0068856_1003133542	229
295	3300005617	Ga0068859_100002125	Ga0068859_10000212513	229
296	3300005618	Ga0068864_100000102	Ga0068864_10000010268	229
297	3300005618	Ga0068864_100000165	Ga0068864_10000016532	229
298	3300005841	Ga0068863_100000128	Ga0068863_10000012827	229
299	3300005841	Ga0068863_100002006	Ga0068863_10000200620	229
300	3300005841	Ga0068863_100009403	Ga0068863_1000094032	229
301	3300005842	Ga0068858_100000117	Ga0068858_1000001172	229
302	3300005842	Ga0068858_100018471	Ga0068858_1000184718	229
303	3300005842	Ga0068858_100086101	Ga0068858_1000861012	229
304	3300005843	Ga0068860_100000157	Ga0068860_100000157108	229
305	3300005843	Ga0068860_100360386	Ga0068860_1003603862	229
306	3300005844	Ga0068862_100000368	Ga0068862_10000036815	229
307	3300005844	Ga0068862_100053321	Ga0068862_1000533212	229
308	3300005844	Ga0068862_100067209	Ga0068862_1000672092	229
309	3300006931	Ga0097620_100002125	Ga0097620_10000212514	229
310	3300009092	Ga0105250_10021869	Ga0105250_100218692	229
311	3300009093	Ga0105240_10050218	Ga0105240_100502188	229
312	3300009177	Ga0105248_10026225	Ga0105248_100262256	229
313	3300009177	Ga0105248_10031769	Ga0105248_100317692	229
314	3300009177	Ga0105248_10041689	Ga0105248_100416892	229
315	3300009177	Ga0105248_10281102	Ga0105248_102811022	229
316	3300009553	Ga0105249_10000525	Ga0105249_1000052514	229
317	3300009553	Ga0105249_10153929	Ga0105249_101539292	229
318	3300013306	Ga0163162_10013185	Ga0163162_100131859	229
319	3300014325	Ga0163163_10003142	Ga0163163_100031427	229
320	3300014325	Ga0163163_10538872	Ga0163163_105388722	229
321	3300014325	Ga0163163_10624486	Ga0163163_106244862	229
322	3300014326	Ga0157380_10543327	Ga0157380_105433271	229
323	3300014326	Ga0157380_10697954	Ga0157380_106979541	229
324	3300014968	Ga0157379_10009657	Ga0157379_100096578	229
325	3300014968	Ga0157379_10128027	Ga0157379_101280272	229
326	3300014968	Ga0157379_10363270	Ga0157379_103632702	229
327	3300025711	Ga0207696_1016173	Ga0207696_10161733	229
328	3300025900	Ga0207710_10040132	Ga0207710_100401322	229
329	3300025900	Ga0207710_10215203	Ga0207710_102152031	229
330	3300025913	Ga0207695_10055587	Ga0207695_100555876	229
331	3300025913	Ga0207695_10085386	Ga0207695_100853862	229
332	3300025925	Ga0207650_10000350	Ga0207650_1000035048	229
333	3300025941	Ga0207711_10003343	Ga0207711_100033436	229
334	3300025941	Ga0207711_10010082	Ga0207711_100100824	229
335	3300025941	Ga0207711_10023616	Ga0207711_100236162	229
336	3300025941	Ga0207711_10153594	Ga0207711_101535942	229
337	3300025949	Ga0207667_10019407	Ga0207667_100194071	229
338	3300025961	Ga0207712_10001643	Ga0207712_1000164311	229
339	3300025961	Ga0207712_10093167	Ga0207712_100931672	229
340	3300025972	Ga0207668_10000025	Ga0207668_1000002537	229
341	3300025972	Ga0207668_10000035	Ga0207668_10000035131	229
342	3300025972	Ga0207668_10002965	Ga0207668_100029651	229
343	3300025986	Ga0207658_10000300	Ga0207658_1000030045	229
344	3300025986	Ga0207658_10001621	Ga0207658_1000162120	229
345	3300025986	Ga0207658_10028144	Ga0207658_100281447	229
346	3300026035	Ga0207703_10002585	Ga0207703_1000258515	229
347	3300026035	Ga0207703_10004356	Ga0207703_100043563	229
348	3300026035	Ga0207703_10012853	Ga0207703_100128532	229
349	3300026078	Ga0207702_10242073	Ga0207702_102420732	229
350	3300026088	Ga0207641_10000005	Ga0207641_10000005409	229
351	3300026088	Ga0207641_10000777	Ga0207641_100007779	229
352	3300026088	Ga0207641_10000994	Ga0207641_1000099414	229
353	3300026095	Ga0207676_10000066	Ga0207676_1000006696	229
354	3300026095	Ga0207676_10000145	Ga0207676_100001452	229
355	3300026118	Ga0207675_100435900	Ga0207675_1004359001	229
356	3300028379	Ga0268266_10000814	Ga0268266_100008142	229
357	3300028379	Ga0268266_10002311	Ga0268266_100023118	229
358	3300028379	Ga0268266_10061572	Ga0268266_100615723	229
359	3300028379	Ga0268266_10290893	Ga0268266_102908932	229
360	3300028380	Ga0268265_10007485	Ga0268265_100074858	229
361	3300028380	Ga0268265_10010073	Ga0268265_100100738	229
362	3300028380	Ga0268265_10050898	Ga0268265_100508984	229
363	3300028381	Ga0268264_10000211	Ga0268264_1000021145	229
364	3300028381	Ga0268264_10027891	Ga0268264_100278915	229
365	3300028786	Ga0307517_10037096	Ga0307517_100370967	229
366	3300031456	Ga0307513_10000053	Ga0307513_1000005364	229
367	3300031456	Ga0307513_10000790	Ga0307513_1000079015	229
368	3300035170	Ga0373943_0035044	Ga0373943_0035044_431_1141	229
369	3300037312	Ga0395899_0166208	Ga0395899_0166208_88_798	229
370	3300037418	Ga0395900_0009668	Ga0395900_0009668_7137_7847	229
371	3300037466	Ga0395898_0012341	Ga0395898_0012341_848_1558	229
372	3300037466	Ga0395898_0217027	Ga0395898_0217027_1010_1720	229
373	3300037471	Ga0395905_0062149	Ga0395905_0062149_1935_2645	229
374	3300038443	Ga0395901_0163116	Ga0395901_0163116_1419_2129	229
375	3300038443	Ga0395901_1087890	Ga0395901_1087890_16_726	229
376	3300044693	Ga0466961_0398995	Ga0466961_0398995_80_790	229
377	3300044706	Ga0466964_0097557	Ga0466964_0097557_530_1240	229
378	3300046459	Ga0495629_0039331	Ga0495629_0039331_1695_2405	229
379	3300046460	Ga0495638_0068195	Ga0495638_0068195_751_1461	229
380	3300046506	Ga0495583_0014367	Ga0495583_0014367_1207_1917	229
381	3300046507	Ga0495606_0084999	Ga0495606_0084999_1198_1908	229
382	3300046515	Ga0495620_0057000	Ga0495620_0057000_131_841	229
383	3300046522	Ga0495643_0088257	Ga0495643_0088257_588_1298	229
384	3300046530	Ga0495654_0112878	Ga0495654_0112878_168_878	229
385	3300046542	Ga0495597_0005464	Ga0495597_0005464_4681_5391	229
386	3300046557	Ga0495622_0023435	Ga0495622_0023435_1486_2196	229
387	3300046616	Ga0495668_0144499	Ga0495668_0144499_121_831	229
388	3300046660	Ga0495625_0050107	Ga0495625_0050107_386_1096	229
389	3300046660	Ga0495625_0221274	Ga0495625_0221274_425_1135	229
390	3300046684	Ga0495669_0048198	Ga0495669_0048198_1097_1807	229
391	3300046684	Ga0495669_0056559	Ga0495669_0056559_1000_1710	229
392	3300047443	Ga0495687_063975	Ga0495687_063975_148_858	229
393	3300047447	Ga0495685_134099	Ga0495685_134099_40_750	229
394	3300047673	Ga0495593_0160434	Ga0495593_0160434_354_1064	229
395	3300048088	Ga0495602_0232155	Ga0495602_0232155_353_1063	229
396	3300048905	Ga0496102_0031506	Ga0496102_0031506_2547_3257	229
397	3300048906	Ga0496103_0026960	Ga0496103_0026960_2572_3282	229
398	3300048919	Ga0496116_0065515	Ga0496116_0065515_230_940	229
399	3300048920	Ga0496117_0173573	Ga0496117_0173573_273_983	229
400	3300048921	Ga0496118_0066912	Ga0496118_0066912_835_1545	229
401	3300048922	Ga0496119_0004972	Ga0496119_0004972_5919_6629	229
402	3300048924	Ga0496121_0000059	Ga0496121_0000059_143134_143844	229
403	3300053080	Ga0500635_0000048	Ga0500635_0000048_11207_11917	229
404	3300053086	Ga0500578_0056542	Ga0500578_0056542_22_732	229
405	3300053087	Ga0500643_006111	Ga0500643_006111_2111_2821	229
406	3300053091	Ga0500647_0125783	Ga0500647_0125783_397_1107	229
407	3300053093	Ga0500651_0071351	Ga0500651_0071351_1198_1908	229
408	3300053094	Ga0500566_0016038	Ga0500566_0016038_979_1689	229
409	3300053102	Ga0500554_134045	Ga0500554_134045_51_761	229
410	3300053103	Ga0500555_000530	Ga0500555_000530_545_1255	229
411	3300053108	Ga0500562_001393	Ga0500562_001393_1828_2538	229
412	3300053109	Ga0500569_003811	Ga0500569_003811_2113_2823	229
413	3300053119	Ga0500595_004073	Ga0500595_004073_1008_1718	229
414	3300053121	Ga0500607_053361	Ga0500607_053361_90_800	229
415	3300053122	Ga0500608_000246	Ga0500608_000246_8061_8771	229
416	3300053123	Ga0500614_002953	Ga0500614_002953_1766_2476	229
417	3300053148	Ga0500590_095285	Ga0500590_095285_394_1104	229
418	3300053150	Ga0500603_004265	Ga0500603_004265_1096_1806	229
419	3300053154	Ga0500619_012134	Ga0500619_012134_1136_1846	229
420	3300053162	Ga0500638_059695	Ga0500638_059695_128_838	229
421	3300053725	Ga0500576_123255	Ga0500576_123255_243_953	229
422	3300053735	Ga0500596_005719	Ga0500596_005719_1126_1836	229
423	3300053737	Ga0500601_011833	Ga0500601_011833_253_963	229
424	iso_pu_bacteria	2510917020	2511122244	229
425	iso_pu_bacteria	2582581279	2585149014	229
426	iso_pu_bacteria	2582581280	2585153004	229
427	iso_pu_bacteria	2582581293	2585195037	229
428	iso_pu_bacteria	2585428106	2587915384	229
429	iso_pu_bacteria	2643221545	2643747168	229
430	iso_pu_bacteria	2643221552	2643781200	229
431	iso_pu_bacteria	2643221583	2643924332	229
432	iso_pu_bacteria	2643221584	2643927216	229
433	iso_pu_bacteria	2643221614	2644086710	229
434	iso_pu_bacteria	2643221640	2644223940	229
435	iso_pu_bacteria	2643221642	2644232926	229
436	iso_pu_bacteria	2643221661	2644341664	229
437	iso_pu_bacteria	2643221666	2644367951	229
438	iso_pu_bacteria	2643221691	2644507636	229
439	iso_pu_bacteria	2791355048	2792459238	229
440	iso_pu_bacteria	2818991435	2819537564	229
441	iso_pu_bacteria	2818991454	2819646374	229
442	iso_pu_bacteria	2843744320	2843744839	229
443	iso_pu_bacteria	2849560528	2849563592	229
444	iso_pu_bacteria	2849573788	2849577921	229
445	iso_pu_bacteria	2851153111	2851154644	229
446	iso_pu_bacteria	2857504554	2857508015	229
447	iso_pu_bacteria	2884960567	2884963108	229
448	iso_pu_bacteria	2898329390	2898330551	229
449	iso_pu_bacteria	2928531327	2928534827	229
450	3300003578	Ga0006562J51391_1023027	Ga0006562J51391_10230272	230
451	3300003781	Ga0055536_1005613	Ga0055536_10056132	230
452	3300005334	Ga0068869_100018066	Ga0068869_1000180662	230
453	3300005564	Ga0070664_100149837	Ga0070664_1001498372	230
454	3300006042	Ga0075368_10012058	Ga0075368_100120581	230
455	3300006051	Ga0075364_10000571	Ga0075364_100005719	230
456	3300006178	Ga0075367_10002075	Ga0075367_1000207511	230
457	3300006186	Ga0075369_10074365	Ga0075369_100743652	230
458	3300006353	Ga0075370_10035355	Ga0075370_100353552	230
459	3300009093	Ga0105240_10425389	Ga0105240_104253892	230
460	3300013100	Ga0157373_10009299	Ga0157373_100092996	230
461	3300013102	Ga0157371_10104425	Ga0157371_101044252	230
462	3300013104	Ga0157370_10025476	Ga0157370_100254762	230
463	3300013105	Ga0157369_10009787	Ga0157369_100097872	230
464	3300025250	Ga0209026_1002628	Ga0209026_10026286	230
465	3300025292	Ga0209676_1000252	Ga0209676_100025285	230
466	3300025304	Ga0209257_1000060	Ga0209257_1000060255	230
467	3300025920	Ga0207649_10264689	Ga0207649_102646892	230
468	3300025942	Ga0207689_10074013	Ga0207689_100740133	230
469	3300025945	Ga0207679_10002652	Ga0207679_100026522	230
470	3300026041	Ga0207639_10359296	Ga0207639_103592962	230
471	3300031456	Ga0307513_10005351	Ga0307513_1000535120	230
472	3300031824	Ga0307413_10031058	Ga0307413_100310582	230
473	3300031901	Ga0307406_10008222	Ga0307406_100082223	230
474	3300031911	Ga0307412_10186005	Ga0307412_101860052	230
475	3300032004	Ga0307414_10658507	Ga0307414_106585071	230
476	3300046558	Ga0495633_0001662	Ga0495633_0001662_941_1672	230
477	3300048918	Ga0496115_0142983	Ga0496115_0142983_245_976	230
478	3300048925	Ga0496122_0002860	Ga0496122_0002860_7182_7919	230
479	3300048926	Ga0496123_0001072	Ga0496123_0001072_31241_31978	230
480	3300048927	Ga0496124_0090823	Ga0496124_0090823_1048_1779	230
481	3300048928	Ga0496125_0001101	Ga0496125_0001101_14155_14886	230
482	3300050491	nmdc:mga00v17_165_c2	nmdc:mga00v17_165_c2_7726_8439	230
483	3300050495	nmdc:mga04h51_9415_c1	nmdc:mga04h51_9415_c1_811_1524	230
484	3300050496	nmdc:mga07m45_27726_c1	nmdc:mga07m45_27726_c1_1900_2613	230
485	3300050516	nmdc:mga0sz30_27614_c1	nmdc:mga0sz30_27614_c1_976_1689	230
486	3300053156	Ga0500622_0081572	Ga0500622_0081572_723_1454	230
487	iso_pu_bacteria	2643221574	2643883071	230
488	iso_pu_bacteria	2643221663	2644353880	230
489	iso_pu_bacteria	2928972540	2928972866	230
490	iso_pu_bacteria	2941485952	2941488677	230
491	iso_pu_bacteria	2977240413	2977242645	230
492	3300005347	Ga0070668_100177005	Ga0070668_1001770052	231
493	3300005548	Ga0070665_100176416	Ga0070665_1001764162	231
494	3300005617	Ga0068859_100525756	Ga0068859_1005257562	231
495	3300005719	Ga0068861_100378407	Ga0068861_1003784072	231
496	3300006931	Ga0097620_100525789	Ga0097620_1005257892	231
497	3300025250	Ga0209026_1025249	Ga0209026_10252492	231
498	3300025961	Ga0207712_10396384	Ga0207712_103963842	231
499	3300025972	Ga0207668_10013045	Ga0207668_100130455	231
500	3300026088	Ga0207641_10093921	Ga0207641_100939212	231
501	3300026118	Ga0207675_100236031	Ga0207675_1002360312	231
502	3300031251	Ga0265327_10002802	Ga0265327_1000280219	231
503	3300033180	Ga0307510_10109845	Ga0307510_101098452	231
504	3300005539	Ga0068853_100209795	Ga0068853_1002097952	232
505	3300025909	Ga0207705_10537669	Ga0207705_105376691	232
506	3300003215	JGI25153J46596_10030285	JGI25153J46596_100302852	233
507	3300003322	rootL2_10005023	rootL2_100050238	233
508	3300003322	rootL2_10022557	rootL2_100225572	233
509	3300003773	Ga0055537_1003143	Ga0055537_10031432	233
510	3300003775	Ga0055524_1016468	Ga0055524_10164683	233
511	3300003790	Ga0055528_1007473	Ga0055528_10074732	233
512	3300005262	Ga0065165_1000930	Ga0065165_100093018	233
513	3300006186	Ga0075369_10015535	Ga0075369_100155352	233
514	3300025263	Ga0209565_1000422	Ga0209565_10004227	233
515	3300025273	Ga0209673_1001190	Ga0209673_100119022	233
516	3300025291	Ga0209675_1004954	Ga0209675_10049545	233
517	3300025295	Ga0209564_1001269	Ga0209564_10012699	233
518	3300025295	Ga0209564_1029350	Ga0209564_10293501	233
519	3300025297	Ga0209758_1002117	Ga0209758_100211717	233
520	3300025297	Ga0209758_1003299	Ga0209758_10032993	233
521	3300025299	Ga0209256_1005129	Ga0209256_10051295	233
522	3300025304	Ga0209257_1000036	Ga0209257_1000036243	233
523	3300028794	Ga0307515_10203945	Ga0307515_102039451	233
524	3300028794	Ga0307515_10414460	Ga0307515_104144602	233
525	3300039437	Ga0436365_1241636	Ga0436365_1241636_483_1193	233
526	3300042436	Ga0439435_0001945	Ga0439435_0001945_2054_2755	233
527	3300042438	Ga0439459_0051355	Ga0439459_0051355_142_855	233
528	3300042530	Ga0450916_002091	Ga0450916_002091_1265_1966	233
529	3300046453	Ga0495627_002718	Ga0495627_002718_775_1476	233
530	3300046460	Ga0495638_0000478	Ga0495638_0000478_14393_15094	233
531	3300046460	Ga0495638_0003434	Ga0495638_0003434_10337_11038	233
532	3300046460	Ga0495638_0058885	Ga0495638_0058885_1300_2001	233
533	3300046460	Ga0495638_0127105	Ga0495638_0127105_104_805	233
534	3300046471	Ga0495650_0000024	Ga0495650_0000024_293962_294663	233
535	3300046492	Ga0495585_0100319	Ga0495585_0100319_47_748	233
536	3300046501	Ga0495607_0076708	Ga0495607_0076708_869_1570	233
537	3300046506	Ga0495583_0000005	Ga0495583_0000005_108043_108744	233
538	3300046507	Ga0495606_0008388	Ga0495606_0008388_4491_5192	233
539	3300046512	Ga0495610_0000078	Ga0495610_0000078_45937_46638	233
540	3300046512	Ga0495610_0002350	Ga0495610_0002350_8395_9096	233
541	3300046513	Ga0495616_0000384	Ga0495616_0000384_25750_26451	233
542	3300046515	Ga0495620_0039578	Ga0495620_0039578_53_754	233
543	3300046518	Ga0495631_0136314	Ga0495631_0136314_272_973	233
544	3300046519	Ga0495632_0001324	Ga0495632_0001324_12837_13538	233
545	3300046520	Ga0495637_0006471	Ga0495637_0006471_4831_5532	233
546	3300046520	Ga0495637_0035293	Ga0495637_0035293_1439_2140	233
547	3300046530	Ga0495654_0000026	Ga0495654_0000026_8353_9054	233
548	3300046616	Ga0495668_0085121	Ga0495668_0085121_745_1446	233
549	3300046616	Ga0495668_0131530	Ga0495668_0131530_59_760	233
550	3300046616	Ga0495668_0132065	Ga0495668_0132065_607_1308	233
551	3300046660	Ga0495625_0002592	Ga0495625_0002592_10356_11057	233
552	3300046660	Ga0495625_0089218	Ga0495625_0089218_662_1363	233
553	3300046660	Ga0495625_0144658	Ga0495625_0144658_662_1363	233
554	3300046660	Ga0495625_0158858	Ga0495625_0158858_697_1398	233
555	3300046810	Ga0495660_0001804	Ga0495660_0001804_13268_13969	233
556	3300047320	Ga0495672_0002493	Ga0495672_0002493_6107_6808	233
557	3300047323	Ga0495683_0124456	Ga0495683_0124456_366_1067	233
558	3300047446	Ga0495679_016734	Ga0495679_016734_1483_2184	233
559	3300047469	Ga0495673_0000346	Ga0495673_0000346_15072_15773	233
560	3300047469	Ga0495673_0023954	Ga0495673_0023954_1538_2239	233
561	3300047472	Ga0495686_0008224	Ga0495686_0008224_6827_7528	233
562	3300047472	Ga0495686_0148187	Ga0495686_0148187_648_1349	233
563	3300047472	Ga0495686_0233793	Ga0495686_0233793_196_897	233
564	3300048909	Ga0496106_0167641	Ga0496106_0167641_428_1129	233
565	3300048910	Ga0496107_0007239	Ga0496107_0007239_6915_7616	233
566	3300048924	Ga0496121_0004872	Ga0496121_0004872_10070_10771	233
567	3300048927	Ga0496124_0013512	Ga0496124_0013512_298_1005	233
568	3300048929	Ga0496126_0004127	Ga0496126_0004127_1389_2096	233
569	3300049570	Ga0501033_0003034	Ga0501033_0003034_320_1030	233
570	3300049571	Ga0501034_0046132	Ga0501034_0046132_1029_1739	233
571	3300049823	Ga0501044_0000588	Ga0501044_0000588_39154_39864	233
572	3300050516	nmdc:mga0sz30_2184_c1	nmdc:mga0sz30_2184_c1_1492_2199	233
573	3300053087	Ga0500643_000316	Ga0500643_000316_14936_15661	233
574	3300053096	Ga0500641_0000367	Ga0500641_0000367_1566_2291	233
575	3300053102	Ga0500554_001300	Ga0500554_001300_1075_1776	233
576	3300053104	Ga0500556_0002301	Ga0500556_0002301_1639_2340	233
577	3300053104	Ga0500556_0044078	Ga0500556_0044078_466_1191	233
578	3300053108	Ga0500562_000587	Ga0500562_000587_1363_2088	233
579	3300053125	Ga0500618_000058	Ga0500618_000058_26122_26823	233
580	3300053134	Ga0500658_0009981	Ga0500658_0009981_2520_3221	233
581	3300053136	Ga0500559_0000140	Ga0500559_0000140_21738_22439	233
582	3300053136	Ga0500559_0005025	Ga0500559_0005025_5195_5896	233
583	3300053139	Ga0500568_0167435	Ga0500568_0167435_63_788	233
584	3300053142	Ga0500577_0002825	Ga0500577_0002825_3707_4408	233
585	3300053153	Ga0500616_0026824	Ga0500616_0026824_1594_2295	233
586	3300053153	Ga0500616_0039670	Ga0500616_0039670_1222_1947	233
587	3300053156	Ga0500622_0017044	Ga0500622_0017044_518_1243	233
588	3300053156	Ga0500622_0225179	Ga0500622_0225179_80_781	233
589	3300053158	Ga0500627_0019880	Ga0500627_0019880_492_1193	233
590	3300053727	Ga0500611_007243	Ga0500611_007243_382_1083	233
591	3300053730	Ga0500645_001079	Ga0500645_001079_11498_12223	233
592	3300053730	Ga0500645_001315	Ga0500645_001315_3434_4159	233
593	3300053730	Ga0500645_004793	Ga0500645_004793_4050_4751	233
594	3300053731	Ga0500609_005287	Ga0500609_005287_476_1177	233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

37

150

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3w9s-assembly1.cif.gz_B	crystal structure analysis of the n-terminal receiver domain of response regulator pmra	0.9705	11	129
2a9r-assembly1.cif.gz_A-2	rr02-rec phosphate in the active site	0.9674	9	130
1nxt-assembly1.cif.gz_A-2	micarec ph 4.0	0.9673	9	130
2pl1-assembly1.cif.gz_A	berrylium fluoride activated receiver domain of e.coli phop	0.9662	10	131
7m0s-assembly1.cif.gz_B	n-terminal domain of pmra from acinetobacter baumannii	0.9652	9	130

ID	Description	Score	Start	End	Superfamily
af_P23836_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9839	10	91	3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9796	9	91	3.40.50.2300
af_P0AA16_3_84_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9789	9	91	3.40.50.2300
af_O07776_22_102_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9713	9	91	3.40.50.2300
af_P30843_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9703	10	91	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A536BC37-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.9857	9	128	GO:0000155 GO:0005524
AF-A0A846E1R9-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.985	9	129	GO:0000155 GO:0016020
AF-A0A1Z4JLY7-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.9841	9	128	GO:0000155
AF-A0A1N7EQV4-F1-model_v4	deleted	0.9831	9	128
AF-A0A1Z4STJ1-F1-model_v4	deleted	0.9829	9	128

Feature Viewer

pLDDT	pTM	Quality
88.42	0.59	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467298

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

37

150

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map