F467151

General Info

Members Datasets Scaffolds Average Seq Length
592 335 561 274

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_0709787|Ga0451837_0709787_366_1364
Length 332
Sequence MSPRRKSRMLWSFVSIAIGLIFAGAGLWLIERPDLWLWLITGTVFVLTGAVGLLMGEKAPQISWGSIVGAELIVLYTLTPVVYLVSLSLKGGNADVNQGGFLPQDPGFDNYKTVFKFDLFQSALVNSFGISIISTTISVVLATFAAYAIARLRFRGKKFVLSMALAIAMFPVVALVGPLFDMWRAIGIYDTWLGLIIPYLSFTLPMSIWVLSAFFREIPWEMEQAAEVDGATAWQAFRKVIVPLAAPGVFTAAIITFFFAWNDFVFGISLTSTTRAIPVPASLAFFTGASQFDQPIAAIAAASVXXXVPIFIIVLLFQRKIVSGLTSGAVKG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221590 Nocardioides sp. Root682 Isolate Unclassified
6 2643221604 Nocardioides sp. Root190 Isolate Unclassified
7 2643221617 Nocardioides sp. Root79 Isolate Unclassified
8 2643221620 Nocardioides sp. Root240 Isolate Unclassified
9 2643221641 Nocardioides sp. Root122 Isolate Unclassified
10 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
11 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
12 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
13 2643221696 Nocardioides sp. Root140 Isolate Unclassified
14 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
15 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
16 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
17 2739367898 Nocardioides sp. CF479 Isolate Unclassified
18 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
19 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
20 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
21 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
22 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
23 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
24 2857727296 Kocuria sp. R-72562 Isolate Unclassified
25 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
26 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
27 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
28 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
29 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
213 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
214 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
215 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
335 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.68
Metatranscriptomes 6.08
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 6.42
Nodule 0.17
Rhizoplane 7.6
Rhizosphere 79.22
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000078 3300002077 Bacteria 12370
2 JGI24742J22300_10000523 3300002244 Bacteria 5732
3 Ga0055540_1029007 3300003792 Bacteria 1300
4 Ga0055540_1044808 3300003792 Bacteria 937
5 Ga0070658_10394635 3300005327 Bacteria 1188
6 Ga0070676_10002380 3300005328 Bacteria 9627
7 Ga0070683_100015687 3300005329 Bacteria 6661
8 Ga0070683_100033858 3300005329 Bacteria 4662
9 Ga0070683_100091573 3300005329 Bacteria 2855
10 Ga0070690_100006999 3300005330 Bacteria 6429
11 Ga0070666_10022138 3300005335 Bacteria 4125
12 Ga0070682_100057891 3300005337 Bacteria 2443
13 Ga0070682_100067443 3300005337 Bacteria 2279
14 Ga0070682_100074265 3300005337 Bacteria 2183
15 Ga0068868_100018801 3300005338 Bacteria 5169
16 Ga0068868_100275877 3300005338 Bacteria 1421
17 Ga0068868_100319860 3300005338 Bacteria 1322
18 Ga0070689_100003899 3300005340 Bacteria 9997
19 Ga0070691_10002225 3300005341 Bacteria 8580
20 Ga0070687_100030099 3300005343 Bacteria 2651
21 Ga0070692_10039994 3300005345 Bacteria 2396
22 Ga0070668_100009628 3300005347 Bacteria 7169
23 Ga0070669_100003754 3300005353 Bacteria 10972
24 Ga0070674_100002737 3300005356 Bacteria 9747
25 Ga0070659_100103632 3300005366 Bacteria 2292
26 Ga0070659_100142478 3300005366 Bacteria 1952
27 Ga0070667_100008109 3300005367 Bacteria 8711
28 Ga0070667_100021025 3300005367 Bacteria 5422
29 Ga0070703_10009690 3300005406 Bacteria 2718
30 Ga0070709_10005377 3300005434 Bacteria 6935
31 Ga0070714_100015337 3300005435 Bacteria 6165
32 Ga0070713_100076272 3300005436 Bacteria 2846
33 Ga0070710_10001581 3300005437 Bacteria 10748
34 Ga0070701_10000838 3300005438 Bacteria 11018
35 Ga0070711_100001170 3300005439 Bacteria 14108
36 Ga0070705_100009208 3300005440 Bacteria 4904
37 Ga0070700_100002020 3300005441 Bacteria 10306
38 Ga0070694_100002677 3300005444 Bacteria 10554
39 Ga0070663_100006355 3300005455 Bacteria 7096
40 Ga0070678_100001750 3300005456 Bacteria 11677
41 Ga0070678_100349596 3300005456 Bacteria 1271
42 Ga0070662_100001556 3300005457 Bacteria 14166
43 Ga0070681_10185544 3300005458 Bacteria 2000
44 Ga0068867_100001095 3300005459 Bacteria 18493
45 Ga0070685_10140507 3300005466 Bacteria 1520
46 Ga0070679_100001580 3300005530 Bacteria 20414
47 Ga0070679_100467901 3300005530 Bacteria 1205
48 Ga0070684_100015891 3300005535 Bacteria 6143
49 Ga0070684_100451921 3300005535 Bacteria 1188
50 Ga0068853_100009119 3300005539 Bacteria 7991
51 Ga0070672_100388643 3300005543 Bacteria 1194
52 Ga0070695_100009155 3300005545 Bacteria 5888
53 Ga0070696_100001977 3300005546 Bacteria 13461
54 Ga0070665_100002666 3300005548 Bacteria 19405
55 Ga0070665_100053510 3300005548 Bacteria 4048
56 Ga0070704_100025332 3300005549 Bacteria 3904
57 Ga0068855_100013782 3300005563 Bacteria 9746
58 Ga0068857_100000819 3300005577 Bacteria 23265
59 Ga0068854_100001489 3300005578 Bacteria 14174
60 Ga0068856_100160954 3300005614 Bacteria 2255
61 Ga0070702_100001146 3300005615 Bacteria 10651
62 Ga0070702_100057973 3300005615 Bacteria 2241
63 Ga0068852_100045801 3300005616 Bacteria 3723
64 Ga0068852_100394343 3300005616 Bacteria 1360
65 Ga0068859_100005669 3300005617 Bacteria 12711
66 Ga0068866_10001545 3300005718 Bacteria 9773
67 Ga0068861_100005782 3300005719 Bacteria 8391
68 Ga0068858_100007701 3300005842 Bacteria 10397
69 Ga0068860_100000408 3300005843 Bacteria 55871
70 Ga0068860_100004270 3300005843 Bacteria 14630
71 Ga0068862_100024677 3300005844 Bacteria 5045
72 Ga0081538_10000099 3300005981 Bacteria 83947
73 Ga0081538_10000252 3300005981 Bacteria 60660
74 Ga0081538_10019152 3300005981 Bacteria 5103
75 Ga0081538_10037561 3300005981 Bacteria 3140
76 Ga0081538_10037796 3300005981 Bacteria 3124
77 Ga0081538_10049339 3300005981 Bacteria 2554
78 Ga0081538_10096530 3300005981 Bacteria 1505
79 Ga0081539_10079947 3300005985 Bacteria 1721
80 Ga0070717_10015158 3300006028 Bacteria 5946
81 Ga0070717_10137861 3300006028 Bacteria 2102
82 Ga0070717_10156338 3300006028 Bacteria 1976
83 Ga0075365_10017086 3300006038 Bacteria 4429
84 Ga0075365_10017207 3300006038 Bacteria 4417
85 Ga0075365_10024565 3300006038 Bacteria 3803
86 Ga0075365_10025770 3300006038 Bacteria 3726
87 Ga0075365_10045002 3300006038 Bacteria 2894
88 Ga0075365_10049467 3300006038 Bacteria 2770
89 Ga0075365_10332158 3300006038 Bacteria 1071
90 Ga0075363_100049876 3300006048 Bacteria 2229
91 Ga0075364_10007767 3300006051 Bacteria 6390
92 Ga0075364_10010039 3300006051 Bacteria 5705
93 Ga0075364_10044043 3300006051 Bacteria 2902
94 Ga0075432_10069707 3300006058 Bacteria 1262
95 Ga0070715_10001041 3300006163 Bacteria 7840
96 Ga0070716_100008509 3300006173 Bacteria 5092
97 Ga0070712_100000937 3300006175 Bacteria 17569
98 Ga0075367_10048383 3300006178 Bacteria 2504
99 Ga0075367_10130088 3300006178 Bacteria 1556
100 Ga0068871_100221906 3300006358 Bacteria 1638
101 Ga0075428_100039164 3300006844 Bacteria 5216
102 Ga0075428_100180884 3300006844 Bacteria 2282
103 Ga0075431_100079606 3300006847 Bacteria 3382
104 Ga0075429_100000888 3300006880 Bacteria 23633
105 Ga0068865_100003697 3300006881 Bacteria 9193
106 Ga0068865_100259268 3300006881 Bacteria 1376
107 Ga0097620_100005669 3300006931 Bacteria 12711
108 Ga0105250_10037625 3300009092 Bacteria 1941
109 Ga0105240_10849346 3300009093 Bacteria 986
110 Ga0111539_10058482 3300009094 Bacteria 4574
111 Ga0105245_10011878 3300009098 Bacteria 7572
112 Ga0105245_10035148 3300009098 Bacteria 4447
113 Ga0105245_10059711 3300009098 Bacteria 3434
114 Ga0105245_10112496 3300009098 Bacteria 2534
115 Ga0105247_10001851 3300009101 Bacteria 14800
116 Ga0105247_10087153 3300009101 Bacteria 1976
117 Ga0105247_10152885 3300009101 Bacteria 1522
118 Ga0114129_10142119 3300009147 Bacteria 3289
119 Ga0114129_10166783 3300009147 Bacteria 3005
120 Ga0105243_10014535 3300009148 Bacteria 5956
121 Ga0105242_10003909 3300009176 Bacteria 11586
122 Ga0105248_10112709 3300009177 Bacteria 3067
123 Ga0105248_10257854 3300009177 Bacteria 1963
124 Ga0105237_10023851 3300009545 Bacteria 6261
125 Ga0105238_10142663 3300009551 Bacteria 2372
126 Ga0105249_10006429 3300009553 Bacteria 10214
127 Ga0105249_10112826 3300009553 Bacteria 2571
128 Ga0105239_10002575 3300010375 Bacteria 22977
129 Ga0105239_10016028 3300010375 Bacteria 8293
130 Ga0105239_10029888 3300010375 Bacteria 5992
131 Ga0105239_10343406 3300010375 Bacteria 1685
132 Ga0105239_10355278 3300010375 Bacteria 1655
133 Ga0105246_10030583 3300011119 Bacteria 3558
134 Ga0157371_10394161 3300013102 Bacteria 1012
135 Ga0157369_10030343 3300013105 Bacteria 5963
136 Ga0157378_10003234 3300013297 Bacteria 14500
137 Ga0163162_10010330 3300013306 Bacteria 9074
138 Ga0163162_10188172 3300013306 Bacteria 2192
139 Ga0163162_10657106 3300013306 Bacteria 1172
140 Ga0163162_10943039 3300013306 Bacteria 974
141 Ga0157372_10003899 3300013307 Bacteria 16030
142 Ga0157372_10078862 3300013307 Bacteria 3722
143 Ga0157375_10002098 3300013308 Bacteria 17205
144 Ga0157375_10047567 3300013308 Bacteria 4191
145 Ga0157375_10383078 3300013308 Bacteria 1573
146 Ga0157375_10448611 3300013308 Bacteria 1455
147 Ga0163163_10013478 3300014325 Bacteria 7489
148 Ga0163163_10410426 3300014325 Bacteria 1413
149 Ga0157380_10003529 3300014326 Bacteria 10751
150 Ga0157379_10038287 3300014968 Bacteria 4279
151 Ga0163161_10005680 3300017792 Bacteria 8647
152 Ga0163161_10009991 3300017792 Bacteria 6574
153 Ga0206351_10140874 3300020077 Bacteria 1922
154 Ga0206350_10894643 3300020080 Bacteria 3293
155 Ga0206350_11056928 3300020080 Bacteria 942
156 Ga0206354_10050827 3300020081 Bacteria 944
157 Ga0154015_1573958 3300020610 Bacteria 1633
158 Ga0224712_10008296 3300022467 Bacteria 3072
159 Ga0224712_10008417 3300022467 Bacteria 3057
160 Ga0224712_10037096 3300022467 Bacteria 1812
161 Ga0209051_1003121 3300025303 Bacteria 11169
162 Ga0209051_1003771 3300025303 Bacteria 9724
163 Ga0209051_1032521 3300025303 Bacteria 1988
164 Ga0207653_10006916 3300025885 Bacteria 3537
165 Ga0207692_10001621 3300025898 Bacteria 8485
166 Ga0207642_10001089 3300025899 Bacteria 8426
167 Ga0207710_10138033 3300025900 Bacteria 1175
168 Ga0207688_10001131 3300025901 Bacteria 13728
169 Ga0207688_10023746 3300025901 Bacteria 3360
170 Ga0207688_10101463 3300025901 Bacteria 1662
171 Ga0207647_10070388 3300025904 Bacteria 2113
172 Ga0207647_10077760 3300025904 Bacteria 1994
173 Ga0207699_10016517 3300025906 Bacteria 3864
174 Ga0207645_10011031 3300025907 Bacteria 6184
175 Ga0207705_10195114 3300025909 Bacteria 1533
176 Ga0207693_10002173 3300025915 Bacteria 17096
177 Ga0207663_10013617 3300025916 Bacteria 4425
178 Ga0207662_10007411 3300025918 Bacteria 5973
179 Ga0207662_10017458 3300025918 Bacteria 4060
180 Ga0207657_10072767 3300025919 Bacteria 2906
181 Ga0207652_10001806 3300025921 Bacteria 18544
182 Ga0207681_10003723 3300025923 Bacteria 9478
183 Ga0207694_10505451 3300025924 Bacteria 1012
184 Ga0207659_10203763 3300025926 Bacteria 1582
185 Ga0207687_10019651 3300025927 Bacteria 4477
186 Ga0207687_10030335 3300025927 Bacteria 3645
187 Ga0207687_10110492 3300025927 Bacteria 2039
188 Ga0207687_10135336 3300025927 Bacteria 1863
189 Ga0207700_10113260 3300025928 Bacteria 2187
190 Ga0207664_10013850 3300025929 Bacteria 5807
191 Ga0207690_10019121 3300025932 Bacteria 4210
192 Ga0207690_10045121 3300025932 Bacteria 2910
193 Ga0207706_10002932 3300025933 Bacteria 16485
194 Ga0207706_10049707 3300025933 Bacteria 3705
195 Ga0207686_10003255 3300025934 Bacteria 8739
196 Ga0207709_10001833 3300025935 Bacteria 14176
197 Ga0207709_10117591 3300025935 Bacteria 1789
198 Ga0207670_10527087 3300025936 Bacteria 962
199 Ga0207669_10000720 3300025937 Bacteria 14321
200 Ga0207704_10001891 3300025938 Bacteria 9373
201 Ga0207704_10015500 3300025938 Bacteria 3886
202 Ga0207665_10001201 3300025939 Bacteria 17463
203 Ga0207691_10016370 3300025940 Bacteria 7039
204 Ga0207691_10145693 3300025940 Bacteria 2085
205 Ga0207711_10109034 3300025941 Bacteria 2460
206 Ga0207711_10258230 3300025941 Bacteria 1601
207 Ga0207661_10008926 3300025944 Bacteria 7180
208 Ga0207661_10013016 3300025944 Bacteria 6071
209 Ga0207661_10047503 3300025944 Bacteria 3408
210 Ga0207661_10093823 3300025944 Bacteria 2506
211 Ga0207661_10110241 3300025944 Bacteria 2326
212 Ga0207679_10030500 3300025945 Bacteria 3766
213 Ga0207667_10102225 3300025949 Bacteria 2956
214 Ga0207712_10005996 3300025961 Bacteria 7670
215 Ga0207668_10001945 3300025972 Bacteria 12107
216 Ga0207640_10014765 3300025981 Bacteria 4504
217 Ga0207658_10007194 3300025986 Bacteria 7588
218 Ga0207658_10014492 3300025986 Bacteria 5398
219 Ga0207677_10003405 3300026023 Bacteria 8428
220 Ga0207677_10077818 3300026023 Bacteria 2366
221 Ga0207703_10006972 3300026035 Bacteria 8995
222 Ga0207703_10121357 3300026035 Bacteria 2244
223 Ga0207639_10068629 3300026041 Bacteria 2763
224 Ga0207678_10008271 3300026067 Bacteria 9165
225 Ga0207678_10021113 3300026067 Bacteria 5706
226 Ga0207678_10183035 3300026067 Bacteria 1789
227 Ga0207708_10004491 3300026075 Bacteria 10277
228 Ga0207708_10022542 3300026075 Bacteria 4756
229 Ga0207648_10003448 3300026089 Bacteria 16587
230 Ga0207674_10013436 3300026116 Bacteria 9087
231 Ga0207675_100008624 3300026118 Bacteria 9586
232 Ga0207683_10002390 3300026121 Bacteria 16400
233 Ga0207683_10110974 3300026121 Bacteria 2455
234 Ga0207683_10224664 3300026121 Bacteria 1711
235 Ga0207683_10411908 3300026121 Bacteria 1244
236 Ga0207698_10025039 3300026142 Bacteria 4197
237 Ga0207428_10013868 3300027907 Bacteria 7020
238 Ga0207428_10054436 3300027907 Bacteria 3187
239 Ga0268266_10001442 3300028379 Bacteria 28308
240 Ga0268266_10001635 3300028379 Bacteria 26068
241 Ga0268265_10007297 3300028380 Bacteria 7466
242 Ga0268264_10000462 3300028381 Bacteria 55077
243 Ga0268264_10016161 3300028381 Bacteria 6113
244 Ga0316575_10027103 3300031665 Bacteria 2229
245 Ga0316576_10016068 3300031727 Bacteria 5045
246 Ga0316578_10030032 3300031728 Bacteria 3087
247 Ga0316578_10083523 3300031728 Bacteria 1902
248 Ga0316577_10241125 3300031733 Bacteria 1022
249 Ga0307413_10117285 3300031824 Bacteria 1795
250 Ga0307410_10025195 3300031852 Bacteria 3728
251 Ga0307410_10087567 3300031852 Bacteria 2203
252 Ga0307410_10546442 3300031852 Bacteria 959
253 Ga0307407_10076027 3300031903 Bacteria 2015
254 Ga0307409_100010540 3300031995 Bacteria 5755
255 Ga0307409_100897850 3300031995 Bacteria 899
256 Ga0307416_100109175 3300032002 Bacteria 2433
257 Ga0307416_100182608 3300032002 Bacteria 1968
258 Ga0307416_100315404 3300032002 Bacteria 1562
259 Ga0307416_100393140 3300032002 Bacteria 1421
260 Ga0307414_10534818 3300032004 Bacteria 1042
261 Ga0307411_10045263 3300032005 Bacteria 2830
262 Ga0307415_100027771 3300032126 Bacteria 3590
263 Ga0307415_100165563 3300032126 Bacteria 1718
264 Ga0316585_10021477 3300032137 Bacteria 1983
265 Ga0316574_0002209 3300035398 Bacteria 9676
266 Ga0316574_0014024 3300035398 Bacteria 4621
267 Ga0373931_0004469 3300035691 Bacteria 6392
268 Ga0316582_0016333 3300036647 Bacteria 4267
269 Ga0316584_0039301 3300036712 Bacteria 3522
270 Ga0395900_0045588 3300037418 Bacteria 4516
271 Ga0395900_0501324 3300037418 Bacteria 1164
272 Ga0395898_0253563 3300037466 Bacteria 1678
273 Ga0436364_0092506 3300037853 Bacteria 10642
274 Ga0395901_0006164 3300038443 Bacteria 12151
275 Ga0395901_0100709 3300038443 Bacteria 3031
276 Ga0395901_0130816 3300038443 Bacteria 2637
277 Ga0395901_0299201 3300038443 Bacteria 1668
278 Ga0436365_1871652 3300039437 Bacteria 4435
279 Ga0436363_0917578 3300039450 Bacteria 1155
280 Ga0451793_0537355 3300041452 Bacteria 1371
281 Ga0451797_0088653 3300041453 Bacteria 1285
282 Ga0451837_0709787 3300041494 Bacteria 1622
283 Ga0451837_1454732 3300041494 Bacteria 1228
284 Ga0451853_0179873 3300041512 Bacteria 7000
285 Ga0439450_000910 3300042008 Bacteria 4096
286 Ga0439454_000412 3300042011 Bacteria 3354
287 Ga0439463_020173 3300042016 Bacteria 1661
288 Ga0450888_001276 3300042126 Bacteria 2403
289 Ga0450904_001543 3300042139 Bacteria 3157
290 Ga0450889_001591 3300042144 Bacteria 2318
291 Ga0439460_0002451 3300042461 Bacteria 4474
292 Ga0450916_000357 3300042530 Bacteria 3795
293 Ga0466969_0018201 3300044656 Bacteria 3663
294 Ga0466965_0008194 3300044683 Bacteria 4826
295 Ga0466965_0061307 3300044683 Bacteria 1880
296 Ga0466965_0074636 3300044683 Bacteria 1709
297 Ga0466966_0084079 3300044684 Bacteria 1980
298 Ga0466966_0087224 3300044684 Bacteria 1940
299 Ga0466966_0124413 3300044684 Bacteria 1582
300 Ga0466961_0145864 3300044693 Bacteria 1480
301 Ga0466963_0003479 3300044694 Bacteria 9032
302 Ga0466963_0075207 3300044694 Bacteria 2279
303 Ga0466963_0119520 3300044694 Bacteria 1813
304 Ga0466964_0060710 3300044706 Bacteria 1573
305 Ga0466964_0079245 3300044706 Bacteria 1406
306 Ga0466968_0075906 3300044735 Bacteria 1470
307 Ga0466970_0002720 3300044765 Bacteria 8539
308 Ga0466970_0009584 3300044765 Bacteria 4899
309 Ga0466970_0035320 3300044765 Bacteria 2648
310 Ga0466970_0123636 3300044765 Bacteria 1418
311 Ga0466970_0313949 3300044765 Bacteria 885
312 Ga0466957_0020632 3300044842 Bacteria 3878
313 Ga0466957_0062442 3300044842 Bacteria 2288
314 Ga0466957_0269852 3300044842 Bacteria 1136
315 Ga0466957_0280022 3300044842 Bacteria 1116
316 Ga0466960_0101630 3300044901 Bacteria 1481
317 Ga0466960_0144302 3300044901 Bacteria 1267
318 Ga0466959_0009384 3300045049 Bacteria 6956
319 Ga0466959_0017068 3300045049 Bacteria 5315
320 Ga0466959_0080552 3300045049 Bacteria 2347
321 Ga0466958_0009007 3300045836 Bacteria 5543
322 Ga0466958_0011664 3300045836 Bacteria 4955
323 Ga0466967_0000277 3300045976 Bacteria 22703
324 Ga0466967_0002416 3300045976 Bacteria 11608
325 Ga0466967_0052332 3300045976 Bacteria 3583
326 Ga0466967_0224075 3300045976 Bacteria 1788
327 Ga0466967_0227487 3300045976 Bacteria 1775
328 Ga0466967_0267368 3300045976 Bacteria 1637
329 Ga0495664_0008832 3300046477 Bacteria 5630
330 Ga0495596_0023074 3300046500 Bacteria 2527
331 Ga0495607_0140362 3300046501 Bacteria 1247
332 Ga0495631_0034710 3300046518 Bacteria 2260
333 Ga0495644_0049187 3300046523 Bacteria 1583
334 Ga0495668_0041800 3300046616 Bacteria 2553
335 Ga0495589_0138460 3300046794 Bacteria 1167
336 Ga0495677_0029231 3300047445 Bacteria 2004
337 Ga0496100_0007952 3300048903 Bacteria 5891
338 Ga0496101_0001637 3300048904 Bacteria 13428
339 Ga0496101_0023201 3300048904 Bacteria 4283
340 Ga0496101_0110713 3300048904 Bacteria 2066
341 Ga0496101_0208195 3300048904 Bacteria 1514
342 Ga0496102_0013221 3300048905 Bacteria 7143
343 Ga0496102_0013670 3300048905 Bacteria 7035
344 Ga0496102_0031631 3300048905 Bacteria 4747
345 Ga0496102_0094242 3300048905 Bacteria 2774
346 Ga0496103_0003564 3300048906 Bacteria 9508
347 Ga0496103_0031498 3300048906 Bacteria 3231
348 Ga0496103_0191635 3300048906 Bacteria 1314
349 Ga0496104_0085371 3300048907 Bacteria 3013
350 Ga0496104_0139836 3300048907 Bacteria 2326
351 Ga0496105_0076039 3300048908 Bacteria 2773
352 Ga0496105_0146246 3300048908 Bacteria 1944
353 Ga0496105_0246426 3300048908 Bacteria 1449
354 Ga0496106_0002377 3300048909 Bacteria 14010
355 Ga0496106_0011429 3300048909 Bacteria 6568
356 Ga0496106_0110434 3300048909 Bacteria 2140
357 Ga0496106_0180421 3300048909 Bacteria 1676
358 Ga0496107_0005618 3300048910 Bacteria 8588
359 Ga0496107_0166724 3300048910 Bacteria 1633
360 Ga0496107_0179678 3300048910 Bacteria 1571
361 Ga0496108_0037963 3300048911 Bacteria 4013
362 Ga0496108_0084764 3300048911 Bacteria 2689
363 Ga0496109_0005488 3300048912 Bacteria 10614
364 Ga0496109_0009760 3300048912 Bacteria 8193
365 Ga0496109_0059381 3300048912 Bacteria 3493
366 Ga0496109_0230459 3300048912 Bacteria 1742
367 Ga0496110_0005180 3300048913 Bacteria 10196
368 Ga0496110_0027113 3300048913 Bacteria 4908
369 Ga0496111_0010465 3300048914 Bacteria 6226
370 Ga0496111_0224148 3300048914 Bacteria 1397
371 Ga0496112_0011188 3300048915 Bacteria 8183
372 Ga0496112_0185760 3300048915 Bacteria 2042
373 Ga0496113_0137719 3300048916 Bacteria 1919
374 Ga0496113_0174087 3300048916 Bacteria 1705
375 Ga0496114_0004158 3300048917 Bacteria 11197
376 Ga0496114_0014350 3300048917 Bacteria 6355
377 Ga0496114_0086425 3300048917 Bacteria 2658
378 Ga0496114_0454190 3300048917 Bacteria 1134
379 Ga0496115_0007933 3300048918 Bacteria 7833
380 Ga0496117_0003750 3300048920 Bacteria 17399
381 Ga0496117_0047283 3300048920 Bacteria 3087
382 Ga0496118_0002228 3300048921 Bacteria 26760
383 Ga0496119_0006062 3300048922 Bacteria 11328
384 Ga0496119_0117703 3300048922 Bacteria 1465
385 Ga0496120_0001095 3300048923 Bacteria 35373
386 Ga0496121_0008413 3300048924 Bacteria 12148
387 Ga0496121_0012885 3300048924 Bacteria 9045
388 Ga0496121_0048266 3300048924 Bacteria 3623
389 Ga0496125_0141808 3300048928 Bacteria 1669
390 Ga0501031_0005090 3300049568 Bacteria 8555
391 Ga0501031_0008373 3300049568 Bacteria 6724
392 Ga0501031_0040626 3300049568 Bacteria 3037
393 Ga0501032_0002074 3300049569 Bacteria 15823
394 Ga0501032_0012903 3300049569 Bacteria 5957
395 Ga0501032_0026746 3300049569 Bacteria 3966
396 Ga0501033_0000226 3300049570 Bacteria 54291
397 Ga0501033_0032898 3300049570 Bacteria 3893
398 Ga0501034_0012489 3300049571 Bacteria 8771
399 Ga0501034_0013729 3300049571 Bacteria 8332
400 Ga0501034_0028065 3300049571 Bacteria 5724
401 Ga0501034_0219830 3300049571 Bacteria 1852
402 Ga0501036_0000099 3300049572 Bacteria 54135
403 Ga0501036_0026528 3300049572 Bacteria 4891
404 Ga0501036_0076861 3300049572 Bacteria 2825
405 Ga0501036_0102425 3300049572 Bacteria 2422
406 Ga0501036_0206670 3300049572 Bacteria 1650
407 Ga0501036_0250061 3300049572 Bacteria 1486
408 Ga0501037_0000590 3300049573 Bacteria 28545
409 Ga0501037_0004539 3300049573 Bacteria 10094
410 Ga0501037_0038591 3300049573 Bacteria 3519
411 Ga0501037_0152423 3300049573 Bacteria 1651
412 Ga0501038_0000471 3300049574 Bacteria 35396
413 Ga0501038_0002860 3300049574 Bacteria 16077
414 Ga0501038_0005317 3300049574 Bacteria 11963
415 Ga0501038_0007841 3300049574 Bacteria 9842
416 Ga0501039_0001682 3300049575 Bacteria 16289
417 Ga0501039_0045419 3300049575 Bacteria 3394
418 Ga0501039_0075941 3300049575 Bacteria 2612
419 Ga0501039_0090351 3300049575 Bacteria 2387
420 Ga0501040_0118355 3300049576 Bacteria 1857
421 Ga0501041_0001577 3300049577 Bacteria 12692
422 Ga0501042_0005345 3300049578 Bacteria 8257
423 Ga0501042_0006187 3300049578 Bacteria 7768
424 Ga0501042_0011757 3300049578 Bacteria 5913
425 Ga0501042_0091794 3300049578 Bacteria 2180
426 Ga0501043_0000456 3300049579 Bacteria 36439
427 Ga0501043_0006124 3300049579 Bacteria 9660
428 Ga0501043_0024406 3300049579 Bacteria 4745
429 Ga0501043_0164887 3300049579 Bacteria 1730
430 Ga0501043_0288116 3300049579 Bacteria 1257
431 Ga0501046_0002889 3300049580 Bacteria 15933
432 Ga0501046_0012563 3300049580 Bacteria 7201
433 Ga0501046_0016486 3300049580 Bacteria 6186
434 Ga0501046_0017420 3300049580 Bacteria 5996
435 Ga0501047_0000548 3300049581 Bacteria 40558
436 Ga0501047_0004082 3300049581 Bacteria 13735
437 Ga0501047_0006490 3300049581 Bacteria 11007
438 Ga0501047_0080757 3300049581 Bacteria 3125
439 Ga0501048_0007225 3300049582 Bacteria 8425
440 Ga0501048_0022728 3300049582 Bacteria 4584
441 Ga0501048_0290634 3300049582 Bacteria 1162
442 Ga0501067_0015280 3300049583 Bacteria 4249
443 Ga0501067_0018426 3300049583 Bacteria 3867
444 Ga0501067_0019048 3300049583 Bacteria 3798
445 Ga0501068_0010174 3300049584 Bacteria 5279
446 Ga0501068_0015112 3300049584 Bacteria 4428
447 Ga0501068_0040122 3300049584 Bacteria 2809
448 Ga0501068_0256919 3300049584 Bacteria 1114
449 Ga0501068_0267143 3300049584 Bacteria 1092
450 Ga0501069_0005561 3300049585 Bacteria 6558
451 Ga0501069_0131987 3300049585 Bacteria 1430
452 Ga0501070_0000220 3300049586 Bacteria 54220
453 Ga0501070_0012952 3300049586 Bacteria 7028
454 Ga0501070_0038647 3300049586 Bacteria 3982
455 Ga0501070_0056839 3300049586 Bacteria 3244
456 Ga0501070_0132686 3300049586 Bacteria 2057
457 Ga0501071_0006682 3300049587 Bacteria 7496
458 Ga0501071_0016393 3300049587 Bacteria 5094
459 Ga0501071_0249584 3300049587 Bacteria 1339
460 Ga0501072_0007113 3300049588 Bacteria 8492
461 Ga0501072_0015945 3300049588 Bacteria 5761
462 Ga0501072_0070949 3300049588 Bacteria 2752
463 Ga0501072_0145712 3300049588 Bacteria 1888
464 Ga0501072_0164768 3300049588 Bacteria 1768
465 Ga0501072_0456642 3300049588 Bacteria 1011
466 Ga0501073_0001220 3300049589 Bacteria 18744
467 Ga0501073_0029543 3300049589 Bacteria 3916
468 Ga0501073_0034355 3300049589 Bacteria 3609
469 Ga0501074_0008628 3300049590 Bacteria 7381
470 Ga0501074_0012328 3300049590 Bacteria 6213
471 Ga0501074_0342420 3300049590 Bacteria 1061
472 Ga0501075_0127065 3300049591 Bacteria 1941
473 Ga0501075_0323333 3300049591 Bacteria 1175
474 Ga0501076_0029675 3300049592 Bacteria 4254
475 Ga0501077_0016778 3300049593 Bacteria 4618
476 Ga0501077_0090910 3300049593 Bacteria 1934
477 Ga0501202_017121 3300049652 Bacteria 1413
478 Ga0501079_0016656 3300049741 Bacteria 5614
479 Ga0501080_0006668 3300049742 Bacteria 10390
480 Ga0501080_0012460 3300049742 Bacteria 7795
481 Ga0501080_0015799 3300049742 Bacteria 6964
482 Ga0501080_0016637 3300049742 Bacteria 6793
483 Ga0501080_0211935 3300049742 Bacteria 1775
484 Ga0501083_0006808 3300049744 Bacteria 8112
485 Ga0501083_0032037 3300049744 Bacteria 3606
486 Ga0501035_0000341 3300049822 Bacteria 54138
487 Ga0501035_0021934 3300049822 Bacteria 5867
488 Ga0501035_0025384 3300049822 Bacteria 5433
489 Ga0501035_0029670 3300049822 Bacteria 4987
490 Ga0501044_0004112 3300049823 Bacteria 16318
491 Ga0501044_0017065 3300049823 Bacteria 7790
492 Ga0501044_0077263 3300049823 Bacteria 3377
493 Ga0501045_0005505 3300049824 Bacteria 8760
494 Ga0501045_0018624 3300049824 Bacteria 4941
495 Ga0501045_0061130 3300049824 Bacteria 2763
496 nmdc:mga03n38_54150_c1 3300050490 Bacteria 1802
497 nmdc:mga00v17_1324_c1 3300050491 Bacteria 12971
498 nmdc:mga00v17_158662_c1 3300050491 Bacteria 1455
499 nmdc:mga00v17_169776_c1 3300050491 Bacteria 1406
500 nmdc:mga00v17_46663_c1 3300050491 Bacteria 2622
501 nmdc:mga0yw44_10089_c1 3300050492 Bacteria 4809
502 nmdc:mga0yw44_102450_c1 3300050492 Bacteria 1825
503 nmdc:mga0yw44_19468_c1 3300050492 Bacteria 3745
504 nmdc:mga0yw44_23417_c1 3300050492 Bacteria 3479
505 nmdc:mga0yw44_269147_c1 3300050492 Bacteria 1137
506 nmdc:mga0yw44_54852_c1 3300050492 Bacteria 2424
507 nmdc:mga0yw44_75456_c1 3300050492 Bacteria 2102
508 nmdc:mga0yw44_795_c1 3300050492 Bacteria 11754
509 nmdc:mga06z11_160163_c1 3300050494 Bacteria 1286
510 nmdc:mga07m45_112300_c1 3300050496 Bacteria 1570
511 nmdc:mga07m45_311280_c1 3300050496 Bacteria 915
512 nmdc:mga05p37_241701_c1 3300050507 Bacteria 2171
513 nmdc:mga09592_7702_c1 3300050508 Bacteria 8751
514 nmdc:mga0qj67_11712_c1 3300050509 Bacteria 6582
515 nmdc:mga0qj67_44288_c1 3300050509 Bacteria 3506
516 nmdc:mga06r32_81068_c1 3300050510 Bacteria 3160
517 Ga0495601_0034461 3300053077 Bacteria 3159
518 Ga0500572_081222 3300053111 Bacteria 1016
519 Ga0500658_0147705 3300053134 Bacteria 1058
520 Ga0500573_0008115 3300053140 Bacteria 5774
521 Ga0500616_0008327 3300053153 Bacteria 6454
522 Ga0501084_0008503 3300054114 Bacteria 8486
523 Ga0501084_0014283 3300054114 Bacteria 6577
524 Ga0501084_0034944 3300054114 Bacteria 4203
525 Ga0501084_0042614 3300054114 Bacteria 3797
526 Ga0587066_030109 3300059490 Bacteria 962
527 Ga0587070_021489 3300059491 Bacteria 1090
528 Ga0587073_0002139 3300059492 Bacteria 2476
529 Ga0587073_0010989 3300059492 Bacteria 1535
530 Ga0587073_0028813 3300059492 Bacteria 1130
531 Ga0587080_009301 3300059503 Bacteria 1426
532 Ga0587082_005954 3300059504 Bacteria 1606
533 Ga0587082_012490 3300059504 Bacteria 1263
534 Ga0587083_0039976 3300059505 Bacteria 977
535 Ga0587086_002286 3300059507 Bacteria 1789
536 Ga0587086_015682 3300059507 Bacteria 981
537 Ga0587088_009085 3300059508 Bacteria 1422
538 Ga0587090_000593 3300059510 Bacteria 3125
539 Ga0587091_010351 3300059511 Bacteria 1425
540 Ga0587091_021555 3300059511 Bacteria 1130
541 Ga0587095_006594 3300059514 Bacteria 905
542 Ga0587106_000591 3300059605 Bacteria 2688
543 Ga0587115_002176 3300059626 Bacteria 1911
544 Ga0587128_021058 3300059630 Bacteria 1002
545 Ga0587069_005574 3300059642 Bacteria 1472
546 Ga0587072_003276 3300059643 Bacteria 2261
547 Ga0587075_012731 3300059644 Bacteria 1148
548 Ga0587076_003141 3300059645 Bacteria 1935
549 Ga0587078_003094 3300059646 Bacteria 1658
550 Ga0587079_002826 3300059647 Bacteria 2189
551 Ga0587079_041468 3300059647 Bacteria 931
552 Ga0587114_002489 3300059655 Bacteria 1722
553 Ga0587071_023939 3300060344 Bacteria 1137
554 Ga0501082_0024164 3300060353 Bacteria 5241
555 Ga0501082_0027688 3300060353 Bacteria 4878
556 Ga0501082_0167663 3300060353 Bacteria 1909
557 Ga0466962_0045006 3300061719 Bacteria 2110
558 Ga0530510_0015414 3300061734 Bacteria 5401
559 Ga0530510_0030456 3300061734 Bacteria 3875
560 Ga0530510_0149072 3300061734 Bacteria 1726
561 Ga0530510_0314662 3300061734 Bacteria 1173

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10017458 Ga0207662_100174582 248
2 3300048924 Ga0496121_0008413 Ga0496121_0008413_6042_6872 249
3 3300005530 Ga0070679_100467901 Ga0070679_1004679011 250
4 3300006028 Ga0070717_10156338 Ga0070717_101563382 250
5 3300020077 Ga0206351_10140874 Ga0206351_101408742 250
6 3300020080 Ga0206350_11056928 Ga0206350_110569281 250
7 3300020081 Ga0206354_10050827 Ga0206354_100508271 250
8 3300020610 Ga0154015_1573958 Ga0154015_15739582 250
9 3300022467 Ga0224712_10008296 Ga0224712_100082963 250
10 3300022467 Ga0224712_10008417 Ga0224712_100084171 250
11 3300045976 Ga0466967_0002416 Ga0466967_0002416_4673_5503 250
12 3300044656 Ga0466969_0018201 Ga0466969_0018201_1974_2864 251
13 3300044694 Ga0466963_0003479 Ga0466963_0003479_2610_3500 251
14 3300044694 Ga0466963_0119520 Ga0466963_0119520_845_1678 251
15 3300044735 Ga0466968_0075906 Ga0466968_0075906_224_1114 251
16 3300044765 Ga0466970_0123636 Ga0466970_0123636_494_1384 251
17 3300045049 Ga0466959_0009384 Ga0466959_0009384_3427_4317 251
18 3300045836 Ga0466958_0011664 Ga0466958_0011664_2269_3159 251
19 3300049568 Ga0501031_0040626 Ga0501031_0040626_531_1367 251
20 3300049569 Ga0501032_0012903 Ga0501032_0012903_1705_2541 251
21 3300049570 Ga0501033_0032898 Ga0501033_0032898_1033_1869 251
22 3300049571 Ga0501034_0219830 Ga0501034_0219830_701_1537 251
23 3300049572 Ga0501036_0206670 Ga0501036_0206670_753_1589 251
24 3300049573 Ga0501037_0152423 Ga0501037_0152423_754_1590 251
25 3300049574 Ga0501038_0005317 Ga0501038_0005317_7385_8221 251
26 3300049579 Ga0501043_0288116 Ga0501043_0288116_360_1196 251
27 3300049580 Ga0501046_0012563 Ga0501046_0012563_3807_4643 251
28 3300049581 Ga0501047_0080757 Ga0501047_0080757_404_1240 251
29 3300049582 Ga0501048_0022728 Ga0501048_0022728_3157_3993 251
30 3300049583 Ga0501067_0015280 Ga0501067_0015280_613_1449 251
31 3300049584 Ga0501068_0010174 Ga0501068_0010174_2750_3586 251
32 3300049585 Ga0501069_0131987 Ga0501069_0131987_357_1193 251
33 3300049586 Ga0501070_0012952 Ga0501070_0012952_3276_4112 251
34 3300049587 Ga0501071_0249584 Ga0501071_0249584_52_888 251
35 3300049588 Ga0501072_0070949 Ga0501072_0070949_393_1229 251
36 3300049589 Ga0501073_0034355 Ga0501073_0034355_1758_2594 251
37 3300049590 Ga0501074_0012328 Ga0501074_0012328_1043_1879 251
38 3300049742 Ga0501080_0006668 Ga0501080_0006668_3897_4733 251
39 3300049822 Ga0501035_0025384 Ga0501035_0025384_861_1697 251
40 3300049823 Ga0501044_0017065 Ga0501044_0017065_4281_5117 251
41 3300054114 Ga0501084_0014283 Ga0501084_0014283_2570_3406 251
42 3300059504 Ga0587082_012490 Ga0587082_012490_175_1059 251
43 3300060353 Ga0501082_0027688 Ga0501082_0027688_611_1447 251
44 3300009553 Ga0105249_10112826 Ga0105249_101128262 252
45 3300025944 Ga0207661_10093823 Ga0207661_100938233 252
46 3300037853 Ga0436364_0092506 Ga0436364_0092506_832_1662 252
47 3300039450 Ga0436363_0917578 Ga0436363_0917578_116_1015 252
48 3300044684 Ga0466966_0084079 Ga0466966_0084079_206_1039 252
49 3300044706 Ga0466964_0060710 Ga0466964_0060710_92_922 252
50 3300045049 Ga0466959_0017068 Ga0466959_0017068_2075_2905 252
51 3300045836 Ga0466958_0009007 Ga0466958_0009007_2221_3051 252
52 3300048915 Ga0496112_0011188 Ga0496112_0011188_3038_3865 252
53 3300048916 Ga0496113_0174087 Ga0496113_0174087_407_1234 252
54 3300061719 Ga0466962_0045006 Ga0466962_0045006_1095_1925 252
55 3300020080 Ga0206350_10894643 Ga0206350_108946433 253
56 3300022467 Ga0224712_10037096 Ga0224712_100370962 253
57 3300025904 Ga0207647_10077760 Ga0207647_100777602 253
58 3300044694 Ga0466963_0075207 Ga0466963_0075207_203_1090 253
59 3300045976 Ga0466967_0224075 Ga0466967_0224075_280_1167 253
60 3300048905 Ga0496102_0094242 Ga0496102_0094242_385_1269 253
61 3300005436 Ga0070713_100076272 Ga0070713_1000762722 254
62 3300006028 Ga0070717_10137861 Ga0070717_101378612 254
63 3300025928 Ga0207700_10113260 Ga0207700_101132602 254
64 3300025929 Ga0207664_10013850 Ga0207664_100138505 254
65 3300005435 Ga0070714_100015337 Ga0070714_1000153373 255
66 3300006028 Ga0070717_10015158 Ga0070717_100151582 255
67 3300037466 Ga0395898_0253563 Ga0395898_0253563_333_1223 255
68 3300044842 Ga0466957_0062442 Ga0466957_0062442_268_1098 255
69 3300005327 Ga0070658_10394635 Ga0070658_103946352 256
70 3300039437 Ga0436365_1871652 Ga0436365_1871652_21_905 256
71 3300044683 Ga0466965_0008194 Ga0466965_0008194_3634_4497 256
72 3300044765 Ga0466970_0002720 Ga0466970_0002720_717_1580 256
73 3300044842 Ga0466957_0020632 Ga0466957_0020632_522_1385 256
74 3300059490 Ga0587066_030109 Ga0587066_030109_16_867 257
75 3300059492 Ga0587073_0010989 Ga0587073_0010989_103_954 257
76 3300059505 Ga0587083_0039976 Ga0587083_0039976_31_882 257
77 3300059507 Ga0587086_015682 Ga0587086_015682_35_886 257
78 3300059508 Ga0587088_009085 Ga0587088_009085_240_1091 257
79 3300059510 Ga0587090_000593 Ga0587090_000593_15_866 257
80 3300059511 Ga0587091_021555 Ga0587091_021555_220_1071 257
81 3300059605 Ga0587106_000591 Ga0587106_000591_52_903 257
82 3300059645 Ga0587076_003141 Ga0587076_003141_998_1849 257
83 3300059646 Ga0587078_003094 Ga0587078_003094_443_1294 257
84 3300059655 Ga0587114_002489 Ga0587114_002489_329_1180 257
85 3300009101 Ga0105247_10087153 Ga0105247_100871532 258
86 3300009147 Ga0114129_10166783 Ga0114129_101667832 258
87 3300013308 Ga0157375_10047567 Ga0157375_100475674 258
88 3300026121 Ga0207683_10224664 Ga0207683_102246642 258
89 3300048904 Ga0496101_0110713 Ga0496101_0110713_915_1763 258
90 3300048905 Ga0496102_0013221 Ga0496102_0013221_3658_4506 258
91 3300048906 Ga0496103_0031498 Ga0496103_0031498_1723_2571 258
92 3300048909 Ga0496106_0011429 Ga0496106_0011429_4298_5146 258
93 3300048914 Ga0496111_0224148 Ga0496111_0224148_151_999 258
94 3300044842 Ga0466957_0269852 Ga0466957_0269852_180_1022 259
95 3300005329 Ga0070683_100091573 Ga0070683_1000915731 260
96 3300031852 Ga0307410_10087567 Ga0307410_100875672 261
97 3300031995 Ga0307409_100010540 Ga0307409_1000105405 261
98 3300032002 Ga0307416_100393140 Ga0307416_1003931402 261
99 3300032005 Ga0307411_10045263 Ga0307411_100452632 261
100 3300032126 Ga0307415_100027771 Ga0307415_1000277713 261
101 3300044684 Ga0466966_0124413 Ga0466966_0124413_529_1407 261
102 3300048908 Ga0496105_0076039 Ga0496105_0076039_298_1173 261
103 3300049586 Ga0501070_0056839 Ga0501070_0056839_738_1577 261
104 3300059492 Ga0587073_0028813 Ga0587073_0028813_130_1005 261
105 3300006038 Ga0075365_10017207 Ga0075365_100172075 262
106 3300010375 Ga0105239_10355278 Ga0105239_103552782 262
107 3300038443 Ga0395901_0130816 Ga0395901_0130816_54_887 262
108 3300049571 Ga0501034_0028065 Ga0501034_0028065_1965_2816 262
109 3300049575 Ga0501039_0090351 Ga0501039_0090351_289_1140 262
110 3300049583 Ga0501067_0018426 Ga0501067_0018426_2433_3284 262
111 3300049584 Ga0501068_0015112 Ga0501068_0015112_3440_4291 262
112 3300049587 Ga0501071_0006682 Ga0501071_0006682_573_1424 262
113 3300049588 Ga0501072_0164768 Ga0501072_0164768_789_1640 262
114 3300049589 Ga0501073_0001220 Ga0501073_0001220_71_922 262
115 3300049590 Ga0501074_0008628 Ga0501074_0008628_4102_4959 262
116 3300049593 Ga0501077_0090910 Ga0501077_0090910_743_1594 262
117 3300049742 Ga0501080_0015799 Ga0501080_0015799_5829_6680 262
118 3300050492 nmdc:mga0yw44_19468_c1 nmdc:mga0yw44_19468_c1_2655_3485 262
119 3300054114 Ga0501084_0008503 Ga0501084_0008503_5022_5873 262
120 3300059492 Ga0587073_0002139 Ga0587073_0002139_1541_2392 262
121 3300059507 Ga0587086_002286 Ga0587086_002286_264_1115 262
122 3300059644 Ga0587075_012731 Ga0587075_012731_93_944 262
123 3300059647 Ga0587079_041468 Ga0587079_041468_15_866 262
124 3300005329 Ga0070683_100033858 Ga0070683_1000338583 263
125 3300005337 Ga0070682_100074265 Ga0070682_1000742652 263
126 3300005338 Ga0068868_100275877 Ga0068868_1002758772 263
127 3300005366 Ga0070659_100103632 Ga0070659_1001036322 263
128 3300005456 Ga0070678_100349596 Ga0070678_1003495961 263
129 3300005466 Ga0070685_10140507 Ga0070685_101405072 263
130 3300005535 Ga0070684_100015891 Ga0070684_1000158916 263
131 3300005548 Ga0070665_100002666 Ga0070665_1000026664 263
132 3300005577 Ga0068857_100000819 Ga0068857_10000081923 263
133 3300006358 Ga0068871_100221906 Ga0068871_1002219062 263
134 3300009098 Ga0105245_10059711 Ga0105245_100597112 263
135 3300009177 Ga0105248_10112709 Ga0105248_101127091 263
136 3300010375 Ga0105239_10002575 Ga0105239_1000257511 263
137 3300011119 Ga0105246_10030583 Ga0105246_100305834 263
138 3300013306 Ga0163162_10188172 Ga0163162_101881722 263
139 3300013307 Ga0157372_10078862 Ga0157372_100788622 263
140 3300013308 Ga0157375_10448611 Ga0157375_104486112 263
141 3300014325 Ga0163163_10410426 Ga0163163_104104262 263
142 3300025900 Ga0207710_10138033 Ga0207710_101380332 263
143 3300025901 Ga0207688_10023746 Ga0207688_100237463 263
144 3300025927 Ga0207687_10019651 Ga0207687_100196513 263
145 3300025932 Ga0207690_10045121 Ga0207690_100451212 263
146 3300025938 Ga0207704_10015500 Ga0207704_100155004 263
147 3300025944 Ga0207661_10008926 Ga0207661_100089263 263
148 3300026035 Ga0207703_10121357 Ga0207703_101213572 263
149 3300026116 Ga0207674_10013436 Ga0207674_100134365 263
150 3300028379 Ga0268266_10001635 Ga0268266_1000163511 263
151 3300044683 Ga0466965_0061307 Ga0466965_0061307_605_1450 263
152 3300044765 Ga0466970_0009584 Ga0466970_0009584_414_1259 263
153 3300044901 Ga0466960_0144302 Ga0466960_0144302_56_901 263
154 3300048912 Ga0496109_0009760 Ga0496109_0009760_91_942 263
155 3300048913 Ga0496110_0005180 Ga0496110_0005180_3997_4848 263
156 3300048914 Ga0496111_0010465 Ga0496111_0010465_5164_6015 263
157 3300006038 Ga0075365_10017086 Ga0075365_100170862 264
158 3300006038 Ga0075365_10332158 Ga0075365_103321582 264
159 3300006051 Ga0075364_10010039 Ga0075364_100100394 264
160 3300006058 Ga0075432_10069707 Ga0075432_100697072 264
161 3300006178 Ga0075367_10130088 Ga0075367_101300882 264
162 3300006844 Ga0075428_100180884 Ga0075428_1001808842 264
163 3300006880 Ga0075429_100000888 Ga0075429_1000008883 264
164 3300009094 Ga0111539_10058482 Ga0111539_100584826 264
165 3300027907 Ga0207428_10054436 Ga0207428_100544363 264
166 3300031665 Ga0316575_10027103 Ga0316575_100271032 264
167 3300050491 nmdc:mga00v17_1324_c1 nmdc:mga00v17_1324_c1_817_1662 264
168 3300050492 nmdc:mga0yw44_269147_c1 nmdc:mga0yw44_269147_c1_289_1119 264
169 3300050492 nmdc:mga0yw44_54852_c1 nmdc:mga0yw44_54852_c1_713_1540 264
170 3300050494 nmdc:mga06z11_160163_c1 nmdc:mga06z11_160163_c1_85_915 264
171 3300050507 nmdc:mga05p37_241701_c1 nmdc:mga05p37_241701_c1_77_910 264
172 3300050508 nmdc:mga09592_7702_c1 nmdc:mga09592_7702_c1_4100_4933 264
173 3300050509 nmdc:mga0qj67_11712_c1 nmdc:mga0qj67_11712_c1_4274_5107 264
174 3300013102 Ga0157371_10394161 Ga0157371_103941611 265
175 3300026121 Ga0207683_10110974 Ga0207683_101109743 265
176 3300031903 Ga0307407_10076027 Ga0307407_100760272 265
177 3300044683 Ga0466965_0074636 Ga0466965_0074636_227_1093 265
178 3300044693 Ga0466961_0145864 Ga0466961_0145864_466_1344 265
179 3300044901 Ga0466960_0101630 Ga0466960_0101630_549_1427 265
180 3300005329 Ga0070683_100015687 Ga0070683_1000156874 266
181 3300005337 Ga0070682_100067443 Ga0070682_1000674432 266
182 3300005338 Ga0068868_100319860 Ga0068868_1003198602 266
183 3300005458 Ga0070681_10185544 Ga0070681_101855442 266
184 3300006038 Ga0075365_10049467 Ga0075365_100494673 266
185 3300009098 Ga0105245_10035148 Ga0105245_100351482 266
186 3300009098 Ga0105245_10112496 Ga0105245_101124962 266
187 3300009177 Ga0105248_10257854 Ga0105248_102578542 266
188 3300013308 Ga0157375_10383078 Ga0157375_103830782 266
189 3300014325 Ga0163163_10013478 Ga0163163_100134783 266
190 3300025924 Ga0207694_10505451 Ga0207694_105054512 266
191 3300025927 Ga0207687_10110492 Ga0207687_101104922 266
192 3300025927 Ga0207687_10135336 Ga0207687_101353362 266
193 3300025941 Ga0207711_10258230 Ga0207711_102582302 266
194 3300025944 Ga0207661_10047503 Ga0207661_100475033 266
195 3300025944 Ga0207661_10110241 Ga0207661_101102412 266
196 3300026023 Ga0207677_10077818 Ga0207677_100778182 266
197 3300048904 Ga0496101_0023201 Ga0496101_0023201_918_1748 266
198 3300048904 Ga0496101_0208195 Ga0496101_0208195_553_1383 266
199 3300048905 Ga0496102_0031631 Ga0496102_0031631_2005_2835 266
200 3300048907 Ga0496104_0085371 Ga0496104_0085371_1202_2032 266
201 3300048908 Ga0496105_0146246 Ga0496105_0146246_1088_1918 266
202 3300048909 Ga0496106_0110434 Ga0496106_0110434_121_951 266
203 3300048909 Ga0496106_0180421 Ga0496106_0180421_471_1301 266
204 3300048910 Ga0496107_0166724 Ga0496107_0166724_62_892 266
205 3300048911 Ga0496108_0084764 Ga0496108_0084764_515_1345 266
206 3300048912 Ga0496109_0059381 Ga0496109_0059381_1421_2251 266
207 3300048912 Ga0496109_0230459 Ga0496109_0230459_436_1266 266
208 3300048913 Ga0496110_0027113 Ga0496110_0027113_1670_2500 266
209 3300048915 Ga0496112_0185760 Ga0496112_0185760_225_1055 266
210 3300048916 Ga0496113_0137719 Ga0496113_0137719_931_1761 266
211 3300048917 Ga0496114_0014350 Ga0496114_0014350_546_1376 266
212 3300048917 Ga0496114_0086425 Ga0496114_0086425_1351_2181 266
213 3300049583 Ga0501067_0019048 Ga0501067_0019048_186_1016 266
214 3300050496 nmdc:mga07m45_112300_c1 nmdc:mga07m45_112300_c1_309_1142 266
215 3300061734 Ga0530510_0314662 Ga0530510_0314662_211_1041 266
216 iso_pu_bacteria 2675903058 2676477768 266
217 iso_pu_bacteria 2827628540 2827629091 266
218 3300031728 Ga0316578_10030032 Ga0316578_100300322 267
219 3300032137 Ga0316585_10021477 Ga0316585_100214772 267
220 3300035398 Ga0316574_0014024 Ga0316574_0014024_901_1731 267
221 3300036647 Ga0316582_0016333 Ga0316582_0016333_1117_1947 267
222 3300036712 Ga0316584_0039301 Ga0316584_0039301_2242_3072 267
223 3300049568 Ga0501031_0008373 Ga0501031_0008373_3201_4061 268
224 3300049573 Ga0501037_0038591 Ga0501037_0038591_327_1187 268
225 3300049575 Ga0501039_0001682 Ga0501039_0001682_8434_9294 268
226 3300049577 Ga0501041_0001577 Ga0501041_0001577_2758_3618 268
227 3300049578 Ga0501042_0005345 Ga0501042_0005345_4021_4881 268
228 3300049580 Ga0501046_0016486 Ga0501046_0016486_5111_5971 268
229 3300049582 Ga0501048_0290634 Ga0501048_0290634_139_999 268
230 3300049584 Ga0501068_0256919 Ga0501068_0256919_134_994 268
231 3300049587 Ga0501071_0016393 Ga0501071_0016393_80_940 268
232 3300049588 Ga0501072_0007113 Ga0501072_0007113_2612_3472 268
233 3300049591 Ga0501075_0127065 Ga0501075_0127065_550_1410 268
234 3300049592 Ga0501076_0029675 Ga0501076_0029675_1691_2551 268
235 3300049593 Ga0501077_0016778 Ga0501077_0016778_3198_4058 268
236 3300049824 Ga0501045_0005505 Ga0501045_0005505_3618_4478 268
237 3300054114 Ga0501084_0042614 Ga0501084_0042614_1344_2204 268
238 3300059514 Ga0587095_006594 Ga0587095_006594_40_891 268
239 3300059626 Ga0587115_002176 Ga0587115_002176_274_1125 268
240 3300059630 Ga0587128_021058 Ga0587128_021058_64_915 268
241 3300060344 Ga0587071_023939 Ga0587071_023939_103_954 268
242 3300061734 Ga0530510_0030456 Ga0530510_0030456_1143_2003 268
243 iso_pu_bacteria 2622736605 2623498163 269
244 iso_pu_bacteria 2643221561 2643823964 269
245 iso_pu_bacteria 2643221604 2644033266 269
246 iso_pu_bacteria 2643221617 2644098211 269
247 iso_pu_bacteria 2643221620 2644119061 269
248 iso_pu_bacteria 2643221696 2644533240 269
249 iso_pu_bacteria 2811994874 2812334446 269
250 iso_pu_bacteria 2855386786 2855389398 269
251 iso_pu_bacteria 2915358134 2915361862 269
252 3300005843 Ga0068860_100000408 Ga0068860_10000040835 270
253 3300006038 Ga0075365_10025770 Ga0075365_100257702 270
254 3300006051 Ga0075364_10007767 Ga0075364_100077672 270
255 3300028381 Ga0268264_10000462 Ga0268264_1000046216 270
256 3300049569 Ga0501032_0026746 Ga0501032_0026746_2907_3746 270
257 3300049571 Ga0501034_0013729 Ga0501034_0013729_4464_5303 270
258 3300049572 Ga0501036_0026528 Ga0501036_0026528_3994_4833 270
259 3300049573 Ga0501037_0004539 Ga0501037_0004539_7887_8726 270
260 3300049574 Ga0501038_0000471 Ga0501038_0000471_23980_24819 270
261 3300049574 Ga0501038_0007841 Ga0501038_0007841_5380_6219 270
262 3300049578 Ga0501042_0006187 Ga0501042_0006187_5420_6259 270
263 3300049578 Ga0501042_0091794 Ga0501042_0091794_56_895 270
264 3300049579 Ga0501043_0006124 Ga0501043_0006124_6296_7135 270
265 3300049579 Ga0501043_0024406 Ga0501043_0024406_2020_2859 270
266 3300049580 Ga0501046_0017420 Ga0501046_0017420_2587_3426 270
267 3300049581 Ga0501047_0004082 Ga0501047_0004082_5679_6518 270
268 3300049584 Ga0501068_0267143 Ga0501068_0267143_81_920 270
269 3300049586 Ga0501070_0038647 Ga0501070_0038647_2812_3651 270
270 3300049742 Ga0501080_0016637 Ga0501080_0016637_2813_3652 270
271 3300049822 Ga0501035_0021934 Ga0501035_0021934_2364_3203 270
272 3300049822 Ga0501035_0029670 Ga0501035_0029670_3259_4098 270
273 3300049823 Ga0501044_0077263 Ga0501044_0077263_676_1515 270
274 3300050491 nmdc:mga00v17_46663_c1 nmdc:mga00v17_46663_c1_634_1467 270
275 3300050492 nmdc:mga0yw44_10089_c1 nmdc:mga0yw44_10089_c1_583_1416 270
276 iso_pu_bacteria 2515154155 2515852849 270
277 iso_pu_bacteria 2744054611 2744953444 270
278 iso_pu_bacteria 2816332305 2817508264 270
279 iso_pu_bacteria 2857481737 2857483973 270
280 iso_pu_bacteria 2857727296 2857729175 270
281 3300005981 Ga0081538_10000099 Ga0081538_1000009937 271
282 3300005981 Ga0081538_10000252 Ga0081538_100002523 271
283 3300005981 Ga0081538_10019152 Ga0081538_100191523 271
284 3300005981 Ga0081538_10037561 Ga0081538_100375613 271
285 3300005981 Ga0081538_10037796 Ga0081538_100377963 271
286 3300005981 Ga0081538_10049339 Ga0081538_100493392 271
287 3300005981 Ga0081538_10096530 Ga0081538_100965302 271
288 3300013306 Ga0163162_10657106 Ga0163162_106571062 271
289 3300031852 Ga0307410_10025195 Ga0307410_100251953 271
290 3300031852 Ga0307410_10546442 Ga0307410_105464421 271
291 3300032002 Ga0307416_100315404 Ga0307416_1003154042 271
292 3300032126 Ga0307415_100165563 Ga0307415_1001655631 271
293 3300038443 Ga0395901_0006164 Ga0395901_0006164_6113_6946 271
294 3300044765 Ga0466970_0313949 Ga0466970_0313949_11_844 271
295 3300045976 Ga0466967_0227487 Ga0466967_0227487_92_925 271
296 3300046500 Ga0495596_0023074 Ga0495596_0023074_1077_1904 271
297 3300046501 Ga0495607_0140362 Ga0495607_0140362_61_888 271
298 3300046518 Ga0495631_0034710 Ga0495631_0034710_1263_2096 271
299 3300046523 Ga0495644_0049187 Ga0495644_0049187_409_1236 271
300 3300046616 Ga0495668_0041800 Ga0495668_0041800_1609_2442 271
301 3300047445 Ga0495677_0029231 Ga0495677_0029231_224_1057 271
302 3300048906 Ga0496103_0191635 Ga0496103_0191635_440_1279 271
303 3300048920 Ga0496117_0003750 Ga0496117_0003750_16211_17050 271
304 3300048920 Ga0496117_0047283 Ga0496117_0047283_748_1587 271
305 3300048921 Ga0496118_0002228 Ga0496118_0002228_5694_6533 271
306 3300048923 Ga0496120_0001095 Ga0496120_0001095_8130_8969 271
307 3300048924 Ga0496121_0048266 Ga0496121_0048266_345_1184 271
308 3300048928 Ga0496125_0141808 Ga0496125_0141808_502_1341 271
309 3300049572 Ga0501036_0102425 Ga0501036_0102425_1534_2367 271
310 3300049586 Ga0501070_0132686 Ga0501070_0132686_201_1040 271
311 3300049588 Ga0501072_0456642 Ga0501072_0456642_91_924 271
312 3300049652 Ga0501202_017121 Ga0501202_017121_301_1134 271
313 3300049744 Ga0501083_0032037 Ga0501083_0032037_363_1202 271
314 3300049824 Ga0501045_0018624 Ga0501045_0018624_290_1123 271
315 3300053111 Ga0500572_081222 Ga0500572_081222_33_872 271
316 3300053134 Ga0500658_0147705 Ga0500658_0147705_49_888 271
317 3300054114 Ga0501084_0034944 Ga0501084_0034944_2476_3309 271
318 3300061734 Ga0530510_0015414 Ga0530510_0015414_3160_3993 271
319 iso_pu_bacteria 2643221641 2644231027 271
320 iso_pu_bacteria 3002998708 3003008363 271
321 iso_pu_bacteria 8053945823 8053948303 271
322 iso_pu_bacteria 8054609563 8054610275 271
323 3300005367 Ga0070667_100021025 Ga0070667_1000210252 272
324 3300005530 Ga0070679_100001580 Ga0070679_10000158013 272
325 3300005535 Ga0070684_100451921 Ga0070684_1004519212 272
326 3300005985 Ga0081539_10079947 Ga0081539_100799472 272
327 3300006038 Ga0075365_10024565 Ga0075365_100245653 272
328 3300006038 Ga0075365_10045002 Ga0075365_100450021 272
329 3300006844 Ga0075428_100039164 Ga0075428_1000391642 272
330 3300006847 Ga0075431_100079606 Ga0075431_1000796062 272
331 3300009101 Ga0105247_10152885 Ga0105247_101528852 272
332 3300009147 Ga0114129_10142119 Ga0114129_101421192 272
333 3300010375 Ga0105239_10029888 Ga0105239_100298884 272
334 3300010375 Ga0105239_10343406 Ga0105239_103434062 272
335 3300013306 Ga0163162_10943039 Ga0163162_109430392 272
336 3300025921 Ga0207652_10001806 Ga0207652_1000180612 272
337 3300025944 Ga0207661_10013016 Ga0207661_100130164 272
338 3300025986 Ga0207658_10014492 Ga0207658_100144922 272
339 3300026067 Ga0207678_10008271 Ga0207678_100082717 272
340 3300027907 Ga0207428_10013868 Ga0207428_100138685 272
341 3300028379 Ga0268266_10001442 Ga0268266_1000144219 272
342 3300041494 Ga0451837_0709787 Ga0451837_0709787_366_1364 272
343 3300041512 Ga0451853_0179873 Ga0451853_0179873_316_1314 272
344 3300042008 Ga0439450_000910 Ga0439450_000910_251_1084 272
345 3300042011 Ga0439454_000412 Ga0439454_000412_2069_2902 272
346 3300042016 Ga0439463_020173 Ga0439463_020173_691_1524 272
347 3300042126 Ga0450888_001276 Ga0450888_001276_1183_2010 272
348 3300042139 Ga0450904_001543 Ga0450904_001543_647_1480 272
349 3300042144 Ga0450889_001591 Ga0450889_001591_1073_1906 272
350 3300042461 Ga0439460_0002451 Ga0439460_0002451_2761_3594 272
351 3300042530 Ga0450916_000357 Ga0450916_000357_2265_3098 272
352 3300046794 Ga0495589_0138460 Ga0495589_0138460_146_976 272
353 3300048907 Ga0496104_0139836 Ga0496104_0139836_1017_1859 272
354 3300048910 Ga0496107_0179678 Ga0496107_0179678_233_1075 272
355 3300048922 Ga0496119_0006062 Ga0496119_0006062_3250_4092 272
356 3300048924 Ga0496121_0012885 Ga0496121_0012885_4883_5725 272
357 3300049568 Ga0501031_0005090 Ga0501031_0005090_5730_6572 272
358 3300049569 Ga0501032_0002074 Ga0501032_0002074_1524_2366 272
359 3300049570 Ga0501033_0000226 Ga0501033_0000226_13449_14291 272
360 3300049571 Ga0501034_0012489 Ga0501034_0012489_7881_8723 272
361 3300049572 Ga0501036_0000099 Ga0501036_0000099_13455_14297 272
362 3300049573 Ga0501037_0000590 Ga0501037_0000590_1641_2483 272
363 3300049574 Ga0501038_0002860 Ga0501038_0002860_1778_2620 272
364 3300049575 Ga0501039_0075941 Ga0501039_0075941_351_1193 272
365 3300049576 Ga0501040_0118355 Ga0501040_0118355_639_1481 272
366 3300049578 Ga0501042_0011757 Ga0501042_0011757_395_1237 272
367 3300049579 Ga0501043_0000456 Ga0501043_0000456_22136_22978 272
368 3300049579 Ga0501043_0164887 Ga0501043_0164887_335_1177 272
369 3300049580 Ga0501046_0002889 Ga0501046_0002889_13462_14304 272
370 3300049581 Ga0501047_0000548 Ga0501047_0000548_19154_19996 272
371 3300049581 Ga0501047_0006490 Ga0501047_0006490_6583_7425 272
372 3300049582 Ga0501048_0007225 Ga0501048_0007225_5957_6799 272
373 3300049584 Ga0501068_0040122 Ga0501068_0040122_1336_2178 272
374 3300049585 Ga0501069_0005561 Ga0501069_0005561_1511_2353 272
375 3300049586 Ga0501070_0000220 Ga0501070_0000220_39858_40700 272
376 3300049588 Ga0501072_0015945 Ga0501072_0015945_3750_4601 272
377 3300049589 Ga0501073_0029543 Ga0501073_0029543_1460_2302 272
378 3300049741 Ga0501079_0016656 Ga0501079_0016656_3846_4688 272
379 3300049742 Ga0501080_0012460 Ga0501080_0012460_1457_2299 272
380 3300049742 Ga0501080_0211935 Ga0501080_0211935_337_1188 272
381 3300049744 Ga0501083_0006808 Ga0501083_0006808_5869_6711 272
382 3300049822 Ga0501035_0000341 Ga0501035_0000341_39809_40651 272
383 3300049823 Ga0501044_0004112 Ga0501044_0004112_13499_14341 272
384 3300050491 nmdc:mga00v17_158662_c1 nmdc:mga00v17_158662_c1_456_1298 272
385 3300050492 nmdc:mga0yw44_102450_c1 nmdc:mga0yw44_102450_c1_972_1814 272
386 3300050509 nmdc:mga0qj67_44288_c1 nmdc:mga0qj67_44288_c1_1092_1931 272
387 3300050510 nmdc:mga06r32_81068_c1 nmdc:mga06r32_81068_c1_1489_2328 272
388 3300059504 Ga0587082_005954 Ga0587082_005954_375_1223 272
389 3300060353 Ga0501082_0024164 Ga0501082_0024164_2777_3619 272
390 3300060353 Ga0501082_0167663 Ga0501082_0167663_42_893 272
391 iso_pu_bacteria 2643221961 2645722985 272
392 3300006048 Ga0075363_100049876 Ga0075363_1000498762 273
393 3300006051 Ga0075364_10044043 Ga0075364_100440432 273
394 3300006178 Ga0075367_10048383 Ga0075367_100483832 273
395 3300031824 Ga0307413_10117285 Ga0307413_101172852 273
396 3300031995 Ga0307409_100897850 Ga0307409_1008978501 273
397 3300032002 Ga0307416_100109175 Ga0307416_1001091752 273
398 3300032002 Ga0307416_100182608 Ga0307416_1001826082 273
399 3300032004 Ga0307414_10534818 Ga0307414_105348182 273
400 3300037418 Ga0395900_0045588 Ga0395900_0045588_1024_1857 273
401 3300038443 Ga0395901_0299201 Ga0395901_0299201_169_1002 273
402 3300041494 Ga0451837_1454732 Ga0451837_1454732_133_996 273
403 3300044706 Ga0466964_0079245 Ga0466964_0079245_30_881 273
404 3300044765 Ga0466970_0035320 Ga0466970_0035320_758_1633 273
405 3300045976 Ga0466967_0052332 Ga0466967_0052332_63_914 273
406 3300045976 Ga0466967_0267368 Ga0466967_0267368_101_952 273
407 3300046477 Ga0495664_0008832 Ga0495664_0008832_3203_4033 273
408 3300048908 Ga0496105_0246426 Ga0496105_0246426_551_1399 273
409 3300048912 Ga0496109_0005488 Ga0496109_0005488_7363_8211 273
410 3300049572 Ga0501036_0076861 Ga0501036_0076861_10_840 273
411 3300049572 Ga0501036_0250061 Ga0501036_0250061_352_1182 273
412 3300049575 Ga0501039_0045419 Ga0501039_0045419_1086_1916 273
413 3300049588 Ga0501072_0145712 Ga0501072_0145712_125_955 273
414 3300049824 Ga0501045_0061130 Ga0501045_0061130_479_1309 273
415 3300050490 nmdc:mga03n38_54150_c1 nmdc:mga03n38_54150_c1_26_856 273
416 3300050491 nmdc:mga00v17_169776_c1 nmdc:mga00v17_169776_c1_303_1136 273
417 3300050492 nmdc:mga0yw44_23417_c1 nmdc:mga0yw44_23417_c1_355_1185 273
418 3300050492 nmdc:mga0yw44_795_c1 nmdc:mga0yw44_795_c1_4214_5047 273
419 3300053077 Ga0495601_0034461 Ga0495601_0034461_970_1800 273
420 3300053140 Ga0500573_0008115 Ga0500573_0008115_1242_2075 273
421 3300059491 Ga0587070_021489 Ga0587070_021489_17_868 273
422 3300059503 Ga0587080_009301 Ga0587080_009301_482_1333 273
423 3300059511 Ga0587091_010351 Ga0587091_010351_435_1286 273
424 3300059642 Ga0587069_005574 Ga0587069_005574_39_896 273
425 3300059643 Ga0587072_003276 Ga0587072_003276_110_967 273
426 3300059647 Ga0587079_002826 Ga0587079_002826_957_1814 273
427 iso_pu_bacteria 2643221576 2643890221 273
428 iso_pu_bacteria 2643221590 2643959277 273
429 iso_pu_bacteria 2643221657 2644323059 273
430 iso_pu_bacteria 2643221681 2644458111 273
431 iso_pu_bacteria 2643221687 2644486896 273
432 iso_pu_bacteria 2643221962 2645725940 273
433 iso_pu_bacteria 2739367898 2740166364 273
434 iso_pu_bacteria 2902837492 2902841789 273
435 iso_pu_bacteria 2984592036 2984594170 273
436 iso_pu_bacteria 2990256926 2990257361 273
437 3300002077 JGI24744J21845_10000078 JGI24744J21845_100000789 274
438 3300002244 JGI24742J22300_10000523 JGI24742J22300_100005234 274
439 3300003792 Ga0055540_1029007 Ga0055540_10290072 274
440 3300003792 Ga0055540_1044808 Ga0055540_10448081 274
441 3300005328 Ga0070676_10002380 Ga0070676_100023805 274
442 3300005330 Ga0070690_100006999 Ga0070690_1000069995 274
443 3300005335 Ga0070666_10022138 Ga0070666_100221382 274
444 3300005337 Ga0070682_100057891 Ga0070682_1000578912 274
445 3300005338 Ga0068868_100018801 Ga0068868_1000188014 274
446 3300005340 Ga0070689_100003899 Ga0070689_1000038996 274
447 3300005341 Ga0070691_10002225 Ga0070691_100022255 274
448 3300005343 Ga0070687_100030099 Ga0070687_1000300992 274
449 3300005345 Ga0070692_10039994 Ga0070692_100399943 274
450 3300005347 Ga0070668_100009628 Ga0070668_1000096284 274
451 3300005353 Ga0070669_100003754 Ga0070669_1000037542 274
452 3300005356 Ga0070674_100002737 Ga0070674_1000027376 274
453 3300005366 Ga0070659_100142478 Ga0070659_1001424781 274
454 3300005367 Ga0070667_100008109 Ga0070667_1000081095 274
455 3300005406 Ga0070703_10009690 Ga0070703_100096902 274
456 3300005434 Ga0070709_10005377 Ga0070709_100053773 274
457 3300005437 Ga0070710_10001581 Ga0070710_100015816 274
458 3300005438 Ga0070701_10000838 Ga0070701_100008385 274
459 3300005439 Ga0070711_100001170 Ga0070711_1000011705 274
460 3300005440 Ga0070705_100009208 Ga0070705_1000092085 274
461 3300005441 Ga0070700_100002020 Ga0070700_1000020205 274
462 3300005444 Ga0070694_100002677 Ga0070694_1000026775 274
463 3300005455 Ga0070663_100006355 Ga0070663_1000063555 274
464 3300005456 Ga0070678_100001750 Ga0070678_1000017507 274
465 3300005457 Ga0070662_100001556 Ga0070662_1000015569 274
466 3300005459 Ga0068867_100001095 Ga0068867_1000010955 274
467 3300005539 Ga0068853_100009119 Ga0068853_1000091196 274
468 3300005543 Ga0070672_100388643 Ga0070672_1003886432 274
469 3300005545 Ga0070695_100009155 Ga0070695_1000091555 274
470 3300005546 Ga0070696_100001977 Ga0070696_1000019774 274
471 3300005548 Ga0070665_100053510 Ga0070665_1000535101 274
472 3300005549 Ga0070704_100025332 Ga0070704_1000253323 274
473 3300005563 Ga0068855_100013782 Ga0068855_1000137824 274
474 3300005578 Ga0068854_100001489 Ga0068854_10000148910 274
475 3300005614 Ga0068856_100160954 Ga0068856_1001609542 274
476 3300005615 Ga0070702_100001146 Ga0070702_1000011465 274
477 3300005615 Ga0070702_100057973 Ga0070702_1000579731 274
478 3300005616 Ga0068852_100045801 Ga0068852_1000458013 274
479 3300005616 Ga0068852_100394343 Ga0068852_1003943432 274
480 3300005617 Ga0068859_100005669 Ga0068859_1000056699 274
481 3300005718 Ga0068866_10001545 Ga0068866_100015456 274
482 3300005719 Ga0068861_100005782 Ga0068861_1000057825 274
483 3300005842 Ga0068858_100007701 Ga0068858_1000077015 274
484 3300005843 Ga0068860_100004270 Ga0068860_1000042707 274
485 3300005844 Ga0068862_100024677 Ga0068862_1000246771 274
486 3300006163 Ga0070715_10001041 Ga0070715_100010414 274
487 3300006173 Ga0070716_100008509 Ga0070716_1000085094 274
488 3300006175 Ga0070712_100000937 Ga0070712_1000009375 274
489 3300006881 Ga0068865_100003697 Ga0068865_1000036975 274
490 3300006881 Ga0068865_100259268 Ga0068865_1002592682 274
491 3300006931 Ga0097620_100005669 Ga0097620_1000056699 274
492 3300009092 Ga0105250_10037625 Ga0105250_100376252 274
493 3300009093 Ga0105240_10849346 Ga0105240_108493461 274
494 3300009098 Ga0105245_10011878 Ga0105245_100118783 274
495 3300009101 Ga0105247_10001851 Ga0105247_100018515 274
496 3300009148 Ga0105243_10014535 Ga0105243_100145355 274
497 3300009176 Ga0105242_10003909 Ga0105242_100039096 274
498 3300009545 Ga0105237_10023851 Ga0105237_100238513 274
499 3300009551 Ga0105238_10142663 Ga0105238_101426632 274
500 3300009553 Ga0105249_10006429 Ga0105249_100064297 274
501 3300010375 Ga0105239_10016028 Ga0105239_100160284 274
502 3300013105 Ga0157369_10030343 Ga0157369_100303433 274
503 3300013297 Ga0157378_10003234 Ga0157378_100032345 274
504 3300013306 Ga0163162_10010330 Ga0163162_100103304 274
505 3300013307 Ga0157372_10003899 Ga0157372_100038994 274
506 3300013308 Ga0157375_10002098 Ga0157375_1000209813 274
507 3300014326 Ga0157380_10003529 Ga0157380_100035296 274
508 3300014968 Ga0157379_10038287 Ga0157379_100382874 274
509 3300017792 Ga0163161_10005680 Ga0163161_100056806 274
510 3300017792 Ga0163161_10009991 Ga0163161_100099912 274
511 3300025303 Ga0209051_1003121 Ga0209051_10031212 274
512 3300025303 Ga0209051_1003771 Ga0209051_10037712 274
513 3300025303 Ga0209051_1032521 Ga0209051_10325212 274
514 3300025885 Ga0207653_10006916 Ga0207653_100069162 274
515 3300025898 Ga0207692_10001621 Ga0207692_100016214 274
516 3300025899 Ga0207642_10001089 Ga0207642_100010894 274
517 3300025901 Ga0207688_10001131 Ga0207688_100011318 274
518 3300025901 Ga0207688_10101463 Ga0207688_101014632 274
519 3300025904 Ga0207647_10070388 Ga0207647_100703882 274
520 3300025906 Ga0207699_10016517 Ga0207699_100165173 274
521 3300025907 Ga0207645_10011031 Ga0207645_100110315 274
522 3300025909 Ga0207705_10195114 Ga0207705_101951142 274
523 3300025915 Ga0207693_10002173 Ga0207693_100021735 274
524 3300025916 Ga0207663_10013617 Ga0207663_100136172 274
525 3300025918 Ga0207662_10007411 Ga0207662_100074114 274
526 3300025919 Ga0207657_10072767 Ga0207657_100727673 274
527 3300025923 Ga0207681_10003723 Ga0207681_100037234 274
528 3300025926 Ga0207659_10203763 Ga0207659_102037632 274
529 3300025927 Ga0207687_10030335 Ga0207687_100303352 274
530 3300025932 Ga0207690_10019121 Ga0207690_100191212 274
531 3300025933 Ga0207706_10002932 Ga0207706_100029328 274
532 3300025933 Ga0207706_10049707 Ga0207706_100497073 274
533 3300025934 Ga0207686_10003255 Ga0207686_100032555 274
534 3300025935 Ga0207709_10001833 Ga0207709_100018336 274
535 3300025935 Ga0207709_10117591 Ga0207709_101175912 274
536 3300025936 Ga0207670_10527087 Ga0207670_105270871 274
537 3300025937 Ga0207669_10000720 Ga0207669_100007205 274
538 3300025938 Ga0207704_10001891 Ga0207704_100018915 274
539 3300025939 Ga0207665_10001201 Ga0207665_100012015 274
540 3300025940 Ga0207691_10016370 Ga0207691_100163704 274
541 3300025940 Ga0207691_10145693 Ga0207691_101456932 274
542 3300025941 Ga0207711_10109034 Ga0207711_101090342 274
543 3300025945 Ga0207679_10030500 Ga0207679_100305003 274
544 3300025949 Ga0207667_10102225 Ga0207667_101022253 274
545 3300025961 Ga0207712_10005996 Ga0207712_100059964 274
546 3300025972 Ga0207668_10001945 Ga0207668_100019453 274
547 3300025981 Ga0207640_10014765 Ga0207640_100147655 274
548 3300025986 Ga0207658_10007194 Ga0207658_100071945 274
549 3300026023 Ga0207677_10003405 Ga0207677_100034054 274
550 3300026035 Ga0207703_10006972 Ga0207703_100069724 274
551 3300026041 Ga0207639_10068629 Ga0207639_100686292 274
552 3300026067 Ga0207678_10021113 Ga0207678_100211135 274
553 3300026067 Ga0207678_10183035 Ga0207678_101830352 274
554 3300026075 Ga0207708_10004491 Ga0207708_100044914 274
555 3300026075 Ga0207708_10022542 Ga0207708_100225423 274
556 3300026089 Ga0207648_10003448 Ga0207648_1000344812 274
557 3300026118 Ga0207675_100008624 Ga0207675_1000086245 274
558 3300026121 Ga0207683_10002390 Ga0207683_100023905 274
559 3300026121 Ga0207683_10411908 Ga0207683_104119082 274
560 3300026142 Ga0207698_10025039 Ga0207698_100250393 274
561 3300028380 Ga0268265_10007297 Ga0268265_100072975 274
562 3300028381 Ga0268264_10016161 Ga0268264_100161614 274
563 3300031727 Ga0316576_10016068 Ga0316576_100160683 274
564 3300031728 Ga0316578_10083523 Ga0316578_100835231 274
565 3300031733 Ga0316577_10241125 Ga0316577_102411252 274
566 3300035398 Ga0316574_0002209 Ga0316574_0002209_3615_4439 274
567 3300035691 Ga0373931_0004469 Ga0373931_0004469_3113_3937 274
568 3300037418 Ga0395900_0501324 Ga0395900_0501324_152_985 274
569 3300038443 Ga0395901_0100709 Ga0395901_0100709_245_1078 274
570 3300041452 Ga0451793_0537355 Ga0451793_0537355_265_1098 274
571 3300041453 Ga0451797_0088653 Ga0451797_0088653_62_886 274
572 3300044684 Ga0466966_0087224 Ga0466966_0087224_1055_1888 274
573 3300044842 Ga0466957_0280022 Ga0466957_0280022_162_995 274
574 3300045049 Ga0466959_0080552 Ga0466959_0080552_843_1676 274
575 3300045976 Ga0466967_0000277 Ga0466967_0000277_18882_19715 274
576 3300048903 Ga0496100_0007952 Ga0496100_0007952_2523_3347 274
577 3300048904 Ga0496101_0001637 Ga0496101_0001637_3253_4077 274
578 3300048905 Ga0496102_0013670 Ga0496102_0013670_4773_5597 274
579 3300048906 Ga0496103_0003564 Ga0496103_0003564_2534_3358 274
580 3300048909 Ga0496106_0002377 Ga0496106_0002377_3449_4273 274
581 3300048910 Ga0496107_0005618 Ga0496107_0005618_4392_5216 274
582 3300048911 Ga0496108_0037963 Ga0496108_0037963_657_1490 274
583 3300048917 Ga0496114_0004158 Ga0496114_0004158_3549_4373 274
584 3300048917 Ga0496114_0454190 Ga0496114_0454190_217_1050 274
585 3300048918 Ga0496115_0007933 Ga0496115_0007933_3814_4638 274
586 3300048922 Ga0496119_0117703 Ga0496119_0117703_187_1020 274
587 3300049590 Ga0501074_0342420 Ga0501074_0342420_86_919 274
588 3300049591 Ga0501075_0323333 Ga0501075_0323333_17_844 274
589 3300050492 nmdc:mga0yw44_75456_c1 nmdc:mga0yw44_75456_c1_1156_2022 274
590 3300050496 nmdc:mga07m45_311280_c1 nmdc:mga07m45_311280_c1_31_864 274
591 3300053153 Ga0500616_0008327 Ga0500616_0008327_1517_2350 274
592 3300061734 Ga0530510_0149072 Ga0530510_0149072_773_1600 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

323

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.9237 2 265
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.9105 2 265
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.893 1 270
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.8881 2 258
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8807 1 270
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9219 3 264 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9205 4 264 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9105 4 264 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9024 2 260 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9011 3 264 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A562DLR8-F1-model_v4 Multiple sugar transport system permease protein 0.965 2 244 GO:0005886
GO:0055085
AF-A0A836RFT6-F1-model_v4 Carbohydrate ABC transporter permease 0.9493 1 253 GO:0005886
GO:0055085
AF-A0A0R2Q3N9-F1-model_v4 Sugar ABC transporter permease 0.9476 2 240 GO:0005886
GO:0055085
AF-A0A7Y0L3M8-F1-model_v4 Carbohydrate ABC transporter permease 0.9469 1 274 GO:0005886
GO:0055085
AF-A0A6I7P3W8-F1-model_v4 Carbohydrate ABC transporter permease 0.9469 16 259 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map