F467056

General Info

Members Datasets Scaffolds Average Seq Length
591 357 520 308

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10025325|Ga0265327_100253254
Length 319
Sequence MTKHIRRVAVVQAGSAMFDTPRTLERMQSHCEAAASQALDLVVFPEAYIGGYPKGLDFGARVGTRSAAGREEYLRYWESAIDVPGPETARIGEYAANIGATLVVGVIERDAGTLYCTALFFTPAGALQSKHRKLMPTAMERLIWGFGDGSTLPVIDTPAGRVAAAICWENYMPNLRSALYAGGTQFWCAPTVDDRDVWQASMRHIAVEGRCFVASACQYMLRADAPADYDCMQGNDPDTVLIRGGSVIVSPLGEILAGPLYGTEGLLVADADLSDHTRGKYDLDVTGHYARPDVFQLTVNRSVQAAVADRAPGAHVELK

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231021 Pseudomonas sp. GM78 Isolate Nodule
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2519103095 Burkholderia sp. KJ006 Isolate Nodule
14 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
15 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
16 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
17 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
20 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
21 2643221609 Acidovorax sp. Root217 Isolate Unclassified
22 2643221611 Acidovorax sp. Root219 Isolate Unclassified
23 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
24 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
25 2738543012 Acidovorax sp. CF301 Isolate Unclassified
26 2773857670 Pseudomonas sp. 478 Isolate Unclassified
27 2784132072 Pseudomonas sp. 460 Isolate Unclassified
28 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
29 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
30 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
31 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
32 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
33 2816332133 Acidovorax radicis 2721A Isolate Unclassified
34 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
35 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
36 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
37 2818991452 Burkholderia cepacia 561 Isolate Unclassified
38 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
39 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
40 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
41 2858950400 Achromobacter sp. K91 Isolate Unclassified
42 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
43 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
44 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
45 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
46 2904504865 Serratia marcescens 1822 Isolate Unclassified
47 2904564687 Burkholderia sp. 571 Isolate Unclassified
48 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
49 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
50 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
51 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
52 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
53 2928163908 Burkholderia sp. 567 Isolate Unclassified
54 2928170801 Burkholderia sp. 572 Isolate Unclassified
55 2928536128 Burkholderia sola 565 Isolate Unclassified
56 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
57 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
58 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
59 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
63 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
64 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
94 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
95 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
220 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
221 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
222 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
223 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
245 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
337 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
338 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
346 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
347 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
348 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
349 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
350 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
351 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
352 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
353 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
354 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
355 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
356 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
357 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.99
Metatranscriptomes 0
Isolates 12.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 1.02
Rhizoplane 2.71
Rhizosphere 79.53
Stem 0
Stem Tuber 0.17
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019145 3300001989 Bacteria 2454
2 JGI24735J21928_10069460 3300002067 Bacteria 1009
3 JGI25162J39368_1000051 3300002737 Bacteria 156765
4 JGI25163J39215_1000030 3300002771 Bacteria 65586
5 JGI25164J39214_1000027 3300002772 Bacteria 156759
6 JGI25165J46597_1000101 3300003214 Bacteria 156765
7 Ga0055529_1000783 3300003763 Bacteria 19677
8 Ga0055536_1003447 3300003781 Bacteria 8482
9 Ga0055536_1012362 3300003781 Bacteria 3174
10 Ga0055528_1004283 3300003790 Bacteria 6900
11 Ga0055530_10007923 3300003791 Bacteria 4356
12 Ga0055540_1000420 3300003792 Bacteria 33992
13 Ga0055540_1000492 3300003792 Bacteria 30076
14 Ga0055531_10000309 3300003794 Bacteria 48285
15 Ga0065714_10003773 3300005288 Bacteria 10311
16 Ga0065714_10013835 3300005288 Bacteria 1952
17 Ga0065714_10018286 3300005288 Bacteria 2225
18 Ga0065712_10002138 3300005290 Bacteria 5861
19 Ga0065712_10075821 3300005290 Bacteria 3783
20 Ga0065715_10096779 3300005293 Bacteria 3820
21 Ga0070658_10050471 3300005327 Bacteria 3372
22 Ga0070676_10008160 3300005328 Bacteria 5633
23 Ga0070683_100092802 3300005329 Bacteria 2836
24 Ga0070690_100007404 3300005330 Bacteria 6287
25 Ga0070670_100011258 3300005331 Bacteria 7646
26 Ga0068869_100005075 3300005334 Bacteria 8254
27 Ga0070682_100087022 3300005337 Bacteria 2036
28 Ga0068868_100047158 3300005338 Bacteria 3375
29 Ga0070660_100000032 3300005339 Bacteria 85304
30 Ga0070689_100001773 3300005340 Bacteria 13844
31 Ga0070687_100001091 3300005343 Bacteria 9326
32 Ga0070661_100004510 3300005344 Bacteria 9588
33 Ga0070692_10021763 3300005345 Bacteria 3122
34 Ga0070669_100032108 3300005353 Bacteria 3793
35 Ga0070675_100020801 3300005354 Bacteria 5237
36 Ga0070673_100000964 3300005364 Bacteria 16319
37 Ga0070688_100015862 3300005365 Bacteria 4295
38 Ga0070659_100000035 3300005366 Bacteria 115022
39 Ga0070701_10064522 3300005438 Bacteria 1941
40 Ga0070705_100022729 3300005440 Bacteria 3355
41 Ga0070700_100072775 3300005441 Bacteria 2198
42 Ga0070694_100022460 3300005444 Bacteria 4042
43 Ga0070663_100001341 3300005455 Bacteria 13444
44 Ga0070662_100031143 3300005457 Bacteria 3741
45 Ga0070662_100074061 3300005457 Bacteria 2518
46 Ga0068867_100007456 3300005459 Bacteria 7738
47 Ga0070685_10018645 3300005466 Bacteria 3735
48 Ga0070684_100005098 3300005535 Bacteria 10037
49 Ga0070686_100003171 3300005544 Bacteria 9000
50 Ga0070665_100231753 3300005548 Bacteria 1847
51 Ga0070664_100003939 3300005564 Bacteria 11974
52 Ga0070702_100244755 3300005615 Bacteria 1212
53 Ga0068852_100039241 3300005616 Bacteria 3985
54 Ga0068859_100002841 3300005617 Bacteria 17568
55 Ga0068864_100013233 3300005618 Bacteria 6833
56 Ga0068861_100001395 3300005719 Bacteria 15176
57 Ga0068861_100007235 3300005719 Bacteria 7605
58 Ga0068863_100004099 3300005841 Bacteria 14394
59 Ga0068860_100081077 3300005843 Bacteria 3086
60 Ga0068862_100002154 3300005844 Bacteria 17709
61 Ga0075432_10000949 3300006058 Bacteria 9146
62 Ga0075432_10013134 3300006058 Bacteria 2814
63 Ga0068871_100060188 3300006358 Bacteria 3097
64 Ga0075428_100034198 3300006844 Bacteria 5608
65 Ga0075428_100082352 3300006844 Bacteria 3511
66 Ga0075431_100000002 3300006847 Bacteria 153069
67 Ga0075429_100017681 3300006880 Bacteria 6166
68 Ga0075429_100052780 3300006880 Bacteria 3537
69 Ga0097620_100002841 3300006931 Bacteria 17568
70 Ga0105251_10005374 3300009011 Bacteria 8394
71 Ga0105244_10015632 3300009036 Bacteria 4347
72 Ga0105244_10019652 3300009036 Bacteria 3765
73 Ga0105244_10053380 3300009036 Bacteria 2054
74 Ga0105250_10000084 3300009092 Bacteria 82520
75 Ga0105250_10000549 3300009092 Bacteria 25642
76 Ga0105250_10003112 3300009092 Bacteria 7983
77 Ga0105250_10099049 3300009092 Bacteria 1189
78 Ga0105240_10117814 3300009093 Bacteria 3201
79 Ga0111539_10001191 3300009094 Bacteria 34561
80 Ga0111539_10019623 3300009094 Bacteria 8341
81 Ga0111539_10092884 3300009094 Bacteria 3545
82 Ga0111539_10147229 3300009094 Bacteria 2757
83 Ga0114129_10061189 3300009147 Bacteria 5261
84 Ga0114129_10367788 3300009147 Bacteria 1901
85 Ga0105241_10401529 3300009174 Bacteria 1202
86 Ga0105248_10016878 3300009177 Bacteria 8038
87 Ga0105238_10132314 3300009551 Bacteria 2473
88 Ga0105249_10037754 3300009553 Bacteria 4383
89 Ga0105239_10017732 3300010375 Bacteria 7877
90 Ga0105246_10026618 3300011119 Bacteria 3782
91 Ga0105246_10041298 3300011119 Bacteria 3117
92 Ga0157373_10008632 3300013100 Bacteria 7561
93 Ga0157371_10000189 3300013102 Bacteria 91155
94 Ga0157371_10007038 3300013102 Bacteria 9153
95 Ga0157370_10100427 3300013104 Bacteria 2711
96 Ga0157369_10000802 3300013105 Bacteria 40181
97 Ga0163162_10009747 3300013306 Bacteria 9351
98 Ga0163162_10049179 3300013306 Bacteria 4226
99 Ga0157375_10016404 3300013308 Bacteria 6654
100 Ga0163163_10011164 3300014325 Bacteria 8134
101 Ga0157377_10004934 3300014745 Bacteria 6215
102 Ga0157376_10091077 3300014969 Bacteria 2641
103 Ga0182006_1000191 3300015261 Bacteria 63183
104 Ga0182006_1020569 3300015261 Bacteria 2764
105 Ga0182005_1000092 3300015265 Bacteria 67804
106 Ga0163161_10005213 3300017792 Bacteria 9042
107 Ga0163161_10019022 3300017792 Bacteria 4814
108 Ga0163161_10024765 3300017792 Bacteria 4242
109 Ga0213872_10006341 3300021361 Bacteria 5954
110 Ga0209760_100014 3300025207 Bacteria 177898
111 Ga0209566_101181 3300025225 Bacteria 9449
112 Ga0209672_100028 3300025228 Bacteria 341962
113 Ga0209672_100038 3300025228 Bacteria 286731
114 Ga0209147_100163 3300025229 Bacteria 90494
115 Ga0209147_100239 3300025229 Bacteria 53469
116 Ga0209147_100259 3300025229 Bacteria 49184
117 Ga0207427_100011 3300025231 Bacteria 640076
118 Ga0209437_100025 3300025233 Bacteria 561333
119 Ga0209258_100191 3300025242 Bacteria 125980
120 Ga0209258_100289 3300025242 Bacteria 82650
121 Ga0209148_1000081 3300025254 Bacteria 273676
122 Ga0209759_1011057 3300025256 Bacteria 2595
123 Ga0209233_1000012 3300025261 Bacteria 1019519
124 Ga0209455_1000050 3300025272 Bacteria 373239
125 Ga0209673_1000038 3300025273 Bacteria 312957
126 Ga0209676_1000105 3300025292 Bacteria 224151
127 Ga0209676_1000855 3300025292 Bacteria 39250
128 Ga0209564_1018517 3300025295 Bacteria 2649
129 Ga0209050_1001141 3300025298 Bacteria 31960
130 Ga0209051_1000064 3300025303 Bacteria 231735
131 Ga0209257_1000109 3300025304 Bacteria 239439
132 Ga0207696_1000222 3300025711 Bacteria 82527
133 Ga0207696_1000607 3300025711 Bacteria 26704
134 Ga0207696_1002327 3300025711 Bacteria 9423
135 Ga0207696_1008008 3300025711 Bacteria 4085
136 Ga0207696_1034175 3300025711 Bacteria 1520
137 Ga0207655_1001108 3300025728 Bacteria 26310
138 Ga0207655_1016969 3300025728 Bacteria 3951
139 Ga0207655_1048637 3300025728 Bacteria 1739
140 Ga0207713_1005227 3300025735 Bacteria 8184
141 Ga0207713_1010201 3300025735 Bacteria 5218
142 Ga0207688_10186432 3300025901 Bacteria 1239
143 Ga0207647_10006816 3300025904 Bacteria 8282
144 Ga0207645_10015033 3300025907 Bacteria 5158
145 Ga0207643_10119786 3300025908 Bacteria 1558
146 Ga0207705_10036150 3300025909 Bacteria 3535
147 Ga0207695_10022380 3300025913 Bacteria 7176
148 Ga0207662_10004095 3300025918 Bacteria 7623
149 Ga0207657_10000051 3300025919 Bacteria 109129
150 Ga0207657_10345090 3300025919 Bacteria 1175
151 Ga0207649_10001844 3300025920 Bacteria 12107
152 Ga0207681_10022636 3300025923 Bacteria 4010
153 Ga0207650_10012826 3300025925 Bacteria 5791
154 Ga0207659_10045263 3300025926 Bacteria 3101
155 Ga0207690_10000034 3300025932 Bacteria 149574
156 Ga0207690_10010955 3300025932 Bacteria 5406
157 Ga0207706_10021203 3300025933 Bacteria 5837
158 Ga0207670_10007311 3300025936 Bacteria 6151
159 Ga0207669_10068150 3300025937 Bacteria 2221
160 Ga0207704_10185245 3300025938 Bacteria 1508
161 Ga0207691_10013069 3300025940 Bacteria 7949
162 Ga0207689_10001689 3300025942 Bacteria 20967
163 Ga0207661_10360974 3300025944 Bacteria 1312
164 Ga0207679_10028989 3300025945 Bacteria 3849
165 Ga0207667_10083069 3300025949 Bacteria 3317
166 Ga0207668_10008961 3300025972 Bacteria 5984
167 Ga0207677_10036586 3300026023 Bacteria 3201
168 Ga0207703_10049319 3300026035 Bacteria 3404
169 Ga0207678_10000508 3300026067 Bacteria 35274
170 Ga0207678_10502322 3300026067 Bacteria 1057
171 Ga0207708_10092538 3300026075 Bacteria 2333
172 Ga0207641_10024452 3300026088 Bacteria 4979
173 Ga0207648_10026094 3300026089 Bacteria 5195
174 Ga0207676_10013416 3300026095 Bacteria 5885
175 Ga0207674_10468378 3300026116 Bacteria 1218
176 Ga0207675_100008825 3300026118 Bacteria 9462
177 Ga0207675_100010477 3300026118 Bacteria 8683
178 Ga0209371_1000439 3300027312 Bacteria 42232
179 Ga0207428_10025777 3300027907 Bacteria 4916
180 Ga0207428_10026239 3300027907 Bacteria 4864
181 Ga0268266_10467697 3300028379 Bacteria 1200
182 Ga0268265_10004923 3300028380 Bacteria 9183
183 Ga0268265_10007323 3300028380 Bacteria 7448
184 Ga0268265_10353293 3300028380 Bacteria 1343
185 Ga0268256_1000895 3300030500 Bacteria 20555
186 Ga0265327_10025325 3300031251 Bacteria 3463
187 Ga0307408_100157814 3300031548 Bacteria 1799
188 Ga0316576_10200465 3300031727 Bacteria 1503
189 Ga0307406_10106614 3300031901 Bacteria 1920
190 Ga0307416_100015666 3300032002 Bacteria 5244
191 Ga0307414_10487093 3300032004 Bacteria 1089
192 Ga0307415_100042319 3300032126 Bacteria 3031
193 Ga0373931_0036871 3300035691 Bacteria 2551
194 Ga0395899_0030038 3300037312 Bacteria 4090
195 Ga0395899_0164633 3300037312 Bacteria 1565
196 Ga0395900_0000003 3300037418 Bacteria 587648
197 Ga0395900_0003333 3300037418 Bacteria 17365
198 Ga0395900_0061875 3300037418 Bacteria 3848
199 Ga0395898_0000003 3300037466 Bacteria 772986
200 Ga0395898_0001172 3300037466 Bacteria 39985
201 Ga0395898_0077661 3300037466 Bacteria 3205
202 Ga0395901_0000045 3300038443 Bacteria 188874
203 Ga0395901_0012509 3300038443 Bacteria 8611
204 Ga0395901_0086188 3300038443 Bacteria 3284
205 Ga0436365_0433621 3300039437 Bacteria 4087
206 Ga0436361_1123903 3300039447 Bacteria 20318
207 Ga0439438_001454 3300041405 Bacteria 10435
208 Ga0439432_010954 3300042006 Bacteria 3128
209 Ga0439451_000735 3300042009 Bacteria 6218
210 Ga0439451_003621 3300042009 Bacteria 3126
211 Ga0439452_000146 3300042010 Bacteria 52810
212 Ga0439452_000292 3300042010 Bacteria 32220
213 Ga0439452_005855 3300042010 Bacteria 3915
214 Ga0439456_018778 3300042013 Bacteria 1452
215 Ga0450892_005616 3300042130 Bacteria 1034
216 Ga0450903_000497 3300042138 Bacteria 8252
217 Ga0450904_001470 3300042139 Bacteria 3284
218 Ga0450907_000060 3300042146 Bacteria 43254
219 Ga0439446_0006650 3300042156 Bacteria 3023
220 Ga0450909_011975 3300042185 Bacteria 1270
221 Ga0439434_0000096 3300042435 Bacteria 22268
222 Ga0439460_0001418 3300042461 Bacteria 5647
223 Ga0451577_0000338 3300042876 Bacteria 87563
224 Ga0439440_0007305 3300042993 Bacteria 2241
225 Ga0466969_0001536 3300044656 Bacteria 12397
226 Ga0466972_0000155 3300044658 Bacteria 55326
227 Ga0466965_0011127 3300044683 Bacteria 4209
228 Ga0466966_0029687 3300044684 Bacteria 3555
229 Ga0466961_0000258 3300044693 Bacteria 35598
230 Ga0466961_0001247 3300044693 Bacteria 15677
231 Ga0466963_0003576 3300044694 Bacteria 8929
232 Ga0466963_0006455 3300044694 Bacteria 6938
233 Ga0453684_0000495 3300044712 Bacteria 155165
234 Ga0466971_0000370 3300044719 Bacteria 17315
235 Ga0466971_0003779 3300044719 Bacteria 6482
236 Ga0466971_0006418 3300044719 Bacteria 5109
237 Ga0466957_0001907 3300044842 Bacteria 11059
238 Ga0466960_0136501 3300044901 Bacteria 1299
239 Ga0466959_0007944 3300045049 Bacteria 7472
240 Ga0466959_0055001 3300045049 Bacteria 2906
241 Ga0451576_0040370 3300045051 Bacteria 4940
242 Ga0466958_0019177 3300045836 Bacteria 3978
243 Ga0466958_0030952 3300045836 Bacteria 3180
244 Ga0466967_0065656 3300045976 Bacteria 3231
245 Ga0495617_000844 3300046452 Bacteria 14558
246 Ga0495617_013342 3300046452 Bacteria 2795
247 Ga0495617_014612 3300046452 Bacteria 2668
248 Ga0495627_021602 3300046453 Bacteria 2131
249 Ga0495627_041334 3300046453 Bacteria 1416
250 Ga0495603_0000337 3300046455 Bacteria 25136
251 Ga0495590_0002611 3300046457 Bacteria 7445
252 Ga0495590_0010841 3300046457 Bacteria 3415
253 Ga0495590_0012332 3300046457 Bacteria 3172
254 Ga0495590_0013264 3300046457 Bacteria 3035
255 Ga0495591_000060 3300046458 Bacteria 129321
256 Ga0495591_002550 3300046458 Bacteria 10037
257 Ga0495591_003898 3300046458 Bacteria 7517
258 Ga0495591_024792 3300046458 Bacteria 1893
259 Ga0495629_0004842 3300046459 Bacteria 10096
260 Ga0495638_0001873 3300046460 Bacteria 18187
261 Ga0495638_0008997 3300046460 Bacteria 7038
262 Ga0495638_0030308 3300046460 Bacteria 3483
263 Ga0495638_0081295 3300046460 Bacteria 1967
264 Ga0495638_0089763 3300046460 Bacteria 1853
265 Ga0495653_0001219 3300046463 Bacteria 19940
266 Ga0495653_0005957 3300046463 Bacteria 9978
267 Ga0495650_0001020 3300046471 Bacteria 31519
268 Ga0495650_0001892 3300046471 Bacteria 18567
269 Ga0495650_0002415 3300046471 Bacteria 15199
270 Ga0495650_0005703 3300046471 Bacteria 7975
271 Ga0495650_0015658 3300046471 Bacteria 3879
272 Ga0495650_0048809 3300046471 Bacteria 1761
273 Ga0495580_0011295 3300046472 Bacteria 6911
274 Ga0495580_0038337 3300046472 Bacteria 3432
275 Ga0495582_0020479 3300046473 Bacteria 3621
276 Ga0495605_0004771 3300046474 Bacteria 7924
277 Ga0495605_0008597 3300046474 Bacteria 5767
278 Ga0495605_0013146 3300046474 Bacteria 4573
279 Ga0495605_0014977 3300046474 Bacteria 4228
280 Ga0495605_0028302 3300046474 Bacteria 2894
281 Ga0495605_0032970 3300046474 Bacteria 2633
282 Ga0495605_0042677 3300046474 Bacteria 2252
283 Ga0495605_0062347 3300046474 Bacteria 1782
284 Ga0495639_0000016 3300046475 Bacteria 76516
285 Ga0495584_0012049 3300046491 Bacteria 4421
286 Ga0495584_0036174 3300046491 Bacteria 2494
287 Ga0495584_0048028 3300046491 Bacteria 2152
288 Ga0495584_0079245 3300046491 Bacteria 1652
289 Ga0495585_0000219 3300046492 Bacteria 59369
290 Ga0495585_0001028 3300046492 Bacteria 23187
291 Ga0495585_0014678 3300046492 Bacteria 4557
292 Ga0495594_0003073 3300046499 Bacteria 8649
293 Ga0495594_0043472 3300046499 Bacteria 2463
294 Ga0495596_0000083 3300046500 Bacteria 65056
295 Ga0495607_0002053 3300046501 Bacteria 16840
296 Ga0495607_0008431 3300046501 Bacteria 7046
297 Ga0495607_0009300 3300046501 Bacteria 6661
298 Ga0495607_0017208 3300046501 Bacteria 4648
299 Ga0495583_0000467 3300046506 Bacteria 59823
300 Ga0495583_0004739 3300046506 Bacteria 9563
301 Ga0495583_0064372 3300046506 Bacteria 1627
302 Ga0495606_0001204 3300046507 Bacteria 36360
303 Ga0495606_0004583 3300046507 Bacteria 13710
304 Ga0495606_0009895 3300046507 Bacteria 7987
305 Ga0495606_0012725 3300046507 Bacteria 6709
306 Ga0495610_0000842 3300046512 Bacteria 28591
307 Ga0495610_0008011 3300046512 Bacteria 6921
308 Ga0495610_0011287 3300046512 Bacteria 5473
309 Ga0495616_0001642 3300046513 Bacteria 15338
310 Ga0495616_0027767 3300046513 Bacteria 3001
311 Ga0495620_0006725 3300046515 Bacteria 6292
312 Ga0495620_0013828 3300046515 Bacteria 4121
313 Ga0495628_0011614 3300046516 Bacteria 7447
314 Ga0495628_0099929 3300046516 Bacteria 2240
315 Ga0495630_0004302 3300046517 Bacteria 9988
316 Ga0495630_0076627 3300046517 Bacteria 2520
317 Ga0495630_0099332 3300046517 Bacteria 2202
318 Ga0495631_0000014 3300046518 Bacteria 109076
319 Ga0495631_0003553 3300046518 Bacteria 8524
320 Ga0495632_0000022 3300046519 Bacteria 187045
321 Ga0495632_0000301 3300046519 Bacteria 47824
322 Ga0495632_0002786 3300046519 Bacteria 12963
323 Ga0495632_0003547 3300046519 Bacteria 11031
324 Ga0495632_0003659 3300046519 Bacteria 10784
325 Ga0495632_0084462 3300046519 Bacteria 1510
326 Ga0495632_0101206 3300046519 Bacteria 1358
327 Ga0495637_0000294 3300046520 Bacteria 38681
328 Ga0495637_0000463 3300046520 Bacteria 29650
329 Ga0495637_0007661 3300046520 Bacteria 5341
330 Ga0495637_0016435 3300046520 Bacteria 3458
331 Ga0495637_0039923 3300046520 Bacteria 2022
332 Ga0495643_0040579 3300046522 Bacteria 2541
333 Ga0495644_0000064 3300046523 Bacteria 51920
334 Ga0495644_0023999 3300046523 Bacteria 2320
335 Ga0495648_0011057 3300046524 Bacteria 6836
336 Ga0495648_0030605 3300046524 Bacteria 3556
337 Ga0495648_0039834 3300046524 Bacteria 2985
338 Ga0495648_0085733 3300046524 Bacteria 1778
339 Ga0495648_0094701 3300046524 Bacteria 1663
340 Ga0495666_0001376 3300046526 Bacteria 11787
341 Ga0495666_0087557 3300046526 Bacteria 1471
342 Ga0495666_0096078 3300046526 Bacteria 1397
343 Ga0495642_0000011 3300046528 Bacteria 128280
344 Ga0495652_0029190 3300046529 Bacteria 4846
345 Ga0495654_0000263 3300046530 Bacteria 47747
346 Ga0495654_0002386 3300046530 Bacteria 12115
347 Ga0495654_0020473 3300046530 Bacteria 3446
348 Ga0495654_0026601 3300046530 Bacteria 2972
349 Ga0495654_0061955 3300046530 Bacteria 1794
350 Ga0495654_0069034 3300046530 Bacteria 1678
351 Ga0495654_0070932 3300046530 Bacteria 1651
352 Ga0495665_0045648 3300046531 Bacteria 2327
353 Ga0495587_0001361 3300046536 Bacteria 16211
354 Ga0495609_0000212 3300046538 Bacteria 57886
355 Ga0495609_0087983 3300046538 Bacteria 1353
356 Ga0495597_0001850 3300046542 Bacteria 14480
357 Ga0495597_0003934 3300046542 Bacteria 8372
358 Ga0495597_0024251 3300046542 Bacteria 2801
359 Ga0495597_0045891 3300046542 Bacteria 1937
360 Ga0495622_0000070 3300046557 Bacteria 89579
361 Ga0495622_0000350 3300046557 Bacteria 32833
362 Ga0495633_0002077 3300046558 Bacteria 14408
363 Ga0495668_0000635 3300046616 Bacteria 42189
364 Ga0495634_0000290 3300046642 Bacteria 48107
365 Ga0495625_0000012 3300046660 Bacteria 363006
366 Ga0495625_0002425 3300046660 Bacteria 20189
367 Ga0495625_0002680 3300046660 Bacteria 18942
368 Ga0495625_0026831 3300046660 Bacteria 4344
369 Ga0495635_0000107 3300046663 Bacteria 49233
370 Ga0495659_0000056 3300046664 Bacteria 49485
371 Ga0495659_0005571 3300046664 Bacteria 3961
372 Ga0495661_0016734 3300046665 Bacteria 4852
373 Ga0495661_0023211 3300046665 Bacteria 4027
374 Ga0495657_0125585 3300046675 Bacteria 1612
375 Ga0495623_0019562 3300046679 Bacteria 4375
376 Ga0495623_0058750 3300046679 Bacteria 2417
377 Ga0495646_0000723 3300046680 Bacteria 18297
378 Ga0495646_0007377 3300046680 Bacteria 6988
379 Ga0495669_0000591 3300046684 Bacteria 15918
380 Ga0495624_0008865 3300046690 Bacteria 6991
381 Ga0495624_0020250 3300046690 Bacteria 4430
382 Ga0495671_0000496 3300046692 Bacteria 30365
383 Ga0495671_0035644 3300046692 Bacteria 2525
384 Ga0495671_0050039 3300046692 Bacteria 2082
385 Ga0495671_0057728 3300046692 Bacteria 1920
386 Ga0495671_0062279 3300046692 Bacteria 1838
387 Ga0495649_0000485 3300046694 Bacteria 34144
388 Ga0495649_0001028 3300046694 Bacteria 21892
389 Ga0495649_0029045 3300046694 Bacteria 3063
390 Ga0495649_0069201 3300046694 Bacteria 1893
391 Ga0495649_0070452 3300046694 Bacteria 1874
392 Ga0495649_0081851 3300046694 Bacteria 1726
393 Ga0495589_0000823 3300046794 Bacteria 19568
394 Ga0495589_0018397 3300046794 Bacteria 3582
395 Ga0495589_0018643 3300046794 Bacteria 3558
396 Ga0495589_0026254 3300046794 Bacteria 2952
397 Ga0495589_0076824 3300046794 Bacteria 1627
398 Ga0495660_0031644 3300046810 Bacteria 2974
399 Ga0495660_0044438 3300046810 Bacteria 2443
400 Ga0495660_0046093 3300046810 Bacteria 2391
401 Ga0495660_0099126 3300046810 Bacteria 1502
402 Ga0495581_0002889 3300047315 Bacteria 9825
403 Ga0495604_0009287 3300047317 Bacteria 7785
404 Ga0495604_0027529 3300047317 Bacteria 4520
405 Ga0495636_0024195 3300047318 Bacteria 2461
406 Ga0495674_0000507 3300047319 Bacteria 35691
407 Ga0495674_0002074 3300047319 Bacteria 19661
408 Ga0495674_0006124 3300047319 Bacteria 11551
409 Ga0495674_0010629 3300047319 Bacteria 8707
410 Ga0495672_0000698 3300047320 Bacteria 37164
411 Ga0495672_0030539 3300047320 Bacteria 3378
412 Ga0495672_0037598 3300047320 Bacteria 2960
413 Ga0495672_0041484 3300047320 Bacteria 2782
414 Ga0495672_0050550 3300047320 Bacteria 2452
415 Ga0495672_0118664 3300047320 Bacteria 1409
416 Ga0495676_0157246 3300047321 Bacteria 1611
417 Ga0495683_0000057 3300047323 Bacteria 118509
418 Ga0495683_0002986 3300047323 Bacteria 9981
419 Ga0495683_0009936 3300047323 Bacteria 5053
420 Ga0495683_0015284 3300047323 Bacteria 3996
421 Ga0495683_0026580 3300047323 Bacteria 2961
422 Ga0495683_0074784 3300047323 Bacteria 1659
423 Ga0495687_003368 3300047443 Bacteria 11664
424 Ga0495687_003616 3300047443 Bacteria 11044
425 Ga0495687_007084 3300047443 Bacteria 6695
426 Ga0495679_000054 3300047446 Bacteria 114312
427 Ga0495679_001048 3300047446 Bacteria 16854
428 Ga0495679_027634 3300047446 Bacteria 1868
429 Ga0495673_0000234 3300047469 Bacteria 80453
430 Ga0495673_0000717 3300047469 Bacteria 32108
431 Ga0495673_0000829 3300047469 Bacteria 28864
432 Ga0495673_0000891 3300047469 Bacteria 27479
433 Ga0495673_0004176 3300047469 Bacteria 9125
434 Ga0495673_0007511 3300047469 Bacteria 6253
435 Ga0495673_0043354 3300047469 Bacteria 2014
436 Ga0495673_0045372 3300047469 Bacteria 1954
437 Ga0495681_0000372 3300047470 Bacteria 35092
438 Ga0495681_0000533 3300047470 Bacteria 29141
439 Ga0495681_0003850 3300047470 Bacteria 10376
440 Ga0495681_0018258 3300047470 Bacteria 3867
441 Ga0495681_0049707 3300047470 Bacteria 1980
442 Ga0495684_0169533 3300047471 Bacteria 1624
443 Ga0495686_0002045 3300047472 Bacteria 19859
444 Ga0495686_0011147 3300047472 Bacteria 6344
445 Ga0495593_0003972 3300047673 Bacteria 8825
446 Ga0495593_0027760 3300047673 Bacteria 3113
447 Ga0495593_0028898 3300047673 Bacteria 3044
448 Ga0495593_0065136 3300047673 Bacteria 1900
449 Ga0495614_0017913 3300048089 Bacteria 3071
450 Ga0495626_0000066 3300048091 Bacteria 141280
451 Ga0495626_0000077 3300048091 Bacteria 130910
452 Ga0495626_0000268 3300048091 Bacteria 58845
453 Ga0495626_0000513 3300048091 Bacteria 38809
454 Ga0495626_0016477 3300048091 Bacteria 3752
455 Ga0495626_0032165 3300048091 Bacteria 2520
456 Ga0495626_0041723 3300048091 Bacteria 2158
457 Ga0495626_0082129 3300048091 Bacteria 1430
458 Ga0496100_0049028 3300048903 Bacteria 2728
459 Ga0496102_0000394 3300048905 Bacteria 50983
460 Ga0496102_0285136 3300048905 Bacteria 1557
461 Ga0496103_0000807 3300048906 Bacteria 23036
462 Ga0496104_0008299 3300048907 Bacteria 9225
463 Ga0496104_0225084 3300048907 Bacteria 1788
464 Ga0496106_0044530 3300048909 Bacteria 3331
465 Ga0496107_0207349 3300048910 Bacteria 1457
466 Ga0496111_0313577 3300048914 Bacteria 1162
467 Ga0496111_0429002 3300048914 Bacteria 976
468 Ga0496112_0003653 3300048915 Bacteria 12819
469 Ga0496112_0340965 3300048915 Bacteria 1442
470 Ga0496113_0023278 3300048916 Bacteria 4392
471 Ga0496115_0018838 3300048918 Bacteria 5307
472 Ga0496116_0000744 3300048919 Bacteria 41592
473 Ga0496116_0004404 3300048919 Bacteria 13464
474 Ga0496116_0017890 3300048919 Bacteria 5483
475 Ga0496117_0001810 3300048920 Bacteria 29047
476 Ga0496117_0023279 3300048920 Bacteria 4942
477 Ga0496118_0006225 3300048921 Bacteria 13200
478 Ga0496118_0010514 3300048921 Bacteria 9157
479 Ga0496118_0011091 3300048921 Bacteria 8845
480 Ga0496118_0066121 3300048921 Bacteria 2640
481 Ga0496118_0083905 3300048921 Bacteria 2225
482 Ga0496119_0065628 3300048922 Bacteria 2149
483 Ga0496121_0004629 3300048924 Bacteria 18298
484 Ga0496121_0013075 3300048924 Bacteria 8960
485 Ga0496121_0034186 3300048924 Bacteria 4580
486 Ga0496121_0034234 3300048924 Bacteria 4575
487 Ga0496122_0001075 3300048925 Bacteria 47418
488 Ga0496122_0005294 3300048925 Bacteria 15441
489 Ga0496122_0010920 3300048925 Bacteria 9286
490 Ga0496123_0000064 3300048926 Bacteria 212668
491 Ga0496123_0008678 3300048926 Bacteria 9286
492 Ga0496123_0010347 3300048926 Bacteria 8261
493 Ga0496124_0003588 3300048927 Bacteria 18860
494 Ga0496124_0125040 3300048927 Bacteria 2050
495 Ga0496125_0010383 3300048928 Bacteria 9419
496 Ga0496125_0022611 3300048928 Bacteria 5833
497 Ga0496125_0045688 3300048928 Bacteria 3682
498 Ga0496125_0227651 3300048928 Bacteria 1195
499 Ga0496126_0007462 3300048929 Bacteria 11983
500 Ga0496126_0013013 3300048929 Bacteria 8490
501 Ga0495678_001920 3300049459 Bacteria 15087
502 Ga0495678_015692 3300049459 Bacteria 3479
503 Ga0495682_0003682 3300049460 Bacteria 6758
504 Ga0495682_0020493 3300049460 Bacteria 2482
505 Ga0501262_015482 3300049759 Bacteria 1002
506 nmdc:mga05p37_162197_c1 3300050507 Bacteria 2730
507 nmdc:mga05p37_200273_c1 3300050507 Bacteria 2419
508 nmdc:mga09592_7020_c1 3300050508 Bacteria 9155
509 nmdc:mga09592_75657_c1 3300050508 Bacteria 2863
510 nmdc:mga0qj67_323992_c1 3300050509 Bacteria 1247
511 nmdc:mga0qj67_38864_c1 3300050509 Bacteria 3735
512 nmdc:mga06r32_1782_c1 3300050510 Bacteria 19334
513 nmdc:mga06r32_877_c1 3300050510 Bacteria 26778
514 nmdc:mga08y16_1183_c1 3300050511 Bacteria 25760
515 nmdc:mga08y16_151154_c1 3300050511 Bacteria 2413
516 nmdc:mga08y16_39024_c1 3300050511 Bacteria 4984
517 nmdc:mga08y16_627801_c1 3300050511 Bacteria 1081
518 Ga0500658_0000012 3300053134 Bacteria 160010
519 Ga0466962_0003294 3300061719 Bacteria 7674
520 Ga0466962_0020824 3300061719 Bacteria 3151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_627801_c1 nmdc:mga08y16_627801_c1_52_825 257
2 3300032004 Ga0307414_10487093 Ga0307414_104870932 284
3 3300046524 Ga0495648_0039834 Ga0495648_0039834_2086_2970 294
4 3300046530 Ga0495654_0069034 Ga0495654_0069034_779_1663 294
5 3300047470 Ga0495681_0018258 Ga0495681_0018258_2968_3852 294
6 3300006844 Ga0075428_100034198 Ga0075428_1000341987 295
7 3300009147 Ga0114129_10367788 Ga0114129_103677881 295
8 3300050509 nmdc:mga0qj67_38864_c1 nmdc:mga0qj67_38864_c1_1149_2036 295
9 3300050510 nmdc:mga06r32_1782_c1 nmdc:mga06r32_1782_c1_1197_2084 295
10 3300006880 Ga0075429_100017681 Ga0075429_1000176817 296
11 3300031901 Ga0307406_10106614 Ga0307406_101066142 296
12 3300032002 Ga0307416_100015666 Ga0307416_1000156665 296
13 3300050507 nmdc:mga05p37_162197_c1 nmdc:mga05p37_162197_c1_484_1374 296
14 3300050508 nmdc:mga09592_7020_c1 nmdc:mga09592_7020_c1_1357_2247 296
15 3300005290 Ga0065712_10075821 Ga0065712_100758216 298
16 3300005293 Ga0065715_10096779 Ga0065715_100967794 298
17 3300005328 Ga0070676_10008160 Ga0070676_100081603 298
18 3300005329 Ga0070683_100092802 Ga0070683_1000928025 298
19 3300005330 Ga0070690_100007404 Ga0070690_1000074044 298
20 3300005331 Ga0070670_100011258 Ga0070670_1000112589 298
21 3300005334 Ga0068869_100005075 Ga0068869_1000050758 298
22 3300005337 Ga0070682_100087022 Ga0070682_1000870223 298
23 3300005338 Ga0068868_100047158 Ga0068868_1000471583 298
24 3300005340 Ga0070689_100001773 Ga0070689_10000177314 298
25 3300005343 Ga0070687_100001091 Ga0070687_1000010918 298
26 3300005344 Ga0070661_100004510 Ga0070661_1000045106 298
27 3300005345 Ga0070692_10021763 Ga0070692_100217633 298
28 3300005353 Ga0070669_100032108 Ga0070669_1000321083 298
29 3300005354 Ga0070675_100020801 Ga0070675_1000208011 298
30 3300005364 Ga0070673_100000964 Ga0070673_1000009646 298
31 3300005365 Ga0070688_100015862 Ga0070688_1000158625 298
32 3300005438 Ga0070701_10064522 Ga0070701_100645222 298
33 3300005440 Ga0070705_100022729 Ga0070705_1000227294 298
34 3300005441 Ga0070700_100072775 Ga0070700_1000727752 298
35 3300005444 Ga0070694_100022460 Ga0070694_1000224605 298
36 3300005457 Ga0070662_100031143 Ga0070662_1000311433 298
37 3300005457 Ga0070662_100074061 Ga0070662_1000740612 298
38 3300005459 Ga0068867_100007456 Ga0068867_1000074569 298
39 3300005466 Ga0070685_10018645 Ga0070685_100186456 298
40 3300005535 Ga0070684_100005098 Ga0070684_1000050985 298
41 3300005544 Ga0070686_100003171 Ga0070686_10000317110 298
42 3300005548 Ga0070665_100231753 Ga0070665_1002317532 298
43 3300005564 Ga0070664_100003939 Ga0070664_1000039398 298
44 3300005617 Ga0068859_100002841 Ga0068859_10000284110 298
45 3300005618 Ga0068864_100013233 Ga0068864_1000132334 298
46 3300005719 Ga0068861_100001395 Ga0068861_10000139514 298
47 3300005719 Ga0068861_100007235 Ga0068861_1000072355 298
48 3300005841 Ga0068863_100004099 Ga0068863_1000040999 298
49 3300005843 Ga0068860_100081077 Ga0068860_1000810773 298
50 3300005844 Ga0068862_100002154 Ga0068862_1000021544 298
51 3300006358 Ga0068871_100060188 Ga0068871_1000601884 298
52 3300006844 Ga0075428_100082352 Ga0075428_1000823523 298
53 3300006931 Ga0097620_100002841 Ga0097620_10000284114 298
54 3300009092 Ga0105250_10099049 Ga0105250_100990492 298
55 3300009174 Ga0105241_10401529 Ga0105241_104015292 298
56 3300009177 Ga0105248_10016878 Ga0105248_1001687810 298
57 3300009553 Ga0105249_10037754 Ga0105249_100377544 298
58 3300011119 Ga0105246_10026618 Ga0105246_100266186 298
59 3300013306 Ga0163162_10009747 Ga0163162_1000974711 298
60 3300013308 Ga0157375_10016404 Ga0157375_100164043 298
61 3300014325 Ga0163163_10011164 Ga0163163_100111645 298
62 3300014745 Ga0157377_10004934 Ga0157377_100049348 298
63 3300014969 Ga0157376_10091077 Ga0157376_100910773 298
64 3300025901 Ga0207688_10186432 Ga0207688_101864321 298
65 3300025907 Ga0207645_10015033 Ga0207645_100150332 298
66 3300025908 Ga0207643_10119786 Ga0207643_101197862 298
67 3300025918 Ga0207662_10004095 Ga0207662_100040956 298
68 3300025919 Ga0207657_10345090 Ga0207657_103450902 298
69 3300025920 Ga0207649_10001844 Ga0207649_1000184412 298
70 3300025923 Ga0207681_10022636 Ga0207681_100226363 298
71 3300025925 Ga0207650_10012826 Ga0207650_100128265 298
72 3300025926 Ga0207659_10045263 Ga0207659_100452631 298
73 3300025933 Ga0207706_10021203 Ga0207706_100212035 298
74 3300025936 Ga0207670_10007311 Ga0207670_100073118 298
75 3300025938 Ga0207704_10185245 Ga0207704_101852452 298
76 3300025940 Ga0207691_10013069 Ga0207691_100130695 298
77 3300025942 Ga0207689_10001689 Ga0207689_1000168910 298
78 3300025944 Ga0207661_10360974 Ga0207661_103609742 298
79 3300025945 Ga0207679_10028989 Ga0207679_100289894 298
80 3300025972 Ga0207668_10008961 Ga0207668_100089617 298
81 3300026023 Ga0207677_10036586 Ga0207677_100365864 298
82 3300026035 Ga0207703_10049319 Ga0207703_100493194 298
83 3300026067 Ga0207678_10502322 Ga0207678_105023222 298
84 3300026075 Ga0207708_10092538 Ga0207708_100925382 298
85 3300026088 Ga0207641_10024452 Ga0207641_100244524 298
86 3300026089 Ga0207648_10026094 Ga0207648_100260942 298
87 3300026095 Ga0207676_10013416 Ga0207676_100134166 298
88 3300026118 Ga0207675_100008825 Ga0207675_1000088258 298
89 3300026118 Ga0207675_100010477 Ga0207675_10001047710 298
90 3300028379 Ga0268266_10467697 Ga0268266_104676971 298
91 3300028380 Ga0268265_10004923 Ga0268265_100049238 298
92 3300028380 Ga0268265_10007323 Ga0268265_100073239 298
93 3300031548 Ga0307408_100157814 Ga0307408_1001578142 298
94 3300035691 Ga0373931_0036871 Ga0373931_0036871_1411_2307 298
95 3300045051 Ga0451576_0040370 Ga0451576_0040370_28_924 298
96 3300048907 Ga0496104_0225084 Ga0496104_0225084_645_1541 298
97 3300048909 Ga0496106_0044530 Ga0496106_0044530_1357_2253 298
98 3300048914 Ga0496111_0313577 Ga0496111_0313577_177_1073 298
99 3300048915 Ga0496112_0340965 Ga0496112_0340965_487_1383 298
100 3300049759 Ga0501262_015482 Ga0501262_015482_90_986 298
101 3300009094 Ga0111539_10019623 Ga0111539_100196235 299
102 3300027907 Ga0207428_10025777 Ga0207428_100257775 299
103 3300050511 nmdc:mga08y16_39024_c1 nmdc:mga08y16_39024_c1_450_1349 299
104 3300005615 Ga0070702_100244755 Ga0070702_1002447551 300
105 3300009094 Ga0111539_10092884 Ga0111539_100928844 300
106 3300009094 Ga0111539_10147229 Ga0111539_101472294 300
107 3300025225 Ga0209566_101181 Ga0209566_1011817 300
108 3300025229 Ga0209147_100239 Ga0209147_10023944 300
109 3300025937 Ga0207669_10068150 Ga0207669_100681502 300
110 3300028380 Ga0268265_10353293 Ga0268265_103532931 300
111 3300031251 Ga0265327_10025325 Ga0265327_100253254 300
112 3300050509 nmdc:mga0qj67_323992_c1 nmdc:mga0qj67_323992_c1_14_916 300
113 3300050511 nmdc:mga08y16_151154_c1 nmdc:mga08y16_151154_c1_436_1338 300
114 3300032126 Ga0307415_100042319 Ga0307415_1000423193 301
115 3300042130 Ga0450892_005616 Ga0450892_005616_81_989 302
116 iso_pu_bacteria 2511231018 2511338831 302
117 iso_pu_bacteria 2511231019 2511342180 302
118 3300006847 Ga0075431_100000002 Ga0075431_10000000278 303
119 3300006880 Ga0075429_100052780 Ga0075429_1000527806 303
120 3300009094 Ga0111539_10001191 Ga0111539_1000119111 303
121 3300009147 Ga0114129_10061189 Ga0114129_100611896 303
122 3300027907 Ga0207428_10026239 Ga0207428_100262392 303
123 3300050507 nmdc:mga05p37_200273_c1 nmdc:mga05p37_200273_c1_261_1172 303
124 3300050508 nmdc:mga09592_75657_c1 nmdc:mga09592_75657_c1_1762_2673 303
125 3300050510 nmdc:mga06r32_877_c1 nmdc:mga06r32_877_c1_22384_23295 303
126 3300050511 nmdc:mga08y16_1183_c1 nmdc:mga08y16_1183_c1_1832_2743 303
127 iso_pu_bacteria 2501025501 2501073572 303
128 iso_pu_bacteria 2501025502 2501077004 303
129 iso_pu_bacteria 2501025504 2501407077 303
130 iso_pu_bacteria 2510917013 2511092691 303
131 iso_pu_bacteria 2510917014 2511097971 303
132 iso_pu_bacteria 2510917015 2511108157 303
133 iso_pu_bacteria 2511231007 2511271663 303
134 iso_pu_bacteria 2511231021 2511357590 303
135 iso_pu_bacteria 2515154122 2515681481 303
136 iso_pu_bacteria 2515154189 2516019788 303
137 iso_pu_bacteria 2519103095 2519457844 303
138 iso_pu_bacteria 2562617112 2563063775 303
139 iso_pu_bacteria 2582581311 2585295150 303
140 iso_pu_bacteria 2599185239 2599736980 303
141 iso_pu_bacteria 2599185292 2599903052 303
142 iso_pu_bacteria 2600255067 2600813410 303
143 iso_pu_bacteria 2623620446 2624492477 303
144 iso_pu_bacteria 2643221565 2643844548 303
145 iso_pu_bacteria 2643221609 2644059919 303
146 iso_pu_bacteria 2643221611 2644074463 303
147 iso_pu_bacteria 2687453129 2687578133 303
148 iso_pu_bacteria 2711768613 2713474665 303
149 iso_pu_bacteria 2738543012 2739241441 303
150 iso_pu_bacteria 2773857670 2774120415 303
151 iso_pu_bacteria 2784132072 2784312888 303
152 iso_pu_bacteria 2808606382 2808956134 303
153 iso_pu_bacteria 2808606384 2808971421 303
154 iso_pu_bacteria 2808606390 2809006195 303
155 iso_pu_bacteria 2808606391 2809013388 303
156 iso_pu_bacteria 2811994881 2812366396 303
157 iso_pu_bacteria 2816332133 2816473605 303
158 iso_pu_bacteria 2816332253 2817260028 303
159 iso_pu_bacteria 2816332256 2817277691 303
160 iso_pu_bacteria 2816332286 2817456896 303
161 iso_pu_bacteria 2818991452 2819632482 303
162 iso_pu_bacteria 2854601825 2854602318 303
163 iso_pu_bacteria 2856287931 2856289846 303
164 iso_pu_bacteria 2857357740 2857363114 303
165 iso_pu_bacteria 2858950400 2858950735 303
166 iso_pu_bacteria 2860339153 2860344755 303
167 iso_pu_bacteria 2863421361 2863421520 303
168 iso_pu_bacteria 2883087390 2883091995 303
169 iso_pu_bacteria 2904504865 2904507276 303
170 iso_pu_bacteria 2904564687 2904565698 303
171 iso_pu_bacteria 2904571731 2904572741 303
172 iso_pu_bacteria 2919125081 2919127731 303
173 iso_pu_bacteria 2919697872 2919698644 303
174 iso_pu_bacteria 2923519811 2923520420 303
175 iso_pu_bacteria 2928157003 2928159901 303
176 iso_pu_bacteria 2928163908 2928164058 303
177 iso_pu_bacteria 2928170801 2928173411 303
178 iso_pu_bacteria 2928536128 2928538736 303
179 iso_pu_bacteria 2931396565 2931402273 303
180 iso_pu_bacteria 2939651529 2939653731 303
181 iso_pu_bacteria 2981990288 2981994339 303
182 iso_pu_bacteria 641736154 642416620 303
183 iso_pu_bacteria 8002745576 8002748769 303
184 iso_pu_bacteria 8018845410 8018850742 303
185 iso_pu_bacteria 8019775933 8019778888 303
186 iso_pu_bacteria 8020807995 8020812497 303
187 iso_pu_bacteria 8020945358 8020947649 303
188 iso_pu_bacteria 8021120328 8021126777 303
189 iso_pu_bacteria 8039098773 8039099160 303
190 iso_pu_bacteria 8040167225 8040172249 303
191 iso_pu_bacteria 8040173305 8040178078 303
192 iso_pu_bacteria 8056161164 8056166386 303
193 iso_pu_bacteria 8057101203 8057103874 303
194 3300031727 Ga0316576_10200465 Ga0316576_102004651 305
195 3300002737 JGI25162J39368_1000051 JGI25162J39368_100005170 306
196 3300002771 JGI25163J39215_1000030 JGI25163J39215_10000304 306
197 3300002772 JGI25164J39214_1000027 JGI25164J39214_100002751 306
198 3300003214 JGI25165J46597_1000101 JGI25165J46597_100010151 306
199 3300003781 Ga0055536_1003447 Ga0055536_10034472 306
200 3300003791 Ga0055530_10007923 Ga0055530_100079235 306
201 3300003792 Ga0055540_1000420 Ga0055540_100042011 306
202 3300003792 Ga0055540_1000492 Ga0055540_100049218 306
203 3300003794 Ga0055531_10000309 Ga0055531_1000030936 306
204 3300006058 Ga0075432_10013134 Ga0075432_100131344 306
205 3300025207 Ga0209760_100014 Ga0209760_10001469 306
206 3300025231 Ga0207427_100011 Ga0207427_100011318 306
207 3300025233 Ga0209437_100025 Ga0209437_100025252 306
208 3300025261 Ga0209233_1000012 Ga0209233_1000012771 306
209 3300025292 Ga0209676_1000105 Ga0209676_100010567 306
210 3300025298 Ga0209050_1001141 Ga0209050_10011413 306
211 3300025303 Ga0209051_1000064 Ga0209051_1000064154 306
212 3300025304 Ga0209257_1000109 Ga0209257_1000109154 306
213 3300046458 Ga0495591_002550 Ga0495591_002550_1885_2805 306
214 3300046542 Ga0495597_0003934 Ga0495597_0003934_5647_6567 306
215 3300046660 Ga0495625_0000012 Ga0495625_0000012_93722_94642 306
216 3300046692 Ga0495671_0035644 Ga0495671_0035644_1402_2322 306
217 3300047470 Ga0495681_0000372 Ga0495681_0000372_18007_18945 306
218 3300053134 Ga0500658_0000012 Ga0500658_0000012_22897_23817 306
219 3300001989 JGI24739J22299_10019145 JGI24739J22299_100191452 307
220 3300002067 JGI24735J21928_10069460 JGI24735J21928_100694601 307
221 3300003763 Ga0055529_1000783 Ga0055529_100078319 307
222 3300003781 Ga0055536_1012362 Ga0055536_10123623 307
223 3300003790 Ga0055528_1004283 Ga0055528_10042831 307
224 3300005288 Ga0065714_10003773 Ga0065714_100037732 307
225 3300005288 Ga0065714_10013835 Ga0065714_100138353 307
226 3300005288 Ga0065714_10018286 Ga0065714_100182862 307
227 3300005290 Ga0065712_10002138 Ga0065712_100021385 307
228 3300005327 Ga0070658_10050471 Ga0070658_100504714 307
229 3300005339 Ga0070660_100000032 Ga0070660_10000003225 307
230 3300005366 Ga0070659_100000035 Ga0070659_10000003558 307
231 3300005455 Ga0070663_100001341 Ga0070663_1000013412 307
232 3300005616 Ga0068852_100039241 Ga0068852_1000392412 307
233 3300006058 Ga0075432_10000949 Ga0075432_100009495 307
234 3300009011 Ga0105251_10005374 Ga0105251_100053742 307
235 3300009036 Ga0105244_10015632 Ga0105244_100156322 307
236 3300009036 Ga0105244_10019652 Ga0105244_100196524 307
237 3300009036 Ga0105244_10053380 Ga0105244_100533802 307
238 3300009092 Ga0105250_10000084 Ga0105250_1000008453 307
239 3300009092 Ga0105250_10000549 Ga0105250_1000054910 307
240 3300009092 Ga0105250_10003112 Ga0105250_100031122 307
241 3300009093 Ga0105240_10117814 Ga0105240_101178142 307
242 3300009551 Ga0105238_10132314 Ga0105238_101323142 307
243 3300010375 Ga0105239_10017732 Ga0105239_100177325 307
244 3300011119 Ga0105246_10041298 Ga0105246_100412985 307
245 3300013100 Ga0157373_10008632 Ga0157373_100086322 307
246 3300013102 Ga0157371_10000189 Ga0157371_100001897 307
247 3300013102 Ga0157371_10007038 Ga0157371_100070382 307
248 3300013104 Ga0157370_10100427 Ga0157370_101004272 307
249 3300013105 Ga0157369_10000802 Ga0157369_1000080217 307
250 3300013306 Ga0163162_10049179 Ga0163162_100491796 307
251 3300015261 Ga0182006_1000191 Ga0182006_100019134 307
252 3300015261 Ga0182006_1020569 Ga0182006_10205692 307
253 3300015265 Ga0182005_1000092 Ga0182005_100009234 307
254 3300017792 Ga0163161_10005213 Ga0163161_100052137 307
255 3300017792 Ga0163161_10019022 Ga0163161_100190225 307
256 3300017792 Ga0163161_10024765 Ga0163161_100247655 307
257 3300021361 Ga0213872_10006341 Ga0213872_100063415 307
258 3300025228 Ga0209672_100028 Ga0209672_100028129 307
259 3300025228 Ga0209672_100038 Ga0209672_100038192 307
260 3300025229 Ga0209147_100163 Ga0209147_10016359 307
261 3300025229 Ga0209147_100259 Ga0209147_10025936 307
262 3300025242 Ga0209258_100191 Ga0209258_10019118 307
263 3300025242 Ga0209258_100289 Ga0209258_10028917 307
264 3300025254 Ga0209148_1000081 Ga0209148_1000081109 307
265 3300025256 Ga0209759_1011057 Ga0209759_10110573 307
266 3300025272 Ga0209455_1000050 Ga0209455_1000050191 307
267 3300025273 Ga0209673_1000038 Ga0209673_1000038126 307
268 3300025292 Ga0209676_1000855 Ga0209676_100085530 307
269 3300025295 Ga0209564_1018517 Ga0209564_10185173 307
270 3300025711 Ga0207696_1000222 Ga0207696_100022252 307
271 3300025711 Ga0207696_1000607 Ga0207696_100060726 307
272 3300025711 Ga0207696_1002327 Ga0207696_10023278 307
273 3300025711 Ga0207696_1008008 Ga0207696_10080085 307
274 3300025711 Ga0207696_1034175 Ga0207696_10341751 307
275 3300025728 Ga0207655_1001108 Ga0207655_10011088 307
276 3300025728 Ga0207655_1016969 Ga0207655_10169692 307
277 3300025728 Ga0207655_1048637 Ga0207655_10486372 307
278 3300025735 Ga0207713_1005227 Ga0207713_10052278 307
279 3300025735 Ga0207713_1010201 Ga0207713_10102012 307
280 3300025904 Ga0207647_10006816 Ga0207647_100068162 307
281 3300025909 Ga0207705_10036150 Ga0207705_100361502 307
282 3300025913 Ga0207695_10022380 Ga0207695_100223804 307
283 3300025919 Ga0207657_10000051 Ga0207657_1000005122 307
284 3300025932 Ga0207690_10000034 Ga0207690_1000003457 307
285 3300025932 Ga0207690_10010955 Ga0207690_100109554 307
286 3300025949 Ga0207667_10083069 Ga0207667_100830694 307
287 3300026067 Ga0207678_10000508 Ga0207678_1000050814 307
288 3300026116 Ga0207674_10468378 Ga0207674_104683782 307
289 3300027312 Ga0209371_1000439 Ga0209371_100043915 307
290 3300030500 Ga0268256_1000895 Ga0268256_10008956 307
291 3300037312 Ga0395899_0030038 Ga0395899_0030038_1665_2597 307
292 3300037312 Ga0395899_0164633 Ga0395899_0164633_42_974 307
293 3300037418 Ga0395900_0000003 Ga0395900_0000003_48816_49748 307
294 3300037418 Ga0395900_0003333 Ga0395900_0003333_9122_10054 307
295 3300037418 Ga0395900_0061875 Ga0395900_0061875_292_1224 307
296 3300037466 Ga0395898_0000003 Ga0395898_0000003_723239_724171 307
297 3300037466 Ga0395898_0001172 Ga0395898_0001172_24615_25547 307
298 3300037466 Ga0395898_0077661 Ga0395898_0077661_1644_2576 307
299 3300038443 Ga0395901_0000045 Ga0395901_0000045_99239_100171 307
300 3300038443 Ga0395901_0012509 Ga0395901_0012509_3372_4304 307
301 3300038443 Ga0395901_0086188 Ga0395901_0086188_1854_2789 307
302 3300039437 Ga0436365_0433621 Ga0436365_0433621_2856_3779 307
303 3300039447 Ga0436361_1123903 Ga0436361_1123903_14614_15537 307
304 3300041405 Ga0439438_001454 Ga0439438_001454_5457_6380 307
305 3300042006 Ga0439432_010954 Ga0439432_010954_1511_2434 307
306 3300042009 Ga0439451_000735 Ga0439451_000735_1697_2623 307
307 3300042009 Ga0439451_003621 Ga0439451_003621_1274_2197 307
308 3300042010 Ga0439452_000146 Ga0439452_000146_23773_24696 307
309 3300042010 Ga0439452_000292 Ga0439452_000292_13116_14039 307
310 3300042010 Ga0439452_005855 Ga0439452_005855_2090_3013 307
311 3300042013 Ga0439456_018778 Ga0439456_018778_49_972 307
312 3300042138 Ga0450903_000497 Ga0450903_000497_1489_2412 307
313 3300042139 Ga0450904_001470 Ga0450904_001470_1070_1993 307
314 3300042146 Ga0450907_000060 Ga0450907_000060_10963_11886 307
315 3300042156 Ga0439446_0006650 Ga0439446_0006650_722_1645 307
316 3300042185 Ga0450909_011975 Ga0450909_011975_101_1024 307
317 3300042435 Ga0439434_0000096 Ga0439434_0000096_1606_2529 307
318 3300042461 Ga0439460_0001418 Ga0439460_0001418_752_1675 307
319 3300042876 Ga0451577_0000338 Ga0451577_0000338_58874_59797 307
320 3300042993 Ga0439440_0007305 Ga0439440_0007305_999_1922 307
321 3300044656 Ga0466969_0001536 Ga0466969_0001536_11260_12237 307
322 3300044658 Ga0466972_0000155 Ga0466972_0000155_25306_26229 307
323 3300044683 Ga0466965_0011127 Ga0466965_0011127_326_1303 307
324 3300044684 Ga0466966_0029687 Ga0466966_0029687_1170_2102 307
325 3300044693 Ga0466961_0000258 Ga0466961_0000258_24584_25510 307
326 3300044693 Ga0466961_0001247 Ga0466961_0001247_9283_10260 307
327 3300044694 Ga0466963_0003576 Ga0466963_0003576_1395_2327 307
328 3300044694 Ga0466963_0006455 Ga0466963_0006455_4226_5152 307
329 3300044712 Ga0453684_0000495 Ga0453684_0000495_153541_154464 307
330 3300044719 Ga0466971_0000370 Ga0466971_0000370_12947_13879 307
331 3300044719 Ga0466971_0003779 Ga0466971_0003779_711_1688 307
332 3300044719 Ga0466971_0006418 Ga0466971_0006418_872_1798 307
333 3300044842 Ga0466957_0001907 Ga0466957_0001907_528_1505 307
334 3300044901 Ga0466960_0136501 Ga0466960_0136501_302_1228 307
335 3300045049 Ga0466959_0007944 Ga0466959_0007944_4993_5919 307
336 3300045049 Ga0466959_0055001 Ga0466959_0055001_408_1385 307
337 3300045836 Ga0466958_0019177 Ga0466958_0019177_1319_2245 307
338 3300045836 Ga0466958_0030952 Ga0466958_0030952_728_1705 307
339 3300045976 Ga0466967_0065656 Ga0466967_0065656_1208_2284 307
340 3300046452 Ga0495617_000844 Ga0495617_000844_10462_11433 307
341 3300046452 Ga0495617_013342 Ga0495617_013342_113_1036 307
342 3300046452 Ga0495617_014612 Ga0495617_014612_879_1802 307
343 3300046453 Ga0495627_021602 Ga0495627_021602_793_1716 307
344 3300046453 Ga0495627_041334 Ga0495627_041334_222_1145 307
345 3300046455 Ga0495603_0000337 Ga0495603_0000337_23520_24443 307
346 3300046457 Ga0495590_0002611 Ga0495590_0002611_4701_5657 307
347 3300046457 Ga0495590_0010841 Ga0495590_0010841_232_1173 307
348 3300046457 Ga0495590_0012332 Ga0495590_0012332_1217_2140 307
349 3300046457 Ga0495590_0013264 Ga0495590_0013264_1026_1949 307
350 3300046458 Ga0495591_000060 Ga0495591_000060_70776_71699 307
351 3300046458 Ga0495591_003898 Ga0495591_003898_953_1876 307
352 3300046458 Ga0495591_024792 Ga0495591_024792_474_1397 307
353 3300046459 Ga0495629_0004842 Ga0495629_0004842_3163_4119 307
354 3300046460 Ga0495638_0001873 Ga0495638_0001873_15445_16368 307
355 3300046460 Ga0495638_0008997 Ga0495638_0008997_3258_4181 307
356 3300046460 Ga0495638_0030308 Ga0495638_0030308_2152_3075 307
357 3300046460 Ga0495638_0081295 Ga0495638_0081295_10_933 307
358 3300046460 Ga0495638_0089763 Ga0495638_0089763_205_1161 307
359 3300046463 Ga0495653_0001219 Ga0495653_0001219_5595_6518 307
360 3300046463 Ga0495653_0005957 Ga0495653_0005957_3083_4039 307
361 3300046471 Ga0495650_0001020 Ga0495650_0001020_25305_26228 307
362 3300046471 Ga0495650_0001892 Ga0495650_0001892_1809_2732 307
363 3300046471 Ga0495650_0002415 Ga0495650_0002415_9190_10131 307
364 3300046471 Ga0495650_0005703 Ga0495650_0005703_2489_3412 307
365 3300046471 Ga0495650_0015658 Ga0495650_0015658_2241_3197 307
366 3300046471 Ga0495650_0048809 Ga0495650_0048809_261_1184 307
367 3300046472 Ga0495580_0011295 Ga0495580_0011295_1672_2628 307
368 3300046472 Ga0495580_0038337 Ga0495580_0038337_564_1520 307
369 3300046473 Ga0495582_0020479 Ga0495582_0020479_2269_3225 307
370 3300046474 Ga0495605_0004771 Ga0495605_0004771_1284_2207 307
371 3300046474 Ga0495605_0008597 Ga0495605_0008597_3701_4624 307
372 3300046474 Ga0495605_0013146 Ga0495605_0013146_1907_2830 307
373 3300046474 Ga0495605_0014977 Ga0495605_0014977_584_1540 307
374 3300046474 Ga0495605_0028302 Ga0495605_0028302_184_1107 307
375 3300046474 Ga0495605_0032970 Ga0495605_0032970_833_1756 307
376 3300046474 Ga0495605_0042677 Ga0495605_0042677_463_1386 307
377 3300046474 Ga0495605_0062347 Ga0495605_0062347_727_1650 307
378 3300046475 Ga0495639_0000016 Ga0495639_0000016_43953_44876 307
379 3300046491 Ga0495584_0012049 Ga0495584_0012049_3225_4148 307
380 3300046491 Ga0495584_0036174 Ga0495584_0036174_983_1906 307
381 3300046491 Ga0495584_0048028 Ga0495584_0048028_235_1158 307
382 3300046491 Ga0495584_0079245 Ga0495584_0079245_203_1126 307
383 3300046492 Ga0495585_0000219 Ga0495585_0000219_13085_14008 307
384 3300046492 Ga0495585_0001028 Ga0495585_0001028_19896_20837 307
385 3300046492 Ga0495585_0014678 Ga0495585_0014678_3422_4345 307
386 3300046499 Ga0495594_0003073 Ga0495594_0003073_6333_7256 307
387 3300046499 Ga0495594_0043472 Ga0495594_0043472_1237_2208 307
388 3300046500 Ga0495596_0000083 Ga0495596_0000083_36732_37655 307
389 3300046501 Ga0495607_0002053 Ga0495607_0002053_15355_16374 307
390 3300046501 Ga0495607_0008431 Ga0495607_0008431_3711_4634 307
391 3300046501 Ga0495607_0009300 Ga0495607_0009300_5289_6212 307
392 3300046501 Ga0495607_0017208 Ga0495607_0017208_2130_3161 307
393 3300046506 Ga0495583_0000467 Ga0495583_0000467_50038_51069 307
394 3300046506 Ga0495583_0004739 Ga0495583_0004739_4178_5143 307
395 3300046506 Ga0495583_0064372 Ga0495583_0064372_295_1218 307
396 3300046507 Ga0495606_0001204 Ga0495606_0001204_32022_32957 307
397 3300046507 Ga0495606_0004583 Ga0495606_0004583_349_1272 307
398 3300046507 Ga0495606_0009895 Ga0495606_0009895_5799_6722 307
399 3300046507 Ga0495606_0012725 Ga0495606_0012725_2150_3106 307
400 3300046512 Ga0495610_0000842 Ga0495610_0000842_8257_9180 307
401 3300046512 Ga0495610_0008011 Ga0495610_0008011_1070_1993 307
402 3300046512 Ga0495610_0011287 Ga0495610_0011287_1453_2376 307
403 3300046513 Ga0495616_0001642 Ga0495616_0001642_13677_14600 307
404 3300046513 Ga0495616_0027767 Ga0495616_0027767_1442_2407 307
405 3300046515 Ga0495620_0006725 Ga0495620_0006725_1672_2595 307
406 3300046515 Ga0495620_0013828 Ga0495620_0013828_1403_2326 307
407 3300046516 Ga0495628_0011614 Ga0495628_0011614_2881_3837 307
408 3300046516 Ga0495628_0099929 Ga0495628_0099929_609_1643 307
409 3300046517 Ga0495630_0004302 Ga0495630_0004302_7372_8295 307
410 3300046517 Ga0495630_0076627 Ga0495630_0076627_619_1542 307
411 3300046517 Ga0495630_0099332 Ga0495630_0099332_1216_2172 307
412 3300046518 Ga0495631_0000014 Ga0495631_0000014_12716_13639 307
413 3300046518 Ga0495631_0003553 Ga0495631_0003553_954_1877 307
414 3300046519 Ga0495632_0000022 Ga0495632_0000022_107022_107945 307
415 3300046519 Ga0495632_0000301 Ga0495632_0000301_8900_9841 307
416 3300046519 Ga0495632_0002786 Ga0495632_0002786_1809_2732 307
417 3300046519 Ga0495632_0003547 Ga0495632_0003547_9461_10384 307
418 3300046519 Ga0495632_0003659 Ga0495632_0003659_922_1845 307
419 3300046519 Ga0495632_0084462 Ga0495632_0084462_28_1047 307
420 3300046519 Ga0495632_0101206 Ga0495632_0101206_355_1278 307
421 3300046520 Ga0495637_0000294 Ga0495637_0000294_36999_37922 307
422 3300046520 Ga0495637_0000463 Ga0495637_0000463_1297_2238 307
423 3300046520 Ga0495637_0007661 Ga0495637_0007661_4401_5324 307
424 3300046520 Ga0495637_0016435 Ga0495637_0016435_1407_2330 307
425 3300046520 Ga0495637_0039923 Ga0495637_0039923_107_1030 307
426 3300046522 Ga0495643_0040579 Ga0495643_0040579_473_1492 307
427 3300046523 Ga0495644_0000064 Ga0495644_0000064_40673_41596 307
428 3300046523 Ga0495644_0023999 Ga0495644_0023999_1098_2021 307
429 3300046524 Ga0495648_0011057 Ga0495648_0011057_1470_2435 307
430 3300046524 Ga0495648_0030605 Ga0495648_0030605_45_968 307
431 3300046524 Ga0495648_0085733 Ga0495648_0085733_543_1499 307
432 3300046524 Ga0495648_0094701 Ga0495648_0094701_628_1599 307
433 3300046526 Ga0495666_0001376 Ga0495666_0001376_9571_10494 307
434 3300046526 Ga0495666_0087557 Ga0495666_0087557_398_1357 307
435 3300046526 Ga0495666_0096078 Ga0495666_0096078_374_1330 307
436 3300046528 Ga0495642_0000011 Ga0495642_0000011_76433_77464 307
437 3300046529 Ga0495652_0029190 Ga0495652_0029190_113_1072 307
438 3300046530 Ga0495654_0000263 Ga0495654_0000263_35040_35963 307
439 3300046530 Ga0495654_0002386 Ga0495654_0002386_6663_7586 307
440 3300046530 Ga0495654_0020473 Ga0495654_0020473_1034_1957 307
441 3300046530 Ga0495654_0026601 Ga0495654_0026601_1893_2816 307
442 3300046530 Ga0495654_0061955 Ga0495654_0061955_100_1023 307
443 3300046530 Ga0495654_0070932 Ga0495654_0070932_36_977 307
444 3300046531 Ga0495665_0045648 Ga0495665_0045648_583_1539 307
445 3300046536 Ga0495587_0001361 Ga0495587_0001361_7204_8127 307
446 3300046538 Ga0495609_0000212 Ga0495609_0000212_27714_28745 307
447 3300046538 Ga0495609_0087983 Ga0495609_0087983_276_1232 307
448 3300046542 Ga0495597_0001850 Ga0495597_0001850_13043_14062 307
449 3300046542 Ga0495597_0024251 Ga0495597_0024251_995_1918 307
450 3300046542 Ga0495597_0045891 Ga0495597_0045891_768_1691 307
451 3300046557 Ga0495622_0000070 Ga0495622_0000070_51892_52815 307
452 3300046557 Ga0495622_0000350 Ga0495622_0000350_17664_18635 307
453 3300046558 Ga0495633_0002077 Ga0495633_0002077_2046_2969 307
454 3300046616 Ga0495668_0000635 Ga0495668_0000635_1576_2499 307
455 3300046642 Ga0495634_0000290 Ga0495634_0000290_35896_36819 307
456 3300046660 Ga0495625_0002425 Ga0495625_0002425_1808_2731 307
457 3300046660 Ga0495625_0002680 Ga0495625_0002680_1173_2096 307
458 3300046660 Ga0495625_0026831 Ga0495625_0026831_261_1184 307
459 3300046663 Ga0495635_0000107 Ga0495635_0000107_1043_1966 307
460 3300046664 Ga0495659_0000056 Ga0495659_0000056_11098_12021 307
461 3300046664 Ga0495659_0005571 Ga0495659_0005571_2629_3660 307
462 3300046665 Ga0495661_0016734 Ga0495661_0016734_2731_3654 307
463 3300046665 Ga0495661_0023211 Ga0495661_0023211_2023_2979 307
464 3300046675 Ga0495657_0125585 Ga0495657_0125585_395_1318 307
465 3300046679 Ga0495623_0019562 Ga0495623_0019562_2341_3375 307
466 3300046679 Ga0495623_0058750 Ga0495623_0058750_1090_2013 307
467 3300046680 Ga0495646_0000723 Ga0495646_0000723_6451_7374 307
468 3300046680 Ga0495646_0007377 Ga0495646_0007377_3038_3994 307
469 3300046684 Ga0495669_0000591 Ga0495669_0000591_762_1685 307
470 3300046690 Ga0495624_0008865 Ga0495624_0008865_2604_3560 307
471 3300046690 Ga0495624_0020250 Ga0495624_0020250_2555_3511 307
472 3300046692 Ga0495671_0000496 Ga0495671_0000496_2828_3751 307
473 3300046692 Ga0495671_0050039 Ga0495671_0050039_1090_2013 307
474 3300046692 Ga0495671_0057728 Ga0495671_0057728_779_1702 307
475 3300046692 Ga0495671_0062279 Ga0495671_0062279_761_1684 307
476 3300046694 Ga0495649_0000485 Ga0495649_0000485_4643_5566 307
477 3300046694 Ga0495649_0001028 Ga0495649_0001028_20491_21414 307
478 3300046694 Ga0495649_0029045 Ga0495649_0029045_664_1587 307
479 3300046694 Ga0495649_0069201 Ga0495649_0069201_708_1631 307
480 3300046694 Ga0495649_0070452 Ga0495649_0070452_589_1512 307
481 3300046694 Ga0495649_0081851 Ga0495649_0081851_697_1716 307
482 3300046794 Ga0495589_0000823 Ga0495589_0000823_18540_19472 307
483 3300046794 Ga0495589_0018397 Ga0495589_0018397_1784_2707 307
484 3300046794 Ga0495589_0018643 Ga0495589_0018643_1926_2849 307
485 3300046794 Ga0495589_0026254 Ga0495589_0026254_393_1358 307
486 3300046794 Ga0495589_0076824 Ga0495589_0076824_315_1238 307
487 3300046810 Ga0495660_0031644 Ga0495660_0031644_1764_2783 307
488 3300046810 Ga0495660_0044438 Ga0495660_0044438_682_1605 307
489 3300046810 Ga0495660_0046093 Ga0495660_0046093_637_1560 307
490 3300046810 Ga0495660_0099126 Ga0495660_0099126_113_1036 307
491 3300047315 Ga0495581_0002889 Ga0495581_0002889_2396_3319 307
492 3300047317 Ga0495604_0009287 Ga0495604_0009287_5346_6269 307
493 3300047317 Ga0495604_0027529 Ga0495604_0027529_2265_3188 307
494 3300047318 Ga0495636_0024195 Ga0495636_0024195_805_1746 307
495 3300047319 Ga0495674_0000507 Ga0495674_0000507_10904_11863 307
496 3300047319 Ga0495674_0002074 Ga0495674_0002074_16458_17414 307
497 3300047319 Ga0495674_0006124 Ga0495674_0006124_2328_3293 307
498 3300047319 Ga0495674_0010629 Ga0495674_0010629_6537_7460 307
499 3300047320 Ga0495672_0000698 Ga0495672_0000698_33678_34601 307
500 3300047320 Ga0495672_0030539 Ga0495672_0030539_956_1921 307
501 3300047320 Ga0495672_0037598 Ga0495672_0037598_686_1609 307
502 3300047320 Ga0495672_0041484 Ga0495672_0041484_684_1607 307
503 3300047320 Ga0495672_0050550 Ga0495672_0050550_736_1677 307
504 3300047320 Ga0495672_0118664 Ga0495672_0118664_27_950 307
505 3300047321 Ga0495676_0157246 Ga0495676_0157246_341_1297 307
506 3300047323 Ga0495683_0000057 Ga0495683_0000057_10239_11162 307
507 3300047323 Ga0495683_0002986 Ga0495683_0002986_736_1659 307
508 3300047323 Ga0495683_0009936 Ga0495683_0009936_3159_4082 307
509 3300047323 Ga0495683_0015284 Ga0495683_0015284_2007_2930 307
510 3300047323 Ga0495683_0026580 Ga0495683_0026580_1432_2355 307
511 3300047323 Ga0495683_0074784 Ga0495683_0074784_539_1504 307
512 3300047443 Ga0495687_003368 Ga0495687_003368_9556_10587 307
513 3300047443 Ga0495687_003616 Ga0495687_003616_9188_10111 307
514 3300047443 Ga0495687_007084 Ga0495687_007084_284_1249 307
515 3300047446 Ga0495679_000054 Ga0495679_000054_20806_21762 307
516 3300047446 Ga0495679_001048 Ga0495679_001048_15792_16724 307
517 3300047446 Ga0495679_027634 Ga0495679_027634_835_1758 307
518 3300047469 Ga0495673_0000234 Ga0495673_0000234_13633_14556 307
519 3300047469 Ga0495673_0000717 Ga0495673_0000717_25234_26157 307
520 3300047469 Ga0495673_0000829 Ga0495673_0000829_8129_9052 307
521 3300047469 Ga0495673_0000891 Ga0495673_0000891_25226_26149 307
522 3300047469 Ga0495673_0004176 Ga0495673_0004176_1243_2199 307
523 3300047469 Ga0495673_0007511 Ga0495673_0007511_4446_5411 307
524 3300047469 Ga0495673_0043354 Ga0495673_0043354_92_1024 307
525 3300047469 Ga0495673_0045372 Ga0495673_0045372_810_1841 307
526 3300047470 Ga0495681_0000533 Ga0495681_0000533_14929_15852 307
527 3300047470 Ga0495681_0003850 Ga0495681_0003850_3030_3953 307
528 3300047470 Ga0495681_0049707 Ga0495681_0049707_501_1520 307
529 3300047471 Ga0495684_0169533 Ga0495684_0169533_517_1440 307
530 3300047472 Ga0495686_0002045 Ga0495686_0002045_1752_2675 307
531 3300047472 Ga0495686_0011147 Ga0495686_0011147_2847_3770 307
532 3300047673 Ga0495593_0003972 Ga0495593_0003972_1672_2628 307
533 3300047673 Ga0495593_0027760 Ga0495593_0027760_1753_2676 307
534 3300047673 Ga0495593_0028898 Ga0495593_0028898_64_1020 307
535 3300047673 Ga0495593_0065136 Ga0495593_0065136_684_1607 307
536 3300048089 Ga0495614_0017913 Ga0495614_0017913_1509_2468 307
537 3300048091 Ga0495626_0000066 Ga0495626_0000066_128252_129178 307
538 3300048091 Ga0495626_0000077 Ga0495626_0000077_106328_107251 307
539 3300048091 Ga0495626_0000268 Ga0495626_0000268_35335_36258 307
540 3300048091 Ga0495626_0000513 Ga0495626_0000513_11968_12891 307
541 3300048091 Ga0495626_0016477 Ga0495626_0016477_2644_3600 307
542 3300048091 Ga0495626_0032165 Ga0495626_0032165_318_1349 307
543 3300048091 Ga0495626_0041723 Ga0495626_0041723_744_1685 307
544 3300048091 Ga0495626_0082129 Ga0495626_0082129_274_1239 307
545 3300048903 Ga0496100_0049028 Ga0496100_0049028_1569_2534 307
546 3300048905 Ga0496102_0000394 Ga0496102_0000394_14256_15290 307
547 3300048905 Ga0496102_0285136 Ga0496102_0285136_535_1491 307
548 3300048906 Ga0496103_0000807 Ga0496103_0000807_1191_2225 307
549 3300048907 Ga0496104_0008299 Ga0496104_0008299_521_1444 307
550 3300048910 Ga0496107_0207349 Ga0496107_0207349_445_1410 307
551 3300048914 Ga0496111_0429002 Ga0496111_0429002_17_940 307
552 3300048915 Ga0496112_0003653 Ga0496112_0003653_6134_7099 307
553 3300048916 Ga0496113_0023278 Ga0496113_0023278_2842_3807 307
554 3300048918 Ga0496115_0018838 Ga0496115_0018838_1648_2682 307
555 3300048919 Ga0496116_0000744 Ga0496116_0000744_9600_10523 307
556 3300048919 Ga0496116_0004404 Ga0496116_0004404_11942_12865 307
557 3300048919 Ga0496116_0017890 Ga0496116_0017890_399_1322 307
558 3300048920 Ga0496117_0001810 Ga0496117_0001810_6191_7114 307
559 3300048920 Ga0496117_0023279 Ga0496117_0023279_999_2033 307
560 3300048921 Ga0496118_0006225 Ga0496118_0006225_1225_2259 307
561 3300048921 Ga0496118_0010514 Ga0496118_0010514_5145_6101 307
562 3300048921 Ga0496118_0011091 Ga0496118_0011091_1721_2644 307
563 3300048921 Ga0496118_0066121 Ga0496118_0066121_1561_2484 307
564 3300048921 Ga0496118_0083905 Ga0496118_0083905_1216_2139 307
565 3300048922 Ga0496119_0065628 Ga0496119_0065628_33_998 307
566 3300048924 Ga0496121_0004629 Ga0496121_0004629_2891_3856 307
567 3300048924 Ga0496121_0013075 Ga0496121_0013075_6203_7126 307
568 3300048924 Ga0496121_0034186 Ga0496121_0034186_2663_3586 307
569 3300048924 Ga0496121_0034234 Ga0496121_0034234_3243_4166 307
570 3300048925 Ga0496122_0001075 Ga0496122_0001075_37451_38374 307
571 3300048925 Ga0496122_0005294 Ga0496122_0005294_8317_9240 307
572 3300048925 Ga0496122_0010920 Ga0496122_0010920_692_1615 307
573 3300048926 Ga0496123_0000064 Ga0496123_0000064_30340_31263 307
574 3300048926 Ga0496123_0008678 Ga0496123_0008678_692_1615 307
575 3300048926 Ga0496123_0010347 Ga0496123_0010347_2372_3295 307
576 3300048927 Ga0496124_0003588 Ga0496124_0003588_11407_12330 307
577 3300048927 Ga0496124_0125040 Ga0496124_0125040_313_1236 307
578 3300048928 Ga0496125_0010383 Ga0496125_0010383_4807_5730 307
579 3300048928 Ga0496125_0022611 Ga0496125_0022611_2307_3230 307
580 3300048928 Ga0496125_0045688 Ga0496125_0045688_386_1309 307
581 3300048928 Ga0496125_0227651 Ga0496125_0227651_199_1122 307
582 3300048929 Ga0496126_0007462 Ga0496126_0007462_5694_6617 307
583 3300048929 Ga0496126_0013013 Ga0496126_0013013_2358_3281 307
584 3300049459 Ga0495678_001920 Ga0495678_001920_1316_2335 307
585 3300049459 Ga0495678_015692 Ga0495678_015692_757_1680 307
586 3300049460 Ga0495682_0003682 Ga0495682_0003682_2838_3803 307
587 3300049460 Ga0495682_0020493 Ga0495682_0020493_1275_2309 307
588 3300061719 Ga0466962_0003294 Ga0466962_0003294_4903_5835 307
589 3300061719 Ga0466962_0020824 Ga0466962_0020824_728_1705 307
590 iso_pu_bacteria 2902682994 2902686069 307
591 iso_pu_bacteria 2978975091 2978979684 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

7

281

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j31-assembly2.cif.gz_D crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii 0.9008 4 274
7ovg-assembly1.cif.gz_B the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide 0.8859 3 274
6i00-assembly1.cif.gz_J cryo-em informed directed evolution of nitrilase 4 leads to a change in quaternary structure. 0.8833 4 307
6i00-assembly1.cif.gz_J cryo-em informed directed evolution of nitrilase 4 leads to a change in quaternary structure. 0.8747 4 307
3wuy-assembly1.cif.gz_A crystal structure of nit6803 0.8712 3 278
ID Description Score Start End Superfamily
af_P40447_2_198_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9324 6 193 3.60.110.10
af_P32961_18_309_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9192 2 280 3.60.110.10
af_Q23384_2_280_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9014 5 280 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.898 5 274 3.60.110.10
af_Q23384_2_280_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8891 5 280 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2R7K712-F1-model_v4 deleted 0.9476 4 209
AF-A0A2R7S9V7-F1-model_v4 deleted 0.9457 4 141
AF-A0A434NWG8-F1-model_v4 Nitrilase 0.9337 6 216 GO:0000257
AF-B8LLF1-F1-model_v4 cyanoalanine nitrilase (EC 3.5.5.4) 0.9312 6 136 GO:0018822
GO:0047427
GO:0051410
AF-A0A1I7T015-F1-model_v4 CN hydrolase domain-containing protein 0.923 6 204 GO:0000257
GO:0016836

Feature Viewer

pLDDT pTM Quality
87.23 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map