F467151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 592 | 335 | 561 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300041494|Ga0451837_0709787|Ga0451837_0709787_366_1364 |
| Length | 332 |
| Sequence | MSPRRKSRMLWSFVSIAIGLIFAGAGLWLIERPDLWLWLITGTVFVLTGAVGLLMGEKAPQISWGSIVGAELIVLYTLTPVVYLVSLSLKGGNADVNQGGFLPQDPGFDNYKTVFKFDLFQSALVNSFGISIISTTISVVLATFAAYAIARLRFRGKKFVLSMALAIAMFPVVALVGPLFDMWRAIGIYDTWLGLIIPYLSFTLPMSIWVLSAFFREIPWEMEQAAEVDGATAWQAFRKVIVPLAAPGVFTAAIITFFFAWNDFVFGISLTSTTRAIPVPASLAFFTGASQFDQPIAAIAAASVXXXVPIFIIVLLFQRKIVSGLTSGAVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 5 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 6 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 7 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 8 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 9 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 10 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 11 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 12 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 13 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 14 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 15 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 16 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 17 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 18 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 19 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 20 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 21 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 22 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 23 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 24 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 25 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 26 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 27 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 28 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 29 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 30 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 31 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 184 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 213 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 214 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 215 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 334 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 335 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.68 |
| Metatranscriptomes | 6.08 |
| Isolates | 5.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 6.42 |
| Nodule | 0.17 |
| Rhizoplane | 7.6 |
| Rhizosphere | 79.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10000078 | 3300002077 | Bacteria | 12370 |
| 2 | JGI24742J22300_10000523 | 3300002244 | Bacteria | 5732 |
| 3 | Ga0055540_1029007 | 3300003792 | Bacteria | 1300 |
| 4 | Ga0055540_1044808 | 3300003792 | Bacteria | 937 |
| 5 | Ga0070658_10394635 | 3300005327 | Bacteria | 1188 |
| 6 | Ga0070676_10002380 | 3300005328 | Bacteria | 9627 |
| 7 | Ga0070683_100015687 | 3300005329 | Bacteria | 6661 |
| 8 | Ga0070683_100033858 | 3300005329 | Bacteria | 4662 |
| 9 | Ga0070683_100091573 | 3300005329 | Bacteria | 2855 |
| 10 | Ga0070690_100006999 | 3300005330 | Bacteria | 6429 |
| 11 | Ga0070666_10022138 | 3300005335 | Bacteria | 4125 |
| 12 | Ga0070682_100057891 | 3300005337 | Bacteria | 2443 |
| 13 | Ga0070682_100067443 | 3300005337 | Bacteria | 2279 |
| 14 | Ga0070682_100074265 | 3300005337 | Bacteria | 2183 |
| 15 | Ga0068868_100018801 | 3300005338 | Bacteria | 5169 |
| 16 | Ga0068868_100275877 | 3300005338 | Bacteria | 1421 |
| 17 | Ga0068868_100319860 | 3300005338 | Bacteria | 1322 |
| 18 | Ga0070689_100003899 | 3300005340 | Bacteria | 9997 |
| 19 | Ga0070691_10002225 | 3300005341 | Bacteria | 8580 |
| 20 | Ga0070687_100030099 | 3300005343 | Bacteria | 2651 |
| 21 | Ga0070692_10039994 | 3300005345 | Bacteria | 2396 |
| 22 | Ga0070668_100009628 | 3300005347 | Bacteria | 7169 |
| 23 | Ga0070669_100003754 | 3300005353 | Bacteria | 10972 |
| 24 | Ga0070674_100002737 | 3300005356 | Bacteria | 9747 |
| 25 | Ga0070659_100103632 | 3300005366 | Bacteria | 2292 |
| 26 | Ga0070659_100142478 | 3300005366 | Bacteria | 1952 |
| 27 | Ga0070667_100008109 | 3300005367 | Bacteria | 8711 |
| 28 | Ga0070667_100021025 | 3300005367 | Bacteria | 5422 |
| 29 | Ga0070703_10009690 | 3300005406 | Bacteria | 2718 |
| 30 | Ga0070709_10005377 | 3300005434 | Bacteria | 6935 |
| 31 | Ga0070714_100015337 | 3300005435 | Bacteria | 6165 |
| 32 | Ga0070713_100076272 | 3300005436 | Bacteria | 2846 |
| 33 | Ga0070710_10001581 | 3300005437 | Bacteria | 10748 |
| 34 | Ga0070701_10000838 | 3300005438 | Bacteria | 11018 |
| 35 | Ga0070711_100001170 | 3300005439 | Bacteria | 14108 |
| 36 | Ga0070705_100009208 | 3300005440 | Bacteria | 4904 |
| 37 | Ga0070700_100002020 | 3300005441 | Bacteria | 10306 |
| 38 | Ga0070694_100002677 | 3300005444 | Bacteria | 10554 |
| 39 | Ga0070663_100006355 | 3300005455 | Bacteria | 7096 |
| 40 | Ga0070678_100001750 | 3300005456 | Bacteria | 11677 |
| 41 | Ga0070678_100349596 | 3300005456 | Bacteria | 1271 |
| 42 | Ga0070662_100001556 | 3300005457 | Bacteria | 14166 |
| 43 | Ga0070681_10185544 | 3300005458 | Bacteria | 2000 |
| 44 | Ga0068867_100001095 | 3300005459 | Bacteria | 18493 |
| 45 | Ga0070685_10140507 | 3300005466 | Bacteria | 1520 |
| 46 | Ga0070679_100001580 | 3300005530 | Bacteria | 20414 |
| 47 | Ga0070679_100467901 | 3300005530 | Bacteria | 1205 |
| 48 | Ga0070684_100015891 | 3300005535 | Bacteria | 6143 |
| 49 | Ga0070684_100451921 | 3300005535 | Bacteria | 1188 |
| 50 | Ga0068853_100009119 | 3300005539 | Bacteria | 7991 |
| 51 | Ga0070672_100388643 | 3300005543 | Bacteria | 1194 |
| 52 | Ga0070695_100009155 | 3300005545 | Bacteria | 5888 |
| 53 | Ga0070696_100001977 | 3300005546 | Bacteria | 13461 |
| 54 | Ga0070665_100002666 | 3300005548 | Bacteria | 19405 |
| 55 | Ga0070665_100053510 | 3300005548 | Bacteria | 4048 |
| 56 | Ga0070704_100025332 | 3300005549 | Bacteria | 3904 |
| 57 | Ga0068855_100013782 | 3300005563 | Bacteria | 9746 |
| 58 | Ga0068857_100000819 | 3300005577 | Bacteria | 23265 |
| 59 | Ga0068854_100001489 | 3300005578 | Bacteria | 14174 |
| 60 | Ga0068856_100160954 | 3300005614 | Bacteria | 2255 |
| 61 | Ga0070702_100001146 | 3300005615 | Bacteria | 10651 |
| 62 | Ga0070702_100057973 | 3300005615 | Bacteria | 2241 |
| 63 | Ga0068852_100045801 | 3300005616 | Bacteria | 3723 |
| 64 | Ga0068852_100394343 | 3300005616 | Bacteria | 1360 |
| 65 | Ga0068859_100005669 | 3300005617 | Bacteria | 12711 |
| 66 | Ga0068866_10001545 | 3300005718 | Bacteria | 9773 |
| 67 | Ga0068861_100005782 | 3300005719 | Bacteria | 8391 |
| 68 | Ga0068858_100007701 | 3300005842 | Bacteria | 10397 |
| 69 | Ga0068860_100000408 | 3300005843 | Bacteria | 55871 |
| 70 | Ga0068860_100004270 | 3300005843 | Bacteria | 14630 |
| 71 | Ga0068862_100024677 | 3300005844 | Bacteria | 5045 |
| 72 | Ga0081538_10000099 | 3300005981 | Bacteria | 83947 |
| 73 | Ga0081538_10000252 | 3300005981 | Bacteria | 60660 |
| 74 | Ga0081538_10019152 | 3300005981 | Bacteria | 5103 |
| 75 | Ga0081538_10037561 | 3300005981 | Bacteria | 3140 |
| 76 | Ga0081538_10037796 | 3300005981 | Bacteria | 3124 |
| 77 | Ga0081538_10049339 | 3300005981 | Bacteria | 2554 |
| 78 | Ga0081538_10096530 | 3300005981 | Bacteria | 1505 |
| 79 | Ga0081539_10079947 | 3300005985 | Bacteria | 1721 |
| 80 | Ga0070717_10015158 | 3300006028 | Bacteria | 5946 |
| 81 | Ga0070717_10137861 | 3300006028 | Bacteria | 2102 |
| 82 | Ga0070717_10156338 | 3300006028 | Bacteria | 1976 |
| 83 | Ga0075365_10017086 | 3300006038 | Bacteria | 4429 |
| 84 | Ga0075365_10017207 | 3300006038 | Bacteria | 4417 |
| 85 | Ga0075365_10024565 | 3300006038 | Bacteria | 3803 |
| 86 | Ga0075365_10025770 | 3300006038 | Bacteria | 3726 |
| 87 | Ga0075365_10045002 | 3300006038 | Bacteria | 2894 |
| 88 | Ga0075365_10049467 | 3300006038 | Bacteria | 2770 |
| 89 | Ga0075365_10332158 | 3300006038 | Bacteria | 1071 |
| 90 | Ga0075363_100049876 | 3300006048 | Bacteria | 2229 |
| 91 | Ga0075364_10007767 | 3300006051 | Bacteria | 6390 |
| 92 | Ga0075364_10010039 | 3300006051 | Bacteria | 5705 |
| 93 | Ga0075364_10044043 | 3300006051 | Bacteria | 2902 |
| 94 | Ga0075432_10069707 | 3300006058 | Bacteria | 1262 |
| 95 | Ga0070715_10001041 | 3300006163 | Bacteria | 7840 |
| 96 | Ga0070716_100008509 | 3300006173 | Bacteria | 5092 |
| 97 | Ga0070712_100000937 | 3300006175 | Bacteria | 17569 |
| 98 | Ga0075367_10048383 | 3300006178 | Bacteria | 2504 |
| 99 | Ga0075367_10130088 | 3300006178 | Bacteria | 1556 |
| 100 | Ga0068871_100221906 | 3300006358 | Bacteria | 1638 |
| 101 | Ga0075428_100039164 | 3300006844 | Bacteria | 5216 |
| 102 | Ga0075428_100180884 | 3300006844 | Bacteria | 2282 |
| 103 | Ga0075431_100079606 | 3300006847 | Bacteria | 3382 |
| 104 | Ga0075429_100000888 | 3300006880 | Bacteria | 23633 |
| 105 | Ga0068865_100003697 | 3300006881 | Bacteria | 9193 |
| 106 | Ga0068865_100259268 | 3300006881 | Bacteria | 1376 |
| 107 | Ga0097620_100005669 | 3300006931 | Bacteria | 12711 |
| 108 | Ga0105250_10037625 | 3300009092 | Bacteria | 1941 |
| 109 | Ga0105240_10849346 | 3300009093 | Bacteria | 986 |
| 110 | Ga0111539_10058482 | 3300009094 | Bacteria | 4574 |
| 111 | Ga0105245_10011878 | 3300009098 | Bacteria | 7572 |
| 112 | Ga0105245_10035148 | 3300009098 | Bacteria | 4447 |
| 113 | Ga0105245_10059711 | 3300009098 | Bacteria | 3434 |
| 114 | Ga0105245_10112496 | 3300009098 | Bacteria | 2534 |
| 115 | Ga0105247_10001851 | 3300009101 | Bacteria | 14800 |
| 116 | Ga0105247_10087153 | 3300009101 | Bacteria | 1976 |
| 117 | Ga0105247_10152885 | 3300009101 | Bacteria | 1522 |
| 118 | Ga0114129_10142119 | 3300009147 | Bacteria | 3289 |
| 119 | Ga0114129_10166783 | 3300009147 | Bacteria | 3005 |
| 120 | Ga0105243_10014535 | 3300009148 | Bacteria | 5956 |
| 121 | Ga0105242_10003909 | 3300009176 | Bacteria | 11586 |
| 122 | Ga0105248_10112709 | 3300009177 | Bacteria | 3067 |
| 123 | Ga0105248_10257854 | 3300009177 | Bacteria | 1963 |
| 124 | Ga0105237_10023851 | 3300009545 | Bacteria | 6261 |
| 125 | Ga0105238_10142663 | 3300009551 | Bacteria | 2372 |
| 126 | Ga0105249_10006429 | 3300009553 | Bacteria | 10214 |
| 127 | Ga0105249_10112826 | 3300009553 | Bacteria | 2571 |
| 128 | Ga0105239_10002575 | 3300010375 | Bacteria | 22977 |
| 129 | Ga0105239_10016028 | 3300010375 | Bacteria | 8293 |
| 130 | Ga0105239_10029888 | 3300010375 | Bacteria | 5992 |
| 131 | Ga0105239_10343406 | 3300010375 | Bacteria | 1685 |
| 132 | Ga0105239_10355278 | 3300010375 | Bacteria | 1655 |
| 133 | Ga0105246_10030583 | 3300011119 | Bacteria | 3558 |
| 134 | Ga0157371_10394161 | 3300013102 | Bacteria | 1012 |
| 135 | Ga0157369_10030343 | 3300013105 | Bacteria | 5963 |
| 136 | Ga0157378_10003234 | 3300013297 | Bacteria | 14500 |
| 137 | Ga0163162_10010330 | 3300013306 | Bacteria | 9074 |
| 138 | Ga0163162_10188172 | 3300013306 | Bacteria | 2192 |
| 139 | Ga0163162_10657106 | 3300013306 | Bacteria | 1172 |
| 140 | Ga0163162_10943039 | 3300013306 | Bacteria | 974 |
| 141 | Ga0157372_10003899 | 3300013307 | Bacteria | 16030 |
| 142 | Ga0157372_10078862 | 3300013307 | Bacteria | 3722 |
| 143 | Ga0157375_10002098 | 3300013308 | Bacteria | 17205 |
| 144 | Ga0157375_10047567 | 3300013308 | Bacteria | 4191 |
| 145 | Ga0157375_10383078 | 3300013308 | Bacteria | 1573 |
| 146 | Ga0157375_10448611 | 3300013308 | Bacteria | 1455 |
| 147 | Ga0163163_10013478 | 3300014325 | Bacteria | 7489 |
| 148 | Ga0163163_10410426 | 3300014325 | Bacteria | 1413 |
| 149 | Ga0157380_10003529 | 3300014326 | Bacteria | 10751 |
| 150 | Ga0157379_10038287 | 3300014968 | Bacteria | 4279 |
| 151 | Ga0163161_10005680 | 3300017792 | Bacteria | 8647 |
| 152 | Ga0163161_10009991 | 3300017792 | Bacteria | 6574 |
| 153 | Ga0206351_10140874 | 3300020077 | Bacteria | 1922 |
| 154 | Ga0206350_10894643 | 3300020080 | Bacteria | 3293 |
| 155 | Ga0206350_11056928 | 3300020080 | Bacteria | 942 |
| 156 | Ga0206354_10050827 | 3300020081 | Bacteria | 944 |
| 157 | Ga0154015_1573958 | 3300020610 | Bacteria | 1633 |
| 158 | Ga0224712_10008296 | 3300022467 | Bacteria | 3072 |
| 159 | Ga0224712_10008417 | 3300022467 | Bacteria | 3057 |
| 160 | Ga0224712_10037096 | 3300022467 | Bacteria | 1812 |
| 161 | Ga0209051_1003121 | 3300025303 | Bacteria | 11169 |
| 162 | Ga0209051_1003771 | 3300025303 | Bacteria | 9724 |
| 163 | Ga0209051_1032521 | 3300025303 | Bacteria | 1988 |
| 164 | Ga0207653_10006916 | 3300025885 | Bacteria | 3537 |
| 165 | Ga0207692_10001621 | 3300025898 | Bacteria | 8485 |
| 166 | Ga0207642_10001089 | 3300025899 | Bacteria | 8426 |
| 167 | Ga0207710_10138033 | 3300025900 | Bacteria | 1175 |
| 168 | Ga0207688_10001131 | 3300025901 | Bacteria | 13728 |
| 169 | Ga0207688_10023746 | 3300025901 | Bacteria | 3360 |
| 170 | Ga0207688_10101463 | 3300025901 | Bacteria | 1662 |
| 171 | Ga0207647_10070388 | 3300025904 | Bacteria | 2113 |
| 172 | Ga0207647_10077760 | 3300025904 | Bacteria | 1994 |
| 173 | Ga0207699_10016517 | 3300025906 | Bacteria | 3864 |
| 174 | Ga0207645_10011031 | 3300025907 | Bacteria | 6184 |
| 175 | Ga0207705_10195114 | 3300025909 | Bacteria | 1533 |
| 176 | Ga0207693_10002173 | 3300025915 | Bacteria | 17096 |
| 177 | Ga0207663_10013617 | 3300025916 | Bacteria | 4425 |
| 178 | Ga0207662_10007411 | 3300025918 | Bacteria | 5973 |
| 179 | Ga0207662_10017458 | 3300025918 | Bacteria | 4060 |
| 180 | Ga0207657_10072767 | 3300025919 | Bacteria | 2906 |
| 181 | Ga0207652_10001806 | 3300025921 | Bacteria | 18544 |
| 182 | Ga0207681_10003723 | 3300025923 | Bacteria | 9478 |
| 183 | Ga0207694_10505451 | 3300025924 | Bacteria | 1012 |
| 184 | Ga0207659_10203763 | 3300025926 | Bacteria | 1582 |
| 185 | Ga0207687_10019651 | 3300025927 | Bacteria | 4477 |
| 186 | Ga0207687_10030335 | 3300025927 | Bacteria | 3645 |
| 187 | Ga0207687_10110492 | 3300025927 | Bacteria | 2039 |
| 188 | Ga0207687_10135336 | 3300025927 | Bacteria | 1863 |
| 189 | Ga0207700_10113260 | 3300025928 | Bacteria | 2187 |
| 190 | Ga0207664_10013850 | 3300025929 | Bacteria | 5807 |
| 191 | Ga0207690_10019121 | 3300025932 | Bacteria | 4210 |
| 192 | Ga0207690_10045121 | 3300025932 | Bacteria | 2910 |
| 193 | Ga0207706_10002932 | 3300025933 | Bacteria | 16485 |
| 194 | Ga0207706_10049707 | 3300025933 | Bacteria | 3705 |
| 195 | Ga0207686_10003255 | 3300025934 | Bacteria | 8739 |
| 196 | Ga0207709_10001833 | 3300025935 | Bacteria | 14176 |
| 197 | Ga0207709_10117591 | 3300025935 | Bacteria | 1789 |
| 198 | Ga0207670_10527087 | 3300025936 | Bacteria | 962 |
| 199 | Ga0207669_10000720 | 3300025937 | Bacteria | 14321 |
| 200 | Ga0207704_10001891 | 3300025938 | Bacteria | 9373 |
| 201 | Ga0207704_10015500 | 3300025938 | Bacteria | 3886 |
| 202 | Ga0207665_10001201 | 3300025939 | Bacteria | 17463 |
| 203 | Ga0207691_10016370 | 3300025940 | Bacteria | 7039 |
| 204 | Ga0207691_10145693 | 3300025940 | Bacteria | 2085 |
| 205 | Ga0207711_10109034 | 3300025941 | Bacteria | 2460 |
| 206 | Ga0207711_10258230 | 3300025941 | Bacteria | 1601 |
| 207 | Ga0207661_10008926 | 3300025944 | Bacteria | 7180 |
| 208 | Ga0207661_10013016 | 3300025944 | Bacteria | 6071 |
| 209 | Ga0207661_10047503 | 3300025944 | Bacteria | 3408 |
| 210 | Ga0207661_10093823 | 3300025944 | Bacteria | 2506 |
| 211 | Ga0207661_10110241 | 3300025944 | Bacteria | 2326 |
| 212 | Ga0207679_10030500 | 3300025945 | Bacteria | 3766 |
| 213 | Ga0207667_10102225 | 3300025949 | Bacteria | 2956 |
| 214 | Ga0207712_10005996 | 3300025961 | Bacteria | 7670 |
| 215 | Ga0207668_10001945 | 3300025972 | Bacteria | 12107 |
| 216 | Ga0207640_10014765 | 3300025981 | Bacteria | 4504 |
| 217 | Ga0207658_10007194 | 3300025986 | Bacteria | 7588 |
| 218 | Ga0207658_10014492 | 3300025986 | Bacteria | 5398 |
| 219 | Ga0207677_10003405 | 3300026023 | Bacteria | 8428 |
| 220 | Ga0207677_10077818 | 3300026023 | Bacteria | 2366 |
| 221 | Ga0207703_10006972 | 3300026035 | Bacteria | 8995 |
| 222 | Ga0207703_10121357 | 3300026035 | Bacteria | 2244 |
| 223 | Ga0207639_10068629 | 3300026041 | Bacteria | 2763 |
| 224 | Ga0207678_10008271 | 3300026067 | Bacteria | 9165 |
| 225 | Ga0207678_10021113 | 3300026067 | Bacteria | 5706 |
| 226 | Ga0207678_10183035 | 3300026067 | Bacteria | 1789 |
| 227 | Ga0207708_10004491 | 3300026075 | Bacteria | 10277 |
| 228 | Ga0207708_10022542 | 3300026075 | Bacteria | 4756 |
| 229 | Ga0207648_10003448 | 3300026089 | Bacteria | 16587 |
| 230 | Ga0207674_10013436 | 3300026116 | Bacteria | 9087 |
| 231 | Ga0207675_100008624 | 3300026118 | Bacteria | 9586 |
| 232 | Ga0207683_10002390 | 3300026121 | Bacteria | 16400 |
| 233 | Ga0207683_10110974 | 3300026121 | Bacteria | 2455 |
| 234 | Ga0207683_10224664 | 3300026121 | Bacteria | 1711 |
| 235 | Ga0207683_10411908 | 3300026121 | Bacteria | 1244 |
| 236 | Ga0207698_10025039 | 3300026142 | Bacteria | 4197 |
| 237 | Ga0207428_10013868 | 3300027907 | Bacteria | 7020 |
| 238 | Ga0207428_10054436 | 3300027907 | Bacteria | 3187 |
| 239 | Ga0268266_10001442 | 3300028379 | Bacteria | 28308 |
| 240 | Ga0268266_10001635 | 3300028379 | Bacteria | 26068 |
| 241 | Ga0268265_10007297 | 3300028380 | Bacteria | 7466 |
| 242 | Ga0268264_10000462 | 3300028381 | Bacteria | 55077 |
| 243 | Ga0268264_10016161 | 3300028381 | Bacteria | 6113 |
| 244 | Ga0316575_10027103 | 3300031665 | Bacteria | 2229 |
| 245 | Ga0316576_10016068 | 3300031727 | Bacteria | 5045 |
| 246 | Ga0316578_10030032 | 3300031728 | Bacteria | 3087 |
| 247 | Ga0316578_10083523 | 3300031728 | Bacteria | 1902 |
| 248 | Ga0316577_10241125 | 3300031733 | Bacteria | 1022 |
| 249 | Ga0307413_10117285 | 3300031824 | Bacteria | 1795 |
| 250 | Ga0307410_10025195 | 3300031852 | Bacteria | 3728 |
| 251 | Ga0307410_10087567 | 3300031852 | Bacteria | 2203 |
| 252 | Ga0307410_10546442 | 3300031852 | Bacteria | 959 |
| 253 | Ga0307407_10076027 | 3300031903 | Bacteria | 2015 |
| 254 | Ga0307409_100010540 | 3300031995 | Bacteria | 5755 |
| 255 | Ga0307409_100897850 | 3300031995 | Bacteria | 899 |
| 256 | Ga0307416_100109175 | 3300032002 | Bacteria | 2433 |
| 257 | Ga0307416_100182608 | 3300032002 | Bacteria | 1968 |
| 258 | Ga0307416_100315404 | 3300032002 | Bacteria | 1562 |
| 259 | Ga0307416_100393140 | 3300032002 | Bacteria | 1421 |
| 260 | Ga0307414_10534818 | 3300032004 | Bacteria | 1042 |
| 261 | Ga0307411_10045263 | 3300032005 | Bacteria | 2830 |
| 262 | Ga0307415_100027771 | 3300032126 | Bacteria | 3590 |
| 263 | Ga0307415_100165563 | 3300032126 | Bacteria | 1718 |
| 264 | Ga0316585_10021477 | 3300032137 | Bacteria | 1983 |
| 265 | Ga0316574_0002209 | 3300035398 | Bacteria | 9676 |
| 266 | Ga0316574_0014024 | 3300035398 | Bacteria | 4621 |
| 267 | Ga0373931_0004469 | 3300035691 | Bacteria | 6392 |
| 268 | Ga0316582_0016333 | 3300036647 | Bacteria | 4267 |
| 269 | Ga0316584_0039301 | 3300036712 | Bacteria | 3522 |
| 270 | Ga0395900_0045588 | 3300037418 | Bacteria | 4516 |
| 271 | Ga0395900_0501324 | 3300037418 | Bacteria | 1164 |
| 272 | Ga0395898_0253563 | 3300037466 | Bacteria | 1678 |
| 273 | Ga0436364_0092506 | 3300037853 | Bacteria | 10642 |
| 274 | Ga0395901_0006164 | 3300038443 | Bacteria | 12151 |
| 275 | Ga0395901_0100709 | 3300038443 | Bacteria | 3031 |
| 276 | Ga0395901_0130816 | 3300038443 | Bacteria | 2637 |
| 277 | Ga0395901_0299201 | 3300038443 | Bacteria | 1668 |
| 278 | Ga0436365_1871652 | 3300039437 | Bacteria | 4435 |
| 279 | Ga0436363_0917578 | 3300039450 | Bacteria | 1155 |
| 280 | Ga0451793_0537355 | 3300041452 | Bacteria | 1371 |
| 281 | Ga0451797_0088653 | 3300041453 | Bacteria | 1285 |
| 282 | Ga0451837_0709787 | 3300041494 | Bacteria | 1622 |
| 283 | Ga0451837_1454732 | 3300041494 | Bacteria | 1228 |
| 284 | Ga0451853_0179873 | 3300041512 | Bacteria | 7000 |
| 285 | Ga0439450_000910 | 3300042008 | Bacteria | 4096 |
| 286 | Ga0439454_000412 | 3300042011 | Bacteria | 3354 |
| 287 | Ga0439463_020173 | 3300042016 | Bacteria | 1661 |
| 288 | Ga0450888_001276 | 3300042126 | Bacteria | 2403 |
| 289 | Ga0450904_001543 | 3300042139 | Bacteria | 3157 |
| 290 | Ga0450889_001591 | 3300042144 | Bacteria | 2318 |
| 291 | Ga0439460_0002451 | 3300042461 | Bacteria | 4474 |
| 292 | Ga0450916_000357 | 3300042530 | Bacteria | 3795 |
| 293 | Ga0466969_0018201 | 3300044656 | Bacteria | 3663 |
| 294 | Ga0466965_0008194 | 3300044683 | Bacteria | 4826 |
| 295 | Ga0466965_0061307 | 3300044683 | Bacteria | 1880 |
| 296 | Ga0466965_0074636 | 3300044683 | Bacteria | 1709 |
| 297 | Ga0466966_0084079 | 3300044684 | Bacteria | 1980 |
| 298 | Ga0466966_0087224 | 3300044684 | Bacteria | 1940 |
| 299 | Ga0466966_0124413 | 3300044684 | Bacteria | 1582 |
| 300 | Ga0466961_0145864 | 3300044693 | Bacteria | 1480 |
| 301 | Ga0466963_0003479 | 3300044694 | Bacteria | 9032 |
| 302 | Ga0466963_0075207 | 3300044694 | Bacteria | 2279 |
| 303 | Ga0466963_0119520 | 3300044694 | Bacteria | 1813 |
| 304 | Ga0466964_0060710 | 3300044706 | Bacteria | 1573 |
| 305 | Ga0466964_0079245 | 3300044706 | Bacteria | 1406 |
| 306 | Ga0466968_0075906 | 3300044735 | Bacteria | 1470 |
| 307 | Ga0466970_0002720 | 3300044765 | Bacteria | 8539 |
| 308 | Ga0466970_0009584 | 3300044765 | Bacteria | 4899 |
| 309 | Ga0466970_0035320 | 3300044765 | Bacteria | 2648 |
| 310 | Ga0466970_0123636 | 3300044765 | Bacteria | 1418 |
| 311 | Ga0466970_0313949 | 3300044765 | Bacteria | 885 |
| 312 | Ga0466957_0020632 | 3300044842 | Bacteria | 3878 |
| 313 | Ga0466957_0062442 | 3300044842 | Bacteria | 2288 |
| 314 | Ga0466957_0269852 | 3300044842 | Bacteria | 1136 |
| 315 | Ga0466957_0280022 | 3300044842 | Bacteria | 1116 |
| 316 | Ga0466960_0101630 | 3300044901 | Bacteria | 1481 |
| 317 | Ga0466960_0144302 | 3300044901 | Bacteria | 1267 |
| 318 | Ga0466959_0009384 | 3300045049 | Bacteria | 6956 |
| 319 | Ga0466959_0017068 | 3300045049 | Bacteria | 5315 |
| 320 | Ga0466959_0080552 | 3300045049 | Bacteria | 2347 |
| 321 | Ga0466958_0009007 | 3300045836 | Bacteria | 5543 |
| 322 | Ga0466958_0011664 | 3300045836 | Bacteria | 4955 |
| 323 | Ga0466967_0000277 | 3300045976 | Bacteria | 22703 |
| 324 | Ga0466967_0002416 | 3300045976 | Bacteria | 11608 |
| 325 | Ga0466967_0052332 | 3300045976 | Bacteria | 3583 |
| 326 | Ga0466967_0224075 | 3300045976 | Bacteria | 1788 |
| 327 | Ga0466967_0227487 | 3300045976 | Bacteria | 1775 |
| 328 | Ga0466967_0267368 | 3300045976 | Bacteria | 1637 |
| 329 | Ga0495664_0008832 | 3300046477 | Bacteria | 5630 |
| 330 | Ga0495596_0023074 | 3300046500 | Bacteria | 2527 |
| 331 | Ga0495607_0140362 | 3300046501 | Bacteria | 1247 |
| 332 | Ga0495631_0034710 | 3300046518 | Bacteria | 2260 |
| 333 | Ga0495644_0049187 | 3300046523 | Bacteria | 1583 |
| 334 | Ga0495668_0041800 | 3300046616 | Bacteria | 2553 |
| 335 | Ga0495589_0138460 | 3300046794 | Bacteria | 1167 |
| 336 | Ga0495677_0029231 | 3300047445 | Bacteria | 2004 |
| 337 | Ga0496100_0007952 | 3300048903 | Bacteria | 5891 |
| 338 | Ga0496101_0001637 | 3300048904 | Bacteria | 13428 |
| 339 | Ga0496101_0023201 | 3300048904 | Bacteria | 4283 |
| 340 | Ga0496101_0110713 | 3300048904 | Bacteria | 2066 |
| 341 | Ga0496101_0208195 | 3300048904 | Bacteria | 1514 |
| 342 | Ga0496102_0013221 | 3300048905 | Bacteria | 7143 |
| 343 | Ga0496102_0013670 | 3300048905 | Bacteria | 7035 |
| 344 | Ga0496102_0031631 | 3300048905 | Bacteria | 4747 |
| 345 | Ga0496102_0094242 | 3300048905 | Bacteria | 2774 |
| 346 | Ga0496103_0003564 | 3300048906 | Bacteria | 9508 |
| 347 | Ga0496103_0031498 | 3300048906 | Bacteria | 3231 |
| 348 | Ga0496103_0191635 | 3300048906 | Bacteria | 1314 |
| 349 | Ga0496104_0085371 | 3300048907 | Bacteria | 3013 |
| 350 | Ga0496104_0139836 | 3300048907 | Bacteria | 2326 |
| 351 | Ga0496105_0076039 | 3300048908 | Bacteria | 2773 |
| 352 | Ga0496105_0146246 | 3300048908 | Bacteria | 1944 |
| 353 | Ga0496105_0246426 | 3300048908 | Bacteria | 1449 |
| 354 | Ga0496106_0002377 | 3300048909 | Bacteria | 14010 |
| 355 | Ga0496106_0011429 | 3300048909 | Bacteria | 6568 |
| 356 | Ga0496106_0110434 | 3300048909 | Bacteria | 2140 |
| 357 | Ga0496106_0180421 | 3300048909 | Bacteria | 1676 |
| 358 | Ga0496107_0005618 | 3300048910 | Bacteria | 8588 |
| 359 | Ga0496107_0166724 | 3300048910 | Bacteria | 1633 |
| 360 | Ga0496107_0179678 | 3300048910 | Bacteria | 1571 |
| 361 | Ga0496108_0037963 | 3300048911 | Bacteria | 4013 |
| 362 | Ga0496108_0084764 | 3300048911 | Bacteria | 2689 |
| 363 | Ga0496109_0005488 | 3300048912 | Bacteria | 10614 |
| 364 | Ga0496109_0009760 | 3300048912 | Bacteria | 8193 |
| 365 | Ga0496109_0059381 | 3300048912 | Bacteria | 3493 |
| 366 | Ga0496109_0230459 | 3300048912 | Bacteria | 1742 |
| 367 | Ga0496110_0005180 | 3300048913 | Bacteria | 10196 |
| 368 | Ga0496110_0027113 | 3300048913 | Bacteria | 4908 |
| 369 | Ga0496111_0010465 | 3300048914 | Bacteria | 6226 |
| 370 | Ga0496111_0224148 | 3300048914 | Bacteria | 1397 |
| 371 | Ga0496112_0011188 | 3300048915 | Bacteria | 8183 |
| 372 | Ga0496112_0185760 | 3300048915 | Bacteria | 2042 |
| 373 | Ga0496113_0137719 | 3300048916 | Bacteria | 1919 |
| 374 | Ga0496113_0174087 | 3300048916 | Bacteria | 1705 |
| 375 | Ga0496114_0004158 | 3300048917 | Bacteria | 11197 |
| 376 | Ga0496114_0014350 | 3300048917 | Bacteria | 6355 |
| 377 | Ga0496114_0086425 | 3300048917 | Bacteria | 2658 |
| 378 | Ga0496114_0454190 | 3300048917 | Bacteria | 1134 |
| 379 | Ga0496115_0007933 | 3300048918 | Bacteria | 7833 |
| 380 | Ga0496117_0003750 | 3300048920 | Bacteria | 17399 |
| 381 | Ga0496117_0047283 | 3300048920 | Bacteria | 3087 |
| 382 | Ga0496118_0002228 | 3300048921 | Bacteria | 26760 |
| 383 | Ga0496119_0006062 | 3300048922 | Bacteria | 11328 |
| 384 | Ga0496119_0117703 | 3300048922 | Bacteria | 1465 |
| 385 | Ga0496120_0001095 | 3300048923 | Bacteria | 35373 |
| 386 | Ga0496121_0008413 | 3300048924 | Bacteria | 12148 |
| 387 | Ga0496121_0012885 | 3300048924 | Bacteria | 9045 |
| 388 | Ga0496121_0048266 | 3300048924 | Bacteria | 3623 |
| 389 | Ga0496125_0141808 | 3300048928 | Bacteria | 1669 |
| 390 | Ga0501031_0005090 | 3300049568 | Bacteria | 8555 |
| 391 | Ga0501031_0008373 | 3300049568 | Bacteria | 6724 |
| 392 | Ga0501031_0040626 | 3300049568 | Bacteria | 3037 |
| 393 | Ga0501032_0002074 | 3300049569 | Bacteria | 15823 |
| 394 | Ga0501032_0012903 | 3300049569 | Bacteria | 5957 |
| 395 | Ga0501032_0026746 | 3300049569 | Bacteria | 3966 |
| 396 | Ga0501033_0000226 | 3300049570 | Bacteria | 54291 |
| 397 | Ga0501033_0032898 | 3300049570 | Bacteria | 3893 |
| 398 | Ga0501034_0012489 | 3300049571 | Bacteria | 8771 |
| 399 | Ga0501034_0013729 | 3300049571 | Bacteria | 8332 |
| 400 | Ga0501034_0028065 | 3300049571 | Bacteria | 5724 |
| 401 | Ga0501034_0219830 | 3300049571 | Bacteria | 1852 |
| 402 | Ga0501036_0000099 | 3300049572 | Bacteria | 54135 |
| 403 | Ga0501036_0026528 | 3300049572 | Bacteria | 4891 |
| 404 | Ga0501036_0076861 | 3300049572 | Bacteria | 2825 |
| 405 | Ga0501036_0102425 | 3300049572 | Bacteria | 2422 |
| 406 | Ga0501036_0206670 | 3300049572 | Bacteria | 1650 |
| 407 | Ga0501036_0250061 | 3300049572 | Bacteria | 1486 |
| 408 | Ga0501037_0000590 | 3300049573 | Bacteria | 28545 |
| 409 | Ga0501037_0004539 | 3300049573 | Bacteria | 10094 |
| 410 | Ga0501037_0038591 | 3300049573 | Bacteria | 3519 |
| 411 | Ga0501037_0152423 | 3300049573 | Bacteria | 1651 |
| 412 | Ga0501038_0000471 | 3300049574 | Bacteria | 35396 |
| 413 | Ga0501038_0002860 | 3300049574 | Bacteria | 16077 |
| 414 | Ga0501038_0005317 | 3300049574 | Bacteria | 11963 |
| 415 | Ga0501038_0007841 | 3300049574 | Bacteria | 9842 |
| 416 | Ga0501039_0001682 | 3300049575 | Bacteria | 16289 |
| 417 | Ga0501039_0045419 | 3300049575 | Bacteria | 3394 |
| 418 | Ga0501039_0075941 | 3300049575 | Bacteria | 2612 |
| 419 | Ga0501039_0090351 | 3300049575 | Bacteria | 2387 |
| 420 | Ga0501040_0118355 | 3300049576 | Bacteria | 1857 |
| 421 | Ga0501041_0001577 | 3300049577 | Bacteria | 12692 |
| 422 | Ga0501042_0005345 | 3300049578 | Bacteria | 8257 |
| 423 | Ga0501042_0006187 | 3300049578 | Bacteria | 7768 |
| 424 | Ga0501042_0011757 | 3300049578 | Bacteria | 5913 |
| 425 | Ga0501042_0091794 | 3300049578 | Bacteria | 2180 |
| 426 | Ga0501043_0000456 | 3300049579 | Bacteria | 36439 |
| 427 | Ga0501043_0006124 | 3300049579 | Bacteria | 9660 |
| 428 | Ga0501043_0024406 | 3300049579 | Bacteria | 4745 |
| 429 | Ga0501043_0164887 | 3300049579 | Bacteria | 1730 |
| 430 | Ga0501043_0288116 | 3300049579 | Bacteria | 1257 |
| 431 | Ga0501046_0002889 | 3300049580 | Bacteria | 15933 |
| 432 | Ga0501046_0012563 | 3300049580 | Bacteria | 7201 |
| 433 | Ga0501046_0016486 | 3300049580 | Bacteria | 6186 |
| 434 | Ga0501046_0017420 | 3300049580 | Bacteria | 5996 |
| 435 | Ga0501047_0000548 | 3300049581 | Bacteria | 40558 |
| 436 | Ga0501047_0004082 | 3300049581 | Bacteria | 13735 |
| 437 | Ga0501047_0006490 | 3300049581 | Bacteria | 11007 |
| 438 | Ga0501047_0080757 | 3300049581 | Bacteria | 3125 |
| 439 | Ga0501048_0007225 | 3300049582 | Bacteria | 8425 |
| 440 | Ga0501048_0022728 | 3300049582 | Bacteria | 4584 |
| 441 | Ga0501048_0290634 | 3300049582 | Bacteria | 1162 |
| 442 | Ga0501067_0015280 | 3300049583 | Bacteria | 4249 |
| 443 | Ga0501067_0018426 | 3300049583 | Bacteria | 3867 |
| 444 | Ga0501067_0019048 | 3300049583 | Bacteria | 3798 |
| 445 | Ga0501068_0010174 | 3300049584 | Bacteria | 5279 |
| 446 | Ga0501068_0015112 | 3300049584 | Bacteria | 4428 |
| 447 | Ga0501068_0040122 | 3300049584 | Bacteria | 2809 |
| 448 | Ga0501068_0256919 | 3300049584 | Bacteria | 1114 |
| 449 | Ga0501068_0267143 | 3300049584 | Bacteria | 1092 |
| 450 | Ga0501069_0005561 | 3300049585 | Bacteria | 6558 |
| 451 | Ga0501069_0131987 | 3300049585 | Bacteria | 1430 |
| 452 | Ga0501070_0000220 | 3300049586 | Bacteria | 54220 |
| 453 | Ga0501070_0012952 | 3300049586 | Bacteria | 7028 |
| 454 | Ga0501070_0038647 | 3300049586 | Bacteria | 3982 |
| 455 | Ga0501070_0056839 | 3300049586 | Bacteria | 3244 |
| 456 | Ga0501070_0132686 | 3300049586 | Bacteria | 2057 |
| 457 | Ga0501071_0006682 | 3300049587 | Bacteria | 7496 |
| 458 | Ga0501071_0016393 | 3300049587 | Bacteria | 5094 |
| 459 | Ga0501071_0249584 | 3300049587 | Bacteria | 1339 |
| 460 | Ga0501072_0007113 | 3300049588 | Bacteria | 8492 |
| 461 | Ga0501072_0015945 | 3300049588 | Bacteria | 5761 |
| 462 | Ga0501072_0070949 | 3300049588 | Bacteria | 2752 |
| 463 | Ga0501072_0145712 | 3300049588 | Bacteria | 1888 |
| 464 | Ga0501072_0164768 | 3300049588 | Bacteria | 1768 |
| 465 | Ga0501072_0456642 | 3300049588 | Bacteria | 1011 |
| 466 | Ga0501073_0001220 | 3300049589 | Bacteria | 18744 |
| 467 | Ga0501073_0029543 | 3300049589 | Bacteria | 3916 |
| 468 | Ga0501073_0034355 | 3300049589 | Bacteria | 3609 |
| 469 | Ga0501074_0008628 | 3300049590 | Bacteria | 7381 |
| 470 | Ga0501074_0012328 | 3300049590 | Bacteria | 6213 |
| 471 | Ga0501074_0342420 | 3300049590 | Bacteria | 1061 |
| 472 | Ga0501075_0127065 | 3300049591 | Bacteria | 1941 |
| 473 | Ga0501075_0323333 | 3300049591 | Bacteria | 1175 |
| 474 | Ga0501076_0029675 | 3300049592 | Bacteria | 4254 |
| 475 | Ga0501077_0016778 | 3300049593 | Bacteria | 4618 |
| 476 | Ga0501077_0090910 | 3300049593 | Bacteria | 1934 |
| 477 | Ga0501202_017121 | 3300049652 | Bacteria | 1413 |
| 478 | Ga0501079_0016656 | 3300049741 | Bacteria | 5614 |
| 479 | Ga0501080_0006668 | 3300049742 | Bacteria | 10390 |
| 480 | Ga0501080_0012460 | 3300049742 | Bacteria | 7795 |
| 481 | Ga0501080_0015799 | 3300049742 | Bacteria | 6964 |
| 482 | Ga0501080_0016637 | 3300049742 | Bacteria | 6793 |
| 483 | Ga0501080_0211935 | 3300049742 | Bacteria | 1775 |
| 484 | Ga0501083_0006808 | 3300049744 | Bacteria | 8112 |
| 485 | Ga0501083_0032037 | 3300049744 | Bacteria | 3606 |
| 486 | Ga0501035_0000341 | 3300049822 | Bacteria | 54138 |
| 487 | Ga0501035_0021934 | 3300049822 | Bacteria | 5867 |
| 488 | Ga0501035_0025384 | 3300049822 | Bacteria | 5433 |
| 489 | Ga0501035_0029670 | 3300049822 | Bacteria | 4987 |
| 490 | Ga0501044_0004112 | 3300049823 | Bacteria | 16318 |
| 491 | Ga0501044_0017065 | 3300049823 | Bacteria | 7790 |
| 492 | Ga0501044_0077263 | 3300049823 | Bacteria | 3377 |
| 493 | Ga0501045_0005505 | 3300049824 | Bacteria | 8760 |
| 494 | Ga0501045_0018624 | 3300049824 | Bacteria | 4941 |
| 495 | Ga0501045_0061130 | 3300049824 | Bacteria | 2763 |
| 496 | nmdc:mga03n38_54150_c1 | 3300050490 | Bacteria | 1802 |
| 497 | nmdc:mga00v17_1324_c1 | 3300050491 | Bacteria | 12971 |
| 498 | nmdc:mga00v17_158662_c1 | 3300050491 | Bacteria | 1455 |
| 499 | nmdc:mga00v17_169776_c1 | 3300050491 | Bacteria | 1406 |
| 500 | nmdc:mga00v17_46663_c1 | 3300050491 | Bacteria | 2622 |
| 501 | nmdc:mga0yw44_10089_c1 | 3300050492 | Bacteria | 4809 |
| 502 | nmdc:mga0yw44_102450_c1 | 3300050492 | Bacteria | 1825 |
| 503 | nmdc:mga0yw44_19468_c1 | 3300050492 | Bacteria | 3745 |
| 504 | nmdc:mga0yw44_23417_c1 | 3300050492 | Bacteria | 3479 |
| 505 | nmdc:mga0yw44_269147_c1 | 3300050492 | Bacteria | 1137 |
| 506 | nmdc:mga0yw44_54852_c1 | 3300050492 | Bacteria | 2424 |
| 507 | nmdc:mga0yw44_75456_c1 | 3300050492 | Bacteria | 2102 |
| 508 | nmdc:mga0yw44_795_c1 | 3300050492 | Bacteria | 11754 |
| 509 | nmdc:mga06z11_160163_c1 | 3300050494 | Bacteria | 1286 |
| 510 | nmdc:mga07m45_112300_c1 | 3300050496 | Bacteria | 1570 |
| 511 | nmdc:mga07m45_311280_c1 | 3300050496 | Bacteria | 915 |
| 512 | nmdc:mga05p37_241701_c1 | 3300050507 | Bacteria | 2171 |
| 513 | nmdc:mga09592_7702_c1 | 3300050508 | Bacteria | 8751 |
| 514 | nmdc:mga0qj67_11712_c1 | 3300050509 | Bacteria | 6582 |
| 515 | nmdc:mga0qj67_44288_c1 | 3300050509 | Bacteria | 3506 |
| 516 | nmdc:mga06r32_81068_c1 | 3300050510 | Bacteria | 3160 |
| 517 | Ga0495601_0034461 | 3300053077 | Bacteria | 3159 |
| 518 | Ga0500572_081222 | 3300053111 | Bacteria | 1016 |
| 519 | Ga0500658_0147705 | 3300053134 | Bacteria | 1058 |
| 520 | Ga0500573_0008115 | 3300053140 | Bacteria | 5774 |
| 521 | Ga0500616_0008327 | 3300053153 | Bacteria | 6454 |
| 522 | Ga0501084_0008503 | 3300054114 | Bacteria | 8486 |
| 523 | Ga0501084_0014283 | 3300054114 | Bacteria | 6577 |
| 524 | Ga0501084_0034944 | 3300054114 | Bacteria | 4203 |
| 525 | Ga0501084_0042614 | 3300054114 | Bacteria | 3797 |
| 526 | Ga0587066_030109 | 3300059490 | Bacteria | 962 |
| 527 | Ga0587070_021489 | 3300059491 | Bacteria | 1090 |
| 528 | Ga0587073_0002139 | 3300059492 | Bacteria | 2476 |
| 529 | Ga0587073_0010989 | 3300059492 | Bacteria | 1535 |
| 530 | Ga0587073_0028813 | 3300059492 | Bacteria | 1130 |
| 531 | Ga0587080_009301 | 3300059503 | Bacteria | 1426 |
| 532 | Ga0587082_005954 | 3300059504 | Bacteria | 1606 |
| 533 | Ga0587082_012490 | 3300059504 | Bacteria | 1263 |
| 534 | Ga0587083_0039976 | 3300059505 | Bacteria | 977 |
| 535 | Ga0587086_002286 | 3300059507 | Bacteria | 1789 |
| 536 | Ga0587086_015682 | 3300059507 | Bacteria | 981 |
| 537 | Ga0587088_009085 | 3300059508 | Bacteria | 1422 |
| 538 | Ga0587090_000593 | 3300059510 | Bacteria | 3125 |
| 539 | Ga0587091_010351 | 3300059511 | Bacteria | 1425 |
| 540 | Ga0587091_021555 | 3300059511 | Bacteria | 1130 |
| 541 | Ga0587095_006594 | 3300059514 | Bacteria | 905 |
| 542 | Ga0587106_000591 | 3300059605 | Bacteria | 2688 |
| 543 | Ga0587115_002176 | 3300059626 | Bacteria | 1911 |
| 544 | Ga0587128_021058 | 3300059630 | Bacteria | 1002 |
| 545 | Ga0587069_005574 | 3300059642 | Bacteria | 1472 |
| 546 | Ga0587072_003276 | 3300059643 | Bacteria | 2261 |
| 547 | Ga0587075_012731 | 3300059644 | Bacteria | 1148 |
| 548 | Ga0587076_003141 | 3300059645 | Bacteria | 1935 |
| 549 | Ga0587078_003094 | 3300059646 | Bacteria | 1658 |
| 550 | Ga0587079_002826 | 3300059647 | Bacteria | 2189 |
| 551 | Ga0587079_041468 | 3300059647 | Bacteria | 931 |
| 552 | Ga0587114_002489 | 3300059655 | Bacteria | 1722 |
| 553 | Ga0587071_023939 | 3300060344 | Bacteria | 1137 |
| 554 | Ga0501082_0024164 | 3300060353 | Bacteria | 5241 |
| 555 | Ga0501082_0027688 | 3300060353 | Bacteria | 4878 |
| 556 | Ga0501082_0167663 | 3300060353 | Bacteria | 1909 |
| 557 | Ga0466962_0045006 | 3300061719 | Bacteria | 2110 |
| 558 | Ga0530510_0015414 | 3300061734 | Bacteria | 5401 |
| 559 | Ga0530510_0030456 | 3300061734 | Bacteria | 3875 |
| 560 | Ga0530510_0149072 | 3300061734 | Bacteria | 1726 |
| 561 | Ga0530510_0314662 | 3300061734 | Bacteria | 1173 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10017458 | Ga0207662_100174582 | 248 |
| 2 | 3300048924 | Ga0496121_0008413 | Ga0496121_0008413_6042_6872 | 249 |
| 3 | 3300005530 | Ga0070679_100467901 | Ga0070679_1004679011 | 250 |
| 4 | 3300006028 | Ga0070717_10156338 | Ga0070717_101563382 | 250 |
| 5 | 3300020077 | Ga0206351_10140874 | Ga0206351_101408742 | 250 |
| 6 | 3300020080 | Ga0206350_11056928 | Ga0206350_110569281 | 250 |
| 7 | 3300020081 | Ga0206354_10050827 | Ga0206354_100508271 | 250 |
| 8 | 3300020610 | Ga0154015_1573958 | Ga0154015_15739582 | 250 |
| 9 | 3300022467 | Ga0224712_10008296 | Ga0224712_100082963 | 250 |
| 10 | 3300022467 | Ga0224712_10008417 | Ga0224712_100084171 | 250 |
| 11 | 3300045976 | Ga0466967_0002416 | Ga0466967_0002416_4673_5503 | 250 |
| 12 | 3300044656 | Ga0466969_0018201 | Ga0466969_0018201_1974_2864 | 251 |
| 13 | 3300044694 | Ga0466963_0003479 | Ga0466963_0003479_2610_3500 | 251 |
| 14 | 3300044694 | Ga0466963_0119520 | Ga0466963_0119520_845_1678 | 251 |
| 15 | 3300044735 | Ga0466968_0075906 | Ga0466968_0075906_224_1114 | 251 |
| 16 | 3300044765 | Ga0466970_0123636 | Ga0466970_0123636_494_1384 | 251 |
| 17 | 3300045049 | Ga0466959_0009384 | Ga0466959_0009384_3427_4317 | 251 |
| 18 | 3300045836 | Ga0466958_0011664 | Ga0466958_0011664_2269_3159 | 251 |
| 19 | 3300049568 | Ga0501031_0040626 | Ga0501031_0040626_531_1367 | 251 |
| 20 | 3300049569 | Ga0501032_0012903 | Ga0501032_0012903_1705_2541 | 251 |
| 21 | 3300049570 | Ga0501033_0032898 | Ga0501033_0032898_1033_1869 | 251 |
| 22 | 3300049571 | Ga0501034_0219830 | Ga0501034_0219830_701_1537 | 251 |
| 23 | 3300049572 | Ga0501036_0206670 | Ga0501036_0206670_753_1589 | 251 |
| 24 | 3300049573 | Ga0501037_0152423 | Ga0501037_0152423_754_1590 | 251 |
| 25 | 3300049574 | Ga0501038_0005317 | Ga0501038_0005317_7385_8221 | 251 |
| 26 | 3300049579 | Ga0501043_0288116 | Ga0501043_0288116_360_1196 | 251 |
| 27 | 3300049580 | Ga0501046_0012563 | Ga0501046_0012563_3807_4643 | 251 |
| 28 | 3300049581 | Ga0501047_0080757 | Ga0501047_0080757_404_1240 | 251 |
| 29 | 3300049582 | Ga0501048_0022728 | Ga0501048_0022728_3157_3993 | 251 |
| 30 | 3300049583 | Ga0501067_0015280 | Ga0501067_0015280_613_1449 | 251 |
| 31 | 3300049584 | Ga0501068_0010174 | Ga0501068_0010174_2750_3586 | 251 |
| 32 | 3300049585 | Ga0501069_0131987 | Ga0501069_0131987_357_1193 | 251 |
| 33 | 3300049586 | Ga0501070_0012952 | Ga0501070_0012952_3276_4112 | 251 |
| 34 | 3300049587 | Ga0501071_0249584 | Ga0501071_0249584_52_888 | 251 |
| 35 | 3300049588 | Ga0501072_0070949 | Ga0501072_0070949_393_1229 | 251 |
| 36 | 3300049589 | Ga0501073_0034355 | Ga0501073_0034355_1758_2594 | 251 |
| 37 | 3300049590 | Ga0501074_0012328 | Ga0501074_0012328_1043_1879 | 251 |
| 38 | 3300049742 | Ga0501080_0006668 | Ga0501080_0006668_3897_4733 | 251 |
| 39 | 3300049822 | Ga0501035_0025384 | Ga0501035_0025384_861_1697 | 251 |
| 40 | 3300049823 | Ga0501044_0017065 | Ga0501044_0017065_4281_5117 | 251 |
| 41 | 3300054114 | Ga0501084_0014283 | Ga0501084_0014283_2570_3406 | 251 |
| 42 | 3300059504 | Ga0587082_012490 | Ga0587082_012490_175_1059 | 251 |
| 43 | 3300060353 | Ga0501082_0027688 | Ga0501082_0027688_611_1447 | 251 |
| 44 | 3300009553 | Ga0105249_10112826 | Ga0105249_101128262 | 252 |
| 45 | 3300025944 | Ga0207661_10093823 | Ga0207661_100938233 | 252 |
| 46 | 3300037853 | Ga0436364_0092506 | Ga0436364_0092506_832_1662 | 252 |
| 47 | 3300039450 | Ga0436363_0917578 | Ga0436363_0917578_116_1015 | 252 |
| 48 | 3300044684 | Ga0466966_0084079 | Ga0466966_0084079_206_1039 | 252 |
| 49 | 3300044706 | Ga0466964_0060710 | Ga0466964_0060710_92_922 | 252 |
| 50 | 3300045049 | Ga0466959_0017068 | Ga0466959_0017068_2075_2905 | 252 |
| 51 | 3300045836 | Ga0466958_0009007 | Ga0466958_0009007_2221_3051 | 252 |
| 52 | 3300048915 | Ga0496112_0011188 | Ga0496112_0011188_3038_3865 | 252 |
| 53 | 3300048916 | Ga0496113_0174087 | Ga0496113_0174087_407_1234 | 252 |
| 54 | 3300061719 | Ga0466962_0045006 | Ga0466962_0045006_1095_1925 | 252 |
| 55 | 3300020080 | Ga0206350_10894643 | Ga0206350_108946433 | 253 |
| 56 | 3300022467 | Ga0224712_10037096 | Ga0224712_100370962 | 253 |
| 57 | 3300025904 | Ga0207647_10077760 | Ga0207647_100777602 | 253 |
| 58 | 3300044694 | Ga0466963_0075207 | Ga0466963_0075207_203_1090 | 253 |
| 59 | 3300045976 | Ga0466967_0224075 | Ga0466967_0224075_280_1167 | 253 |
| 60 | 3300048905 | Ga0496102_0094242 | Ga0496102_0094242_385_1269 | 253 |
| 61 | 3300005436 | Ga0070713_100076272 | Ga0070713_1000762722 | 254 |
| 62 | 3300006028 | Ga0070717_10137861 | Ga0070717_101378612 | 254 |
| 63 | 3300025928 | Ga0207700_10113260 | Ga0207700_101132602 | 254 |
| 64 | 3300025929 | Ga0207664_10013850 | Ga0207664_100138505 | 254 |
| 65 | 3300005435 | Ga0070714_100015337 | Ga0070714_1000153373 | 255 |
| 66 | 3300006028 | Ga0070717_10015158 | Ga0070717_100151582 | 255 |
| 67 | 3300037466 | Ga0395898_0253563 | Ga0395898_0253563_333_1223 | 255 |
| 68 | 3300044842 | Ga0466957_0062442 | Ga0466957_0062442_268_1098 | 255 |
| 69 | 3300005327 | Ga0070658_10394635 | Ga0070658_103946352 | 256 |
| 70 | 3300039437 | Ga0436365_1871652 | Ga0436365_1871652_21_905 | 256 |
| 71 | 3300044683 | Ga0466965_0008194 | Ga0466965_0008194_3634_4497 | 256 |
| 72 | 3300044765 | Ga0466970_0002720 | Ga0466970_0002720_717_1580 | 256 |
| 73 | 3300044842 | Ga0466957_0020632 | Ga0466957_0020632_522_1385 | 256 |
| 74 | 3300059490 | Ga0587066_030109 | Ga0587066_030109_16_867 | 257 |
| 75 | 3300059492 | Ga0587073_0010989 | Ga0587073_0010989_103_954 | 257 |
| 76 | 3300059505 | Ga0587083_0039976 | Ga0587083_0039976_31_882 | 257 |
| 77 | 3300059507 | Ga0587086_015682 | Ga0587086_015682_35_886 | 257 |
| 78 | 3300059508 | Ga0587088_009085 | Ga0587088_009085_240_1091 | 257 |
| 79 | 3300059510 | Ga0587090_000593 | Ga0587090_000593_15_866 | 257 |
| 80 | 3300059511 | Ga0587091_021555 | Ga0587091_021555_220_1071 | 257 |
| 81 | 3300059605 | Ga0587106_000591 | Ga0587106_000591_52_903 | 257 |
| 82 | 3300059645 | Ga0587076_003141 | Ga0587076_003141_998_1849 | 257 |
| 83 | 3300059646 | Ga0587078_003094 | Ga0587078_003094_443_1294 | 257 |
| 84 | 3300059655 | Ga0587114_002489 | Ga0587114_002489_329_1180 | 257 |
| 85 | 3300009101 | Ga0105247_10087153 | Ga0105247_100871532 | 258 |
| 86 | 3300009147 | Ga0114129_10166783 | Ga0114129_101667832 | 258 |
| 87 | 3300013308 | Ga0157375_10047567 | Ga0157375_100475674 | 258 |
| 88 | 3300026121 | Ga0207683_10224664 | Ga0207683_102246642 | 258 |
| 89 | 3300048904 | Ga0496101_0110713 | Ga0496101_0110713_915_1763 | 258 |
| 90 | 3300048905 | Ga0496102_0013221 | Ga0496102_0013221_3658_4506 | 258 |
| 91 | 3300048906 | Ga0496103_0031498 | Ga0496103_0031498_1723_2571 | 258 |
| 92 | 3300048909 | Ga0496106_0011429 | Ga0496106_0011429_4298_5146 | 258 |
| 93 | 3300048914 | Ga0496111_0224148 | Ga0496111_0224148_151_999 | 258 |
| 94 | 3300044842 | Ga0466957_0269852 | Ga0466957_0269852_180_1022 | 259 |
| 95 | 3300005329 | Ga0070683_100091573 | Ga0070683_1000915731 | 260 |
| 96 | 3300031852 | Ga0307410_10087567 | Ga0307410_100875672 | 261 |
| 97 | 3300031995 | Ga0307409_100010540 | Ga0307409_1000105405 | 261 |
| 98 | 3300032002 | Ga0307416_100393140 | Ga0307416_1003931402 | 261 |
| 99 | 3300032005 | Ga0307411_10045263 | Ga0307411_100452632 | 261 |
| 100 | 3300032126 | Ga0307415_100027771 | Ga0307415_1000277713 | 261 |
| 101 | 3300044684 | Ga0466966_0124413 | Ga0466966_0124413_529_1407 | 261 |
| 102 | 3300048908 | Ga0496105_0076039 | Ga0496105_0076039_298_1173 | 261 |
| 103 | 3300049586 | Ga0501070_0056839 | Ga0501070_0056839_738_1577 | 261 |
| 104 | 3300059492 | Ga0587073_0028813 | Ga0587073_0028813_130_1005 | 261 |
| 105 | 3300006038 | Ga0075365_10017207 | Ga0075365_100172075 | 262 |
| 106 | 3300010375 | Ga0105239_10355278 | Ga0105239_103552782 | 262 |
| 107 | 3300038443 | Ga0395901_0130816 | Ga0395901_0130816_54_887 | 262 |
| 108 | 3300049571 | Ga0501034_0028065 | Ga0501034_0028065_1965_2816 | 262 |
| 109 | 3300049575 | Ga0501039_0090351 | Ga0501039_0090351_289_1140 | 262 |
| 110 | 3300049583 | Ga0501067_0018426 | Ga0501067_0018426_2433_3284 | 262 |
| 111 | 3300049584 | Ga0501068_0015112 | Ga0501068_0015112_3440_4291 | 262 |
| 112 | 3300049587 | Ga0501071_0006682 | Ga0501071_0006682_573_1424 | 262 |
| 113 | 3300049588 | Ga0501072_0164768 | Ga0501072_0164768_789_1640 | 262 |
| 114 | 3300049589 | Ga0501073_0001220 | Ga0501073_0001220_71_922 | 262 |
| 115 | 3300049590 | Ga0501074_0008628 | Ga0501074_0008628_4102_4959 | 262 |
| 116 | 3300049593 | Ga0501077_0090910 | Ga0501077_0090910_743_1594 | 262 |
| 117 | 3300049742 | Ga0501080_0015799 | Ga0501080_0015799_5829_6680 | 262 |
| 118 | 3300050492 | nmdc:mga0yw44_19468_c1 | nmdc:mga0yw44_19468_c1_2655_3485 | 262 |
| 119 | 3300054114 | Ga0501084_0008503 | Ga0501084_0008503_5022_5873 | 262 |
| 120 | 3300059492 | Ga0587073_0002139 | Ga0587073_0002139_1541_2392 | 262 |
| 121 | 3300059507 | Ga0587086_002286 | Ga0587086_002286_264_1115 | 262 |
| 122 | 3300059644 | Ga0587075_012731 | Ga0587075_012731_93_944 | 262 |
| 123 | 3300059647 | Ga0587079_041468 | Ga0587079_041468_15_866 | 262 |
| 124 | 3300005329 | Ga0070683_100033858 | Ga0070683_1000338583 | 263 |
| 125 | 3300005337 | Ga0070682_100074265 | Ga0070682_1000742652 | 263 |
| 126 | 3300005338 | Ga0068868_100275877 | Ga0068868_1002758772 | 263 |
| 127 | 3300005366 | Ga0070659_100103632 | Ga0070659_1001036322 | 263 |
| 128 | 3300005456 | Ga0070678_100349596 | Ga0070678_1003495961 | 263 |
| 129 | 3300005466 | Ga0070685_10140507 | Ga0070685_101405072 | 263 |
| 130 | 3300005535 | Ga0070684_100015891 | Ga0070684_1000158916 | 263 |
| 131 | 3300005548 | Ga0070665_100002666 | Ga0070665_1000026664 | 263 |
| 132 | 3300005577 | Ga0068857_100000819 | Ga0068857_10000081923 | 263 |
| 133 | 3300006358 | Ga0068871_100221906 | Ga0068871_1002219062 | 263 |
| 134 | 3300009098 | Ga0105245_10059711 | Ga0105245_100597112 | 263 |
| 135 | 3300009177 | Ga0105248_10112709 | Ga0105248_101127091 | 263 |
| 136 | 3300010375 | Ga0105239_10002575 | Ga0105239_1000257511 | 263 |
| 137 | 3300011119 | Ga0105246_10030583 | Ga0105246_100305834 | 263 |
| 138 | 3300013306 | Ga0163162_10188172 | Ga0163162_101881722 | 263 |
| 139 | 3300013307 | Ga0157372_10078862 | Ga0157372_100788622 | 263 |
| 140 | 3300013308 | Ga0157375_10448611 | Ga0157375_104486112 | 263 |
| 141 | 3300014325 | Ga0163163_10410426 | Ga0163163_104104262 | 263 |
| 142 | 3300025900 | Ga0207710_10138033 | Ga0207710_101380332 | 263 |
| 143 | 3300025901 | Ga0207688_10023746 | Ga0207688_100237463 | 263 |
| 144 | 3300025927 | Ga0207687_10019651 | Ga0207687_100196513 | 263 |
| 145 | 3300025932 | Ga0207690_10045121 | Ga0207690_100451212 | 263 |
| 146 | 3300025938 | Ga0207704_10015500 | Ga0207704_100155004 | 263 |
| 147 | 3300025944 | Ga0207661_10008926 | Ga0207661_100089263 | 263 |
| 148 | 3300026035 | Ga0207703_10121357 | Ga0207703_101213572 | 263 |
| 149 | 3300026116 | Ga0207674_10013436 | Ga0207674_100134365 | 263 |
| 150 | 3300028379 | Ga0268266_10001635 | Ga0268266_1000163511 | 263 |
| 151 | 3300044683 | Ga0466965_0061307 | Ga0466965_0061307_605_1450 | 263 |
| 152 | 3300044765 | Ga0466970_0009584 | Ga0466970_0009584_414_1259 | 263 |
| 153 | 3300044901 | Ga0466960_0144302 | Ga0466960_0144302_56_901 | 263 |
| 154 | 3300048912 | Ga0496109_0009760 | Ga0496109_0009760_91_942 | 263 |
| 155 | 3300048913 | Ga0496110_0005180 | Ga0496110_0005180_3997_4848 | 263 |
| 156 | 3300048914 | Ga0496111_0010465 | Ga0496111_0010465_5164_6015 | 263 |
| 157 | 3300006038 | Ga0075365_10017086 | Ga0075365_100170862 | 264 |
| 158 | 3300006038 | Ga0075365_10332158 | Ga0075365_103321582 | 264 |
| 159 | 3300006051 | Ga0075364_10010039 | Ga0075364_100100394 | 264 |
| 160 | 3300006058 | Ga0075432_10069707 | Ga0075432_100697072 | 264 |
| 161 | 3300006178 | Ga0075367_10130088 | Ga0075367_101300882 | 264 |
| 162 | 3300006844 | Ga0075428_100180884 | Ga0075428_1001808842 | 264 |
| 163 | 3300006880 | Ga0075429_100000888 | Ga0075429_1000008883 | 264 |
| 164 | 3300009094 | Ga0111539_10058482 | Ga0111539_100584826 | 264 |
| 165 | 3300027907 | Ga0207428_10054436 | Ga0207428_100544363 | 264 |
| 166 | 3300031665 | Ga0316575_10027103 | Ga0316575_100271032 | 264 |
| 167 | 3300050491 | nmdc:mga00v17_1324_c1 | nmdc:mga00v17_1324_c1_817_1662 | 264 |
| 168 | 3300050492 | nmdc:mga0yw44_269147_c1 | nmdc:mga0yw44_269147_c1_289_1119 | 264 |
| 169 | 3300050492 | nmdc:mga0yw44_54852_c1 | nmdc:mga0yw44_54852_c1_713_1540 | 264 |
| 170 | 3300050494 | nmdc:mga06z11_160163_c1 | nmdc:mga06z11_160163_c1_85_915 | 264 |
| 171 | 3300050507 | nmdc:mga05p37_241701_c1 | nmdc:mga05p37_241701_c1_77_910 | 264 |
| 172 | 3300050508 | nmdc:mga09592_7702_c1 | nmdc:mga09592_7702_c1_4100_4933 | 264 |
| 173 | 3300050509 | nmdc:mga0qj67_11712_c1 | nmdc:mga0qj67_11712_c1_4274_5107 | 264 |
| 174 | 3300013102 | Ga0157371_10394161 | Ga0157371_103941611 | 265 |
| 175 | 3300026121 | Ga0207683_10110974 | Ga0207683_101109743 | 265 |
| 176 | 3300031903 | Ga0307407_10076027 | Ga0307407_100760272 | 265 |
| 177 | 3300044683 | Ga0466965_0074636 | Ga0466965_0074636_227_1093 | 265 |
| 178 | 3300044693 | Ga0466961_0145864 | Ga0466961_0145864_466_1344 | 265 |
| 179 | 3300044901 | Ga0466960_0101630 | Ga0466960_0101630_549_1427 | 265 |
| 180 | 3300005329 | Ga0070683_100015687 | Ga0070683_1000156874 | 266 |
| 181 | 3300005337 | Ga0070682_100067443 | Ga0070682_1000674432 | 266 |
| 182 | 3300005338 | Ga0068868_100319860 | Ga0068868_1003198602 | 266 |
| 183 | 3300005458 | Ga0070681_10185544 | Ga0070681_101855442 | 266 |
| 184 | 3300006038 | Ga0075365_10049467 | Ga0075365_100494673 | 266 |
| 185 | 3300009098 | Ga0105245_10035148 | Ga0105245_100351482 | 266 |
| 186 | 3300009098 | Ga0105245_10112496 | Ga0105245_101124962 | 266 |
| 187 | 3300009177 | Ga0105248_10257854 | Ga0105248_102578542 | 266 |
| 188 | 3300013308 | Ga0157375_10383078 | Ga0157375_103830782 | 266 |
| 189 | 3300014325 | Ga0163163_10013478 | Ga0163163_100134783 | 266 |
| 190 | 3300025924 | Ga0207694_10505451 | Ga0207694_105054512 | 266 |
| 191 | 3300025927 | Ga0207687_10110492 | Ga0207687_101104922 | 266 |
| 192 | 3300025927 | Ga0207687_10135336 | Ga0207687_101353362 | 266 |
| 193 | 3300025941 | Ga0207711_10258230 | Ga0207711_102582302 | 266 |
| 194 | 3300025944 | Ga0207661_10047503 | Ga0207661_100475033 | 266 |
| 195 | 3300025944 | Ga0207661_10110241 | Ga0207661_101102412 | 266 |
| 196 | 3300026023 | Ga0207677_10077818 | Ga0207677_100778182 | 266 |
| 197 | 3300048904 | Ga0496101_0023201 | Ga0496101_0023201_918_1748 | 266 |
| 198 | 3300048904 | Ga0496101_0208195 | Ga0496101_0208195_553_1383 | 266 |
| 199 | 3300048905 | Ga0496102_0031631 | Ga0496102_0031631_2005_2835 | 266 |
| 200 | 3300048907 | Ga0496104_0085371 | Ga0496104_0085371_1202_2032 | 266 |
| 201 | 3300048908 | Ga0496105_0146246 | Ga0496105_0146246_1088_1918 | 266 |
| 202 | 3300048909 | Ga0496106_0110434 | Ga0496106_0110434_121_951 | 266 |
| 203 | 3300048909 | Ga0496106_0180421 | Ga0496106_0180421_471_1301 | 266 |
| 204 | 3300048910 | Ga0496107_0166724 | Ga0496107_0166724_62_892 | 266 |
| 205 | 3300048911 | Ga0496108_0084764 | Ga0496108_0084764_515_1345 | 266 |
| 206 | 3300048912 | Ga0496109_0059381 | Ga0496109_0059381_1421_2251 | 266 |
| 207 | 3300048912 | Ga0496109_0230459 | Ga0496109_0230459_436_1266 | 266 |
| 208 | 3300048913 | Ga0496110_0027113 | Ga0496110_0027113_1670_2500 | 266 |
| 209 | 3300048915 | Ga0496112_0185760 | Ga0496112_0185760_225_1055 | 266 |
| 210 | 3300048916 | Ga0496113_0137719 | Ga0496113_0137719_931_1761 | 266 |
| 211 | 3300048917 | Ga0496114_0014350 | Ga0496114_0014350_546_1376 | 266 |
| 212 | 3300048917 | Ga0496114_0086425 | Ga0496114_0086425_1351_2181 | 266 |
| 213 | 3300049583 | Ga0501067_0019048 | Ga0501067_0019048_186_1016 | 266 |
| 214 | 3300050496 | nmdc:mga07m45_112300_c1 | nmdc:mga07m45_112300_c1_309_1142 | 266 |
| 215 | 3300061734 | Ga0530510_0314662 | Ga0530510_0314662_211_1041 | 266 |
| 216 | iso_pu_bacteria | 2675903058 | 2676477768 | 266 |
| 217 | iso_pu_bacteria | 2827628540 | 2827629091 | 266 |
| 218 | 3300031728 | Ga0316578_10030032 | Ga0316578_100300322 | 267 |
| 219 | 3300032137 | Ga0316585_10021477 | Ga0316585_100214772 | 267 |
| 220 | 3300035398 | Ga0316574_0014024 | Ga0316574_0014024_901_1731 | 267 |
| 221 | 3300036647 | Ga0316582_0016333 | Ga0316582_0016333_1117_1947 | 267 |
| 222 | 3300036712 | Ga0316584_0039301 | Ga0316584_0039301_2242_3072 | 267 |
| 223 | 3300049568 | Ga0501031_0008373 | Ga0501031_0008373_3201_4061 | 268 |
| 224 | 3300049573 | Ga0501037_0038591 | Ga0501037_0038591_327_1187 | 268 |
| 225 | 3300049575 | Ga0501039_0001682 | Ga0501039_0001682_8434_9294 | 268 |
| 226 | 3300049577 | Ga0501041_0001577 | Ga0501041_0001577_2758_3618 | 268 |
| 227 | 3300049578 | Ga0501042_0005345 | Ga0501042_0005345_4021_4881 | 268 |
| 228 | 3300049580 | Ga0501046_0016486 | Ga0501046_0016486_5111_5971 | 268 |
| 229 | 3300049582 | Ga0501048_0290634 | Ga0501048_0290634_139_999 | 268 |
| 230 | 3300049584 | Ga0501068_0256919 | Ga0501068_0256919_134_994 | 268 |
| 231 | 3300049587 | Ga0501071_0016393 | Ga0501071_0016393_80_940 | 268 |
| 232 | 3300049588 | Ga0501072_0007113 | Ga0501072_0007113_2612_3472 | 268 |
| 233 | 3300049591 | Ga0501075_0127065 | Ga0501075_0127065_550_1410 | 268 |
| 234 | 3300049592 | Ga0501076_0029675 | Ga0501076_0029675_1691_2551 | 268 |
| 235 | 3300049593 | Ga0501077_0016778 | Ga0501077_0016778_3198_4058 | 268 |
| 236 | 3300049824 | Ga0501045_0005505 | Ga0501045_0005505_3618_4478 | 268 |
| 237 | 3300054114 | Ga0501084_0042614 | Ga0501084_0042614_1344_2204 | 268 |
| 238 | 3300059514 | Ga0587095_006594 | Ga0587095_006594_40_891 | 268 |
| 239 | 3300059626 | Ga0587115_002176 | Ga0587115_002176_274_1125 | 268 |
| 240 | 3300059630 | Ga0587128_021058 | Ga0587128_021058_64_915 | 268 |
| 241 | 3300060344 | Ga0587071_023939 | Ga0587071_023939_103_954 | 268 |
| 242 | 3300061734 | Ga0530510_0030456 | Ga0530510_0030456_1143_2003 | 268 |
| 243 | iso_pu_bacteria | 2622736605 | 2623498163 | 269 |
| 244 | iso_pu_bacteria | 2643221561 | 2643823964 | 269 |
| 245 | iso_pu_bacteria | 2643221604 | 2644033266 | 269 |
| 246 | iso_pu_bacteria | 2643221617 | 2644098211 | 269 |
| 247 | iso_pu_bacteria | 2643221620 | 2644119061 | 269 |
| 248 | iso_pu_bacteria | 2643221696 | 2644533240 | 269 |
| 249 | iso_pu_bacteria | 2811994874 | 2812334446 | 269 |
| 250 | iso_pu_bacteria | 2855386786 | 2855389398 | 269 |
| 251 | iso_pu_bacteria | 2915358134 | 2915361862 | 269 |
| 252 | 3300005843 | Ga0068860_100000408 | Ga0068860_10000040835 | 270 |
| 253 | 3300006038 | Ga0075365_10025770 | Ga0075365_100257702 | 270 |
| 254 | 3300006051 | Ga0075364_10007767 | Ga0075364_100077672 | 270 |
| 255 | 3300028381 | Ga0268264_10000462 | Ga0268264_1000046216 | 270 |
| 256 | 3300049569 | Ga0501032_0026746 | Ga0501032_0026746_2907_3746 | 270 |
| 257 | 3300049571 | Ga0501034_0013729 | Ga0501034_0013729_4464_5303 | 270 |
| 258 | 3300049572 | Ga0501036_0026528 | Ga0501036_0026528_3994_4833 | 270 |
| 259 | 3300049573 | Ga0501037_0004539 | Ga0501037_0004539_7887_8726 | 270 |
| 260 | 3300049574 | Ga0501038_0000471 | Ga0501038_0000471_23980_24819 | 270 |
| 261 | 3300049574 | Ga0501038_0007841 | Ga0501038_0007841_5380_6219 | 270 |
| 262 | 3300049578 | Ga0501042_0006187 | Ga0501042_0006187_5420_6259 | 270 |
| 263 | 3300049578 | Ga0501042_0091794 | Ga0501042_0091794_56_895 | 270 |
| 264 | 3300049579 | Ga0501043_0006124 | Ga0501043_0006124_6296_7135 | 270 |
| 265 | 3300049579 | Ga0501043_0024406 | Ga0501043_0024406_2020_2859 | 270 |
| 266 | 3300049580 | Ga0501046_0017420 | Ga0501046_0017420_2587_3426 | 270 |
| 267 | 3300049581 | Ga0501047_0004082 | Ga0501047_0004082_5679_6518 | 270 |
| 268 | 3300049584 | Ga0501068_0267143 | Ga0501068_0267143_81_920 | 270 |
| 269 | 3300049586 | Ga0501070_0038647 | Ga0501070_0038647_2812_3651 | 270 |
| 270 | 3300049742 | Ga0501080_0016637 | Ga0501080_0016637_2813_3652 | 270 |
| 271 | 3300049822 | Ga0501035_0021934 | Ga0501035_0021934_2364_3203 | 270 |
| 272 | 3300049822 | Ga0501035_0029670 | Ga0501035_0029670_3259_4098 | 270 |
| 273 | 3300049823 | Ga0501044_0077263 | Ga0501044_0077263_676_1515 | 270 |
| 274 | 3300050491 | nmdc:mga00v17_46663_c1 | nmdc:mga00v17_46663_c1_634_1467 | 270 |
| 275 | 3300050492 | nmdc:mga0yw44_10089_c1 | nmdc:mga0yw44_10089_c1_583_1416 | 270 |
| 276 | iso_pu_bacteria | 2515154155 | 2515852849 | 270 |
| 277 | iso_pu_bacteria | 2744054611 | 2744953444 | 270 |
| 278 | iso_pu_bacteria | 2816332305 | 2817508264 | 270 |
| 279 | iso_pu_bacteria | 2857481737 | 2857483973 | 270 |
| 280 | iso_pu_bacteria | 2857727296 | 2857729175 | 270 |
| 281 | 3300005981 | Ga0081538_10000099 | Ga0081538_1000009937 | 271 |
| 282 | 3300005981 | Ga0081538_10000252 | Ga0081538_100002523 | 271 |
| 283 | 3300005981 | Ga0081538_10019152 | Ga0081538_100191523 | 271 |
| 284 | 3300005981 | Ga0081538_10037561 | Ga0081538_100375613 | 271 |
| 285 | 3300005981 | Ga0081538_10037796 | Ga0081538_100377963 | 271 |
| 286 | 3300005981 | Ga0081538_10049339 | Ga0081538_100493392 | 271 |
| 287 | 3300005981 | Ga0081538_10096530 | Ga0081538_100965302 | 271 |
| 288 | 3300013306 | Ga0163162_10657106 | Ga0163162_106571062 | 271 |
| 289 | 3300031852 | Ga0307410_10025195 | Ga0307410_100251953 | 271 |
| 290 | 3300031852 | Ga0307410_10546442 | Ga0307410_105464421 | 271 |
| 291 | 3300032002 | Ga0307416_100315404 | Ga0307416_1003154042 | 271 |
| 292 | 3300032126 | Ga0307415_100165563 | Ga0307415_1001655631 | 271 |
| 293 | 3300038443 | Ga0395901_0006164 | Ga0395901_0006164_6113_6946 | 271 |
| 294 | 3300044765 | Ga0466970_0313949 | Ga0466970_0313949_11_844 | 271 |
| 295 | 3300045976 | Ga0466967_0227487 | Ga0466967_0227487_92_925 | 271 |
| 296 | 3300046500 | Ga0495596_0023074 | Ga0495596_0023074_1077_1904 | 271 |
| 297 | 3300046501 | Ga0495607_0140362 | Ga0495607_0140362_61_888 | 271 |
| 298 | 3300046518 | Ga0495631_0034710 | Ga0495631_0034710_1263_2096 | 271 |
| 299 | 3300046523 | Ga0495644_0049187 | Ga0495644_0049187_409_1236 | 271 |
| 300 | 3300046616 | Ga0495668_0041800 | Ga0495668_0041800_1609_2442 | 271 |
| 301 | 3300047445 | Ga0495677_0029231 | Ga0495677_0029231_224_1057 | 271 |
| 302 | 3300048906 | Ga0496103_0191635 | Ga0496103_0191635_440_1279 | 271 |
| 303 | 3300048920 | Ga0496117_0003750 | Ga0496117_0003750_16211_17050 | 271 |
| 304 | 3300048920 | Ga0496117_0047283 | Ga0496117_0047283_748_1587 | 271 |
| 305 | 3300048921 | Ga0496118_0002228 | Ga0496118_0002228_5694_6533 | 271 |
| 306 | 3300048923 | Ga0496120_0001095 | Ga0496120_0001095_8130_8969 | 271 |
| 307 | 3300048924 | Ga0496121_0048266 | Ga0496121_0048266_345_1184 | 271 |
| 308 | 3300048928 | Ga0496125_0141808 | Ga0496125_0141808_502_1341 | 271 |
| 309 | 3300049572 | Ga0501036_0102425 | Ga0501036_0102425_1534_2367 | 271 |
| 310 | 3300049586 | Ga0501070_0132686 | Ga0501070_0132686_201_1040 | 271 |
| 311 | 3300049588 | Ga0501072_0456642 | Ga0501072_0456642_91_924 | 271 |
| 312 | 3300049652 | Ga0501202_017121 | Ga0501202_017121_301_1134 | 271 |
| 313 | 3300049744 | Ga0501083_0032037 | Ga0501083_0032037_363_1202 | 271 |
| 314 | 3300049824 | Ga0501045_0018624 | Ga0501045_0018624_290_1123 | 271 |
| 315 | 3300053111 | Ga0500572_081222 | Ga0500572_081222_33_872 | 271 |
| 316 | 3300053134 | Ga0500658_0147705 | Ga0500658_0147705_49_888 | 271 |
| 317 | 3300054114 | Ga0501084_0034944 | Ga0501084_0034944_2476_3309 | 271 |
| 318 | 3300061734 | Ga0530510_0015414 | Ga0530510_0015414_3160_3993 | 271 |
| 319 | iso_pu_bacteria | 2643221641 | 2644231027 | 271 |
| 320 | iso_pu_bacteria | 3002998708 | 3003008363 | 271 |
| 321 | iso_pu_bacteria | 8053945823 | 8053948303 | 271 |
| 322 | iso_pu_bacteria | 8054609563 | 8054610275 | 271 |
| 323 | 3300005367 | Ga0070667_100021025 | Ga0070667_1000210252 | 272 |
| 324 | 3300005530 | Ga0070679_100001580 | Ga0070679_10000158013 | 272 |
| 325 | 3300005535 | Ga0070684_100451921 | Ga0070684_1004519212 | 272 |
| 326 | 3300005985 | Ga0081539_10079947 | Ga0081539_100799472 | 272 |
| 327 | 3300006038 | Ga0075365_10024565 | Ga0075365_100245653 | 272 |
| 328 | 3300006038 | Ga0075365_10045002 | Ga0075365_100450021 | 272 |
| 329 | 3300006844 | Ga0075428_100039164 | Ga0075428_1000391642 | 272 |
| 330 | 3300006847 | Ga0075431_100079606 | Ga0075431_1000796062 | 272 |
| 331 | 3300009101 | Ga0105247_10152885 | Ga0105247_101528852 | 272 |
| 332 | 3300009147 | Ga0114129_10142119 | Ga0114129_101421192 | 272 |
| 333 | 3300010375 | Ga0105239_10029888 | Ga0105239_100298884 | 272 |
| 334 | 3300010375 | Ga0105239_10343406 | Ga0105239_103434062 | 272 |
| 335 | 3300013306 | Ga0163162_10943039 | Ga0163162_109430392 | 272 |
| 336 | 3300025921 | Ga0207652_10001806 | Ga0207652_1000180612 | 272 |
| 337 | 3300025944 | Ga0207661_10013016 | Ga0207661_100130164 | 272 |
| 338 | 3300025986 | Ga0207658_10014492 | Ga0207658_100144922 | 272 |
| 339 | 3300026067 | Ga0207678_10008271 | Ga0207678_100082717 | 272 |
| 340 | 3300027907 | Ga0207428_10013868 | Ga0207428_100138685 | 272 |
| 341 | 3300028379 | Ga0268266_10001442 | Ga0268266_1000144219 | 272 |
| 342 | 3300041494 | Ga0451837_0709787 | Ga0451837_0709787_366_1364 | 272 |
| 343 | 3300041512 | Ga0451853_0179873 | Ga0451853_0179873_316_1314 | 272 |
| 344 | 3300042008 | Ga0439450_000910 | Ga0439450_000910_251_1084 | 272 |
| 345 | 3300042011 | Ga0439454_000412 | Ga0439454_000412_2069_2902 | 272 |
| 346 | 3300042016 | Ga0439463_020173 | Ga0439463_020173_691_1524 | 272 |
| 347 | 3300042126 | Ga0450888_001276 | Ga0450888_001276_1183_2010 | 272 |
| 348 | 3300042139 | Ga0450904_001543 | Ga0450904_001543_647_1480 | 272 |
| 349 | 3300042144 | Ga0450889_001591 | Ga0450889_001591_1073_1906 | 272 |
| 350 | 3300042461 | Ga0439460_0002451 | Ga0439460_0002451_2761_3594 | 272 |
| 351 | 3300042530 | Ga0450916_000357 | Ga0450916_000357_2265_3098 | 272 |
| 352 | 3300046794 | Ga0495589_0138460 | Ga0495589_0138460_146_976 | 272 |
| 353 | 3300048907 | Ga0496104_0139836 | Ga0496104_0139836_1017_1859 | 272 |
| 354 | 3300048910 | Ga0496107_0179678 | Ga0496107_0179678_233_1075 | 272 |
| 355 | 3300048922 | Ga0496119_0006062 | Ga0496119_0006062_3250_4092 | 272 |
| 356 | 3300048924 | Ga0496121_0012885 | Ga0496121_0012885_4883_5725 | 272 |
| 357 | 3300049568 | Ga0501031_0005090 | Ga0501031_0005090_5730_6572 | 272 |
| 358 | 3300049569 | Ga0501032_0002074 | Ga0501032_0002074_1524_2366 | 272 |
| 359 | 3300049570 | Ga0501033_0000226 | Ga0501033_0000226_13449_14291 | 272 |
| 360 | 3300049571 | Ga0501034_0012489 | Ga0501034_0012489_7881_8723 | 272 |
| 361 | 3300049572 | Ga0501036_0000099 | Ga0501036_0000099_13455_14297 | 272 |
| 362 | 3300049573 | Ga0501037_0000590 | Ga0501037_0000590_1641_2483 | 272 |
| 363 | 3300049574 | Ga0501038_0002860 | Ga0501038_0002860_1778_2620 | 272 |
| 364 | 3300049575 | Ga0501039_0075941 | Ga0501039_0075941_351_1193 | 272 |
| 365 | 3300049576 | Ga0501040_0118355 | Ga0501040_0118355_639_1481 | 272 |
| 366 | 3300049578 | Ga0501042_0011757 | Ga0501042_0011757_395_1237 | 272 |
| 367 | 3300049579 | Ga0501043_0000456 | Ga0501043_0000456_22136_22978 | 272 |
| 368 | 3300049579 | Ga0501043_0164887 | Ga0501043_0164887_335_1177 | 272 |
| 369 | 3300049580 | Ga0501046_0002889 | Ga0501046_0002889_13462_14304 | 272 |
| 370 | 3300049581 | Ga0501047_0000548 | Ga0501047_0000548_19154_19996 | 272 |
| 371 | 3300049581 | Ga0501047_0006490 | Ga0501047_0006490_6583_7425 | 272 |
| 372 | 3300049582 | Ga0501048_0007225 | Ga0501048_0007225_5957_6799 | 272 |
| 373 | 3300049584 | Ga0501068_0040122 | Ga0501068_0040122_1336_2178 | 272 |
| 374 | 3300049585 | Ga0501069_0005561 | Ga0501069_0005561_1511_2353 | 272 |
| 375 | 3300049586 | Ga0501070_0000220 | Ga0501070_0000220_39858_40700 | 272 |
| 376 | 3300049588 | Ga0501072_0015945 | Ga0501072_0015945_3750_4601 | 272 |
| 377 | 3300049589 | Ga0501073_0029543 | Ga0501073_0029543_1460_2302 | 272 |
| 378 | 3300049741 | Ga0501079_0016656 | Ga0501079_0016656_3846_4688 | 272 |
| 379 | 3300049742 | Ga0501080_0012460 | Ga0501080_0012460_1457_2299 | 272 |
| 380 | 3300049742 | Ga0501080_0211935 | Ga0501080_0211935_337_1188 | 272 |
| 381 | 3300049744 | Ga0501083_0006808 | Ga0501083_0006808_5869_6711 | 272 |
| 382 | 3300049822 | Ga0501035_0000341 | Ga0501035_0000341_39809_40651 | 272 |
| 383 | 3300049823 | Ga0501044_0004112 | Ga0501044_0004112_13499_14341 | 272 |
| 384 | 3300050491 | nmdc:mga00v17_158662_c1 | nmdc:mga00v17_158662_c1_456_1298 | 272 |
| 385 | 3300050492 | nmdc:mga0yw44_102450_c1 | nmdc:mga0yw44_102450_c1_972_1814 | 272 |
| 386 | 3300050509 | nmdc:mga0qj67_44288_c1 | nmdc:mga0qj67_44288_c1_1092_1931 | 272 |
| 387 | 3300050510 | nmdc:mga06r32_81068_c1 | nmdc:mga06r32_81068_c1_1489_2328 | 272 |
| 388 | 3300059504 | Ga0587082_005954 | Ga0587082_005954_375_1223 | 272 |
| 389 | 3300060353 | Ga0501082_0024164 | Ga0501082_0024164_2777_3619 | 272 |
| 390 | 3300060353 | Ga0501082_0167663 | Ga0501082_0167663_42_893 | 272 |
| 391 | iso_pu_bacteria | 2643221961 | 2645722985 | 272 |
| 392 | 3300006048 | Ga0075363_100049876 | Ga0075363_1000498762 | 273 |
| 393 | 3300006051 | Ga0075364_10044043 | Ga0075364_100440432 | 273 |
| 394 | 3300006178 | Ga0075367_10048383 | Ga0075367_100483832 | 273 |
| 395 | 3300031824 | Ga0307413_10117285 | Ga0307413_101172852 | 273 |
| 396 | 3300031995 | Ga0307409_100897850 | Ga0307409_1008978501 | 273 |
| 397 | 3300032002 | Ga0307416_100109175 | Ga0307416_1001091752 | 273 |
| 398 | 3300032002 | Ga0307416_100182608 | Ga0307416_1001826082 | 273 |
| 399 | 3300032004 | Ga0307414_10534818 | Ga0307414_105348182 | 273 |
| 400 | 3300037418 | Ga0395900_0045588 | Ga0395900_0045588_1024_1857 | 273 |
| 401 | 3300038443 | Ga0395901_0299201 | Ga0395901_0299201_169_1002 | 273 |
| 402 | 3300041494 | Ga0451837_1454732 | Ga0451837_1454732_133_996 | 273 |
| 403 | 3300044706 | Ga0466964_0079245 | Ga0466964_0079245_30_881 | 273 |
| 404 | 3300044765 | Ga0466970_0035320 | Ga0466970_0035320_758_1633 | 273 |
| 405 | 3300045976 | Ga0466967_0052332 | Ga0466967_0052332_63_914 | 273 |
| 406 | 3300045976 | Ga0466967_0267368 | Ga0466967_0267368_101_952 | 273 |
| 407 | 3300046477 | Ga0495664_0008832 | Ga0495664_0008832_3203_4033 | 273 |
| 408 | 3300048908 | Ga0496105_0246426 | Ga0496105_0246426_551_1399 | 273 |
| 409 | 3300048912 | Ga0496109_0005488 | Ga0496109_0005488_7363_8211 | 273 |
| 410 | 3300049572 | Ga0501036_0076861 | Ga0501036_0076861_10_840 | 273 |
| 411 | 3300049572 | Ga0501036_0250061 | Ga0501036_0250061_352_1182 | 273 |
| 412 | 3300049575 | Ga0501039_0045419 | Ga0501039_0045419_1086_1916 | 273 |
| 413 | 3300049588 | Ga0501072_0145712 | Ga0501072_0145712_125_955 | 273 |
| 414 | 3300049824 | Ga0501045_0061130 | Ga0501045_0061130_479_1309 | 273 |
| 415 | 3300050490 | nmdc:mga03n38_54150_c1 | nmdc:mga03n38_54150_c1_26_856 | 273 |
| 416 | 3300050491 | nmdc:mga00v17_169776_c1 | nmdc:mga00v17_169776_c1_303_1136 | 273 |
| 417 | 3300050492 | nmdc:mga0yw44_23417_c1 | nmdc:mga0yw44_23417_c1_355_1185 | 273 |
| 418 | 3300050492 | nmdc:mga0yw44_795_c1 | nmdc:mga0yw44_795_c1_4214_5047 | 273 |
| 419 | 3300053077 | Ga0495601_0034461 | Ga0495601_0034461_970_1800 | 273 |
| 420 | 3300053140 | Ga0500573_0008115 | Ga0500573_0008115_1242_2075 | 273 |
| 421 | 3300059491 | Ga0587070_021489 | Ga0587070_021489_17_868 | 273 |
| 422 | 3300059503 | Ga0587080_009301 | Ga0587080_009301_482_1333 | 273 |
| 423 | 3300059511 | Ga0587091_010351 | Ga0587091_010351_435_1286 | 273 |
| 424 | 3300059642 | Ga0587069_005574 | Ga0587069_005574_39_896 | 273 |
| 425 | 3300059643 | Ga0587072_003276 | Ga0587072_003276_110_967 | 273 |
| 426 | 3300059647 | Ga0587079_002826 | Ga0587079_002826_957_1814 | 273 |
| 427 | iso_pu_bacteria | 2643221576 | 2643890221 | 273 |
| 428 | iso_pu_bacteria | 2643221590 | 2643959277 | 273 |
| 429 | iso_pu_bacteria | 2643221657 | 2644323059 | 273 |
| 430 | iso_pu_bacteria | 2643221681 | 2644458111 | 273 |
| 431 | iso_pu_bacteria | 2643221687 | 2644486896 | 273 |
| 432 | iso_pu_bacteria | 2643221962 | 2645725940 | 273 |
| 433 | iso_pu_bacteria | 2739367898 | 2740166364 | 273 |
| 434 | iso_pu_bacteria | 2902837492 | 2902841789 | 273 |
| 435 | iso_pu_bacteria | 2984592036 | 2984594170 | 273 |
| 436 | iso_pu_bacteria | 2990256926 | 2990257361 | 273 |
| 437 | 3300002077 | JGI24744J21845_10000078 | JGI24744J21845_100000789 | 274 |
| 438 | 3300002244 | JGI24742J22300_10000523 | JGI24742J22300_100005234 | 274 |
| 439 | 3300003792 | Ga0055540_1029007 | Ga0055540_10290072 | 274 |
| 440 | 3300003792 | Ga0055540_1044808 | Ga0055540_10448081 | 274 |
| 441 | 3300005328 | Ga0070676_10002380 | Ga0070676_100023805 | 274 |
| 442 | 3300005330 | Ga0070690_100006999 | Ga0070690_1000069995 | 274 |
| 443 | 3300005335 | Ga0070666_10022138 | Ga0070666_100221382 | 274 |
| 444 | 3300005337 | Ga0070682_100057891 | Ga0070682_1000578912 | 274 |
| 445 | 3300005338 | Ga0068868_100018801 | Ga0068868_1000188014 | 274 |
| 446 | 3300005340 | Ga0070689_100003899 | Ga0070689_1000038996 | 274 |
| 447 | 3300005341 | Ga0070691_10002225 | Ga0070691_100022255 | 274 |
| 448 | 3300005343 | Ga0070687_100030099 | Ga0070687_1000300992 | 274 |
| 449 | 3300005345 | Ga0070692_10039994 | Ga0070692_100399943 | 274 |
| 450 | 3300005347 | Ga0070668_100009628 | Ga0070668_1000096284 | 274 |
| 451 | 3300005353 | Ga0070669_100003754 | Ga0070669_1000037542 | 274 |
| 452 | 3300005356 | Ga0070674_100002737 | Ga0070674_1000027376 | 274 |
| 453 | 3300005366 | Ga0070659_100142478 | Ga0070659_1001424781 | 274 |
| 454 | 3300005367 | Ga0070667_100008109 | Ga0070667_1000081095 | 274 |
| 455 | 3300005406 | Ga0070703_10009690 | Ga0070703_100096902 | 274 |
| 456 | 3300005434 | Ga0070709_10005377 | Ga0070709_100053773 | 274 |
| 457 | 3300005437 | Ga0070710_10001581 | Ga0070710_100015816 | 274 |
| 458 | 3300005438 | Ga0070701_10000838 | Ga0070701_100008385 | 274 |
| 459 | 3300005439 | Ga0070711_100001170 | Ga0070711_1000011705 | 274 |
| 460 | 3300005440 | Ga0070705_100009208 | Ga0070705_1000092085 | 274 |
| 461 | 3300005441 | Ga0070700_100002020 | Ga0070700_1000020205 | 274 |
| 462 | 3300005444 | Ga0070694_100002677 | Ga0070694_1000026775 | 274 |
| 463 | 3300005455 | Ga0070663_100006355 | Ga0070663_1000063555 | 274 |
| 464 | 3300005456 | Ga0070678_100001750 | Ga0070678_1000017507 | 274 |
| 465 | 3300005457 | Ga0070662_100001556 | Ga0070662_1000015569 | 274 |
| 466 | 3300005459 | Ga0068867_100001095 | Ga0068867_1000010955 | 274 |
| 467 | 3300005539 | Ga0068853_100009119 | Ga0068853_1000091196 | 274 |
| 468 | 3300005543 | Ga0070672_100388643 | Ga0070672_1003886432 | 274 |
| 469 | 3300005545 | Ga0070695_100009155 | Ga0070695_1000091555 | 274 |
| 470 | 3300005546 | Ga0070696_100001977 | Ga0070696_1000019774 | 274 |
| 471 | 3300005548 | Ga0070665_100053510 | Ga0070665_1000535101 | 274 |
| 472 | 3300005549 | Ga0070704_100025332 | Ga0070704_1000253323 | 274 |
| 473 | 3300005563 | Ga0068855_100013782 | Ga0068855_1000137824 | 274 |
| 474 | 3300005578 | Ga0068854_100001489 | Ga0068854_10000148910 | 274 |
| 475 | 3300005614 | Ga0068856_100160954 | Ga0068856_1001609542 | 274 |
| 476 | 3300005615 | Ga0070702_100001146 | Ga0070702_1000011465 | 274 |
| 477 | 3300005615 | Ga0070702_100057973 | Ga0070702_1000579731 | 274 |
| 478 | 3300005616 | Ga0068852_100045801 | Ga0068852_1000458013 | 274 |
| 479 | 3300005616 | Ga0068852_100394343 | Ga0068852_1003943432 | 274 |
| 480 | 3300005617 | Ga0068859_100005669 | Ga0068859_1000056699 | 274 |
| 481 | 3300005718 | Ga0068866_10001545 | Ga0068866_100015456 | 274 |
| 482 | 3300005719 | Ga0068861_100005782 | Ga0068861_1000057825 | 274 |
| 483 | 3300005842 | Ga0068858_100007701 | Ga0068858_1000077015 | 274 |
| 484 | 3300005843 | Ga0068860_100004270 | Ga0068860_1000042707 | 274 |
| 485 | 3300005844 | Ga0068862_100024677 | Ga0068862_1000246771 | 274 |
| 486 | 3300006163 | Ga0070715_10001041 | Ga0070715_100010414 | 274 |
| 487 | 3300006173 | Ga0070716_100008509 | Ga0070716_1000085094 | 274 |
| 488 | 3300006175 | Ga0070712_100000937 | Ga0070712_1000009375 | 274 |
| 489 | 3300006881 | Ga0068865_100003697 | Ga0068865_1000036975 | 274 |
| 490 | 3300006881 | Ga0068865_100259268 | Ga0068865_1002592682 | 274 |
| 491 | 3300006931 | Ga0097620_100005669 | Ga0097620_1000056699 | 274 |
| 492 | 3300009092 | Ga0105250_10037625 | Ga0105250_100376252 | 274 |
| 493 | 3300009093 | Ga0105240_10849346 | Ga0105240_108493461 | 274 |
| 494 | 3300009098 | Ga0105245_10011878 | Ga0105245_100118783 | 274 |
| 495 | 3300009101 | Ga0105247_10001851 | Ga0105247_100018515 | 274 |
| 496 | 3300009148 | Ga0105243_10014535 | Ga0105243_100145355 | 274 |
| 497 | 3300009176 | Ga0105242_10003909 | Ga0105242_100039096 | 274 |
| 498 | 3300009545 | Ga0105237_10023851 | Ga0105237_100238513 | 274 |
| 499 | 3300009551 | Ga0105238_10142663 | Ga0105238_101426632 | 274 |
| 500 | 3300009553 | Ga0105249_10006429 | Ga0105249_100064297 | 274 |
| 501 | 3300010375 | Ga0105239_10016028 | Ga0105239_100160284 | 274 |
| 502 | 3300013105 | Ga0157369_10030343 | Ga0157369_100303433 | 274 |
| 503 | 3300013297 | Ga0157378_10003234 | Ga0157378_100032345 | 274 |
| 504 | 3300013306 | Ga0163162_10010330 | Ga0163162_100103304 | 274 |
| 505 | 3300013307 | Ga0157372_10003899 | Ga0157372_100038994 | 274 |
| 506 | 3300013308 | Ga0157375_10002098 | Ga0157375_1000209813 | 274 |
| 507 | 3300014326 | Ga0157380_10003529 | Ga0157380_100035296 | 274 |
| 508 | 3300014968 | Ga0157379_10038287 | Ga0157379_100382874 | 274 |
| 509 | 3300017792 | Ga0163161_10005680 | Ga0163161_100056806 | 274 |
| 510 | 3300017792 | Ga0163161_10009991 | Ga0163161_100099912 | 274 |
| 511 | 3300025303 | Ga0209051_1003121 | Ga0209051_10031212 | 274 |
| 512 | 3300025303 | Ga0209051_1003771 | Ga0209051_10037712 | 274 |
| 513 | 3300025303 | Ga0209051_1032521 | Ga0209051_10325212 | 274 |
| 514 | 3300025885 | Ga0207653_10006916 | Ga0207653_100069162 | 274 |
| 515 | 3300025898 | Ga0207692_10001621 | Ga0207692_100016214 | 274 |
| 516 | 3300025899 | Ga0207642_10001089 | Ga0207642_100010894 | 274 |
| 517 | 3300025901 | Ga0207688_10001131 | Ga0207688_100011318 | 274 |
| 518 | 3300025901 | Ga0207688_10101463 | Ga0207688_101014632 | 274 |
| 519 | 3300025904 | Ga0207647_10070388 | Ga0207647_100703882 | 274 |
| 520 | 3300025906 | Ga0207699_10016517 | Ga0207699_100165173 | 274 |
| 521 | 3300025907 | Ga0207645_10011031 | Ga0207645_100110315 | 274 |
| 522 | 3300025909 | Ga0207705_10195114 | Ga0207705_101951142 | 274 |
| 523 | 3300025915 | Ga0207693_10002173 | Ga0207693_100021735 | 274 |
| 524 | 3300025916 | Ga0207663_10013617 | Ga0207663_100136172 | 274 |
| 525 | 3300025918 | Ga0207662_10007411 | Ga0207662_100074114 | 274 |
| 526 | 3300025919 | Ga0207657_10072767 | Ga0207657_100727673 | 274 |
| 527 | 3300025923 | Ga0207681_10003723 | Ga0207681_100037234 | 274 |
| 528 | 3300025926 | Ga0207659_10203763 | Ga0207659_102037632 | 274 |
| 529 | 3300025927 | Ga0207687_10030335 | Ga0207687_100303352 | 274 |
| 530 | 3300025932 | Ga0207690_10019121 | Ga0207690_100191212 | 274 |
| 531 | 3300025933 | Ga0207706_10002932 | Ga0207706_100029328 | 274 |
| 532 | 3300025933 | Ga0207706_10049707 | Ga0207706_100497073 | 274 |
| 533 | 3300025934 | Ga0207686_10003255 | Ga0207686_100032555 | 274 |
| 534 | 3300025935 | Ga0207709_10001833 | Ga0207709_100018336 | 274 |
| 535 | 3300025935 | Ga0207709_10117591 | Ga0207709_101175912 | 274 |
| 536 | 3300025936 | Ga0207670_10527087 | Ga0207670_105270871 | 274 |
| 537 | 3300025937 | Ga0207669_10000720 | Ga0207669_100007205 | 274 |
| 538 | 3300025938 | Ga0207704_10001891 | Ga0207704_100018915 | 274 |
| 539 | 3300025939 | Ga0207665_10001201 | Ga0207665_100012015 | 274 |
| 540 | 3300025940 | Ga0207691_10016370 | Ga0207691_100163704 | 274 |
| 541 | 3300025940 | Ga0207691_10145693 | Ga0207691_101456932 | 274 |
| 542 | 3300025941 | Ga0207711_10109034 | Ga0207711_101090342 | 274 |
| 543 | 3300025945 | Ga0207679_10030500 | Ga0207679_100305003 | 274 |
| 544 | 3300025949 | Ga0207667_10102225 | Ga0207667_101022253 | 274 |
| 545 | 3300025961 | Ga0207712_10005996 | Ga0207712_100059964 | 274 |
| 546 | 3300025972 | Ga0207668_10001945 | Ga0207668_100019453 | 274 |
| 547 | 3300025981 | Ga0207640_10014765 | Ga0207640_100147655 | 274 |
| 548 | 3300025986 | Ga0207658_10007194 | Ga0207658_100071945 | 274 |
| 549 | 3300026023 | Ga0207677_10003405 | Ga0207677_100034054 | 274 |
| 550 | 3300026035 | Ga0207703_10006972 | Ga0207703_100069724 | 274 |
| 551 | 3300026041 | Ga0207639_10068629 | Ga0207639_100686292 | 274 |
| 552 | 3300026067 | Ga0207678_10021113 | Ga0207678_100211135 | 274 |
| 553 | 3300026067 | Ga0207678_10183035 | Ga0207678_101830352 | 274 |
| 554 | 3300026075 | Ga0207708_10004491 | Ga0207708_100044914 | 274 |
| 555 | 3300026075 | Ga0207708_10022542 | Ga0207708_100225423 | 274 |
| 556 | 3300026089 | Ga0207648_10003448 | Ga0207648_1000344812 | 274 |
| 557 | 3300026118 | Ga0207675_100008624 | Ga0207675_1000086245 | 274 |
| 558 | 3300026121 | Ga0207683_10002390 | Ga0207683_100023905 | 274 |
| 559 | 3300026121 | Ga0207683_10411908 | Ga0207683_104119082 | 274 |
| 560 | 3300026142 | Ga0207698_10025039 | Ga0207698_100250393 | 274 |
| 561 | 3300028380 | Ga0268265_10007297 | Ga0268265_100072975 | 274 |
| 562 | 3300028381 | Ga0268264_10016161 | Ga0268264_100161614 | 274 |
| 563 | 3300031727 | Ga0316576_10016068 | Ga0316576_100160683 | 274 |
| 564 | 3300031728 | Ga0316578_10083523 | Ga0316578_100835231 | 274 |
| 565 | 3300031733 | Ga0316577_10241125 | Ga0316577_102411252 | 274 |
| 566 | 3300035398 | Ga0316574_0002209 | Ga0316574_0002209_3615_4439 | 274 |
| 567 | 3300035691 | Ga0373931_0004469 | Ga0373931_0004469_3113_3937 | 274 |
| 568 | 3300037418 | Ga0395900_0501324 | Ga0395900_0501324_152_985 | 274 |
| 569 | 3300038443 | Ga0395901_0100709 | Ga0395901_0100709_245_1078 | 274 |
| 570 | 3300041452 | Ga0451793_0537355 | Ga0451793_0537355_265_1098 | 274 |
| 571 | 3300041453 | Ga0451797_0088653 | Ga0451797_0088653_62_886 | 274 |
| 572 | 3300044684 | Ga0466966_0087224 | Ga0466966_0087224_1055_1888 | 274 |
| 573 | 3300044842 | Ga0466957_0280022 | Ga0466957_0280022_162_995 | 274 |
| 574 | 3300045049 | Ga0466959_0080552 | Ga0466959_0080552_843_1676 | 274 |
| 575 | 3300045976 | Ga0466967_0000277 | Ga0466967_0000277_18882_19715 | 274 |
| 576 | 3300048903 | Ga0496100_0007952 | Ga0496100_0007952_2523_3347 | 274 |
| 577 | 3300048904 | Ga0496101_0001637 | Ga0496101_0001637_3253_4077 | 274 |
| 578 | 3300048905 | Ga0496102_0013670 | Ga0496102_0013670_4773_5597 | 274 |
| 579 | 3300048906 | Ga0496103_0003564 | Ga0496103_0003564_2534_3358 | 274 |
| 580 | 3300048909 | Ga0496106_0002377 | Ga0496106_0002377_3449_4273 | 274 |
| 581 | 3300048910 | Ga0496107_0005618 | Ga0496107_0005618_4392_5216 | 274 |
| 582 | 3300048911 | Ga0496108_0037963 | Ga0496108_0037963_657_1490 | 274 |
| 583 | 3300048917 | Ga0496114_0004158 | Ga0496114_0004158_3549_4373 | 274 |
| 584 | 3300048917 | Ga0496114_0454190 | Ga0496114_0454190_217_1050 | 274 |
| 585 | 3300048918 | Ga0496115_0007933 | Ga0496115_0007933_3814_4638 | 274 |
| 586 | 3300048922 | Ga0496119_0117703 | Ga0496119_0117703_187_1020 | 274 |
| 587 | 3300049590 | Ga0501074_0342420 | Ga0501074_0342420_86_919 | 274 |
| 588 | 3300049591 | Ga0501075_0323333 | Ga0501075_0323333_17_844 | 274 |
| 589 | 3300050492 | nmdc:mga0yw44_75456_c1 | nmdc:mga0yw44_75456_c1_1156_2022 | 274 |
| 590 | 3300050496 | nmdc:mga07m45_311280_c1 | nmdc:mga07m45_311280_c1_31_864 | 274 |
| 591 | 3300053153 | Ga0500616_0008327 | Ga0500616_0008327_1517_2350 | 274 |
| 592 | 3300061734 | Ga0530510_0149072 | Ga0530510_0149072_773_1600 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
138
323
0.89
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.9237 | 2 | 265 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.9105 | 2 | 265 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.893 | 1 | 270 |
| 8hpr-assembly1.cif.gz_B | lpqy-sugabc in state 4 | 0.8881 | 2 | 258 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8807 | 1 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9219 | 3 | 264 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9205 | 4 | 264 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9105 | 4 | 264 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9024 | 2 | 260 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9011 | 3 | 264 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A562DLR8-F1-model_v4 | Multiple sugar transport system permease protein | 0.965 | 2 | 244 |
GO:0005886
GO:0055085 |
| AF-A0A836RFT6-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9493 | 1 | 253 |
GO:0005886
GO:0055085 |
| AF-A0A0R2Q3N9-F1-model_v4 | Sugar ABC transporter permease | 0.9476 | 2 | 240 |
GO:0005886
GO:0055085 |
| AF-A0A7Y0L3M8-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9469 | 1 | 274 |
GO:0005886
GO:0055085 |
| AF-A0A6I7P3W8-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9469 | 16 | 259 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar