F467056
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 357 | 520 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10025325|Ga0265327_100253254 |
| Length | 319 |
| Sequence | MTKHIRRVAVVQAGSAMFDTPRTLERMQSHCEAAASQALDLVVFPEAYIGGYPKGLDFGARVGTRSAAGREEYLRYWESAIDVPGPETARIGEYAANIGATLVVGVIERDAGTLYCTALFFTPAGALQSKHRKLMPTAMERLIWGFGDGSTLPVIDTPAGRVAAAICWENYMPNLRSALYAGGTQFWCAPTVDDRDVWQASMRHIAVEGRCFVASACQYMLRADAPADYDCMQGNDPDTVLIRGGSVIVSPLGEILAGPLYGTEGLLVADADLSDHTRGKYDLDVTGHYARPDVFQLTVNRSVQAAVADRAPGAHVELK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 8 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 9 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 10 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 11 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 14 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 15 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 16 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 17 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 18 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 19 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 20 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 21 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 22 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 23 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 24 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 25 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 26 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 27 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 28 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 29 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 30 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 31 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 32 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 33 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 34 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 35 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 36 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 37 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 38 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 39 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 40 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 41 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 42 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 43 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 44 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 45 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 46 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 47 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 48 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 49 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 50 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 51 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 52 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 53 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 54 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 55 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 56 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 57 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 58 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 59 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 60 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 61 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 62 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 63 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 64 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 66 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 74 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 215 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 218 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 219 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 220 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 221 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 222 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 223 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 224 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 225 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 346 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 347 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 348 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 349 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 350 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 351 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 352 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 353 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 354 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 355 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 356 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 357 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.99 |
| Metatranscriptomes | 0 |
| Isolates | 12.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.75 |
| Nodule | 1.02 |
| Rhizoplane | 2.71 |
| Rhizosphere | 79.53 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 10.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10019145 | 3300001989 | Bacteria | 2454 |
| 2 | JGI24735J21928_10069460 | 3300002067 | Bacteria | 1009 |
| 3 | JGI25162J39368_1000051 | 3300002737 | Bacteria | 156765 |
| 4 | JGI25163J39215_1000030 | 3300002771 | Bacteria | 65586 |
| 5 | JGI25164J39214_1000027 | 3300002772 | Bacteria | 156759 |
| 6 | JGI25165J46597_1000101 | 3300003214 | Bacteria | 156765 |
| 7 | Ga0055529_1000783 | 3300003763 | Bacteria | 19677 |
| 8 | Ga0055536_1003447 | 3300003781 | Bacteria | 8482 |
| 9 | Ga0055536_1012362 | 3300003781 | Bacteria | 3174 |
| 10 | Ga0055528_1004283 | 3300003790 | Bacteria | 6900 |
| 11 | Ga0055530_10007923 | 3300003791 | Bacteria | 4356 |
| 12 | Ga0055540_1000420 | 3300003792 | Bacteria | 33992 |
| 13 | Ga0055540_1000492 | 3300003792 | Bacteria | 30076 |
| 14 | Ga0055531_10000309 | 3300003794 | Bacteria | 48285 |
| 15 | Ga0065714_10003773 | 3300005288 | Bacteria | 10311 |
| 16 | Ga0065714_10013835 | 3300005288 | Bacteria | 1952 |
| 17 | Ga0065714_10018286 | 3300005288 | Bacteria | 2225 |
| 18 | Ga0065712_10002138 | 3300005290 | Bacteria | 5861 |
| 19 | Ga0065712_10075821 | 3300005290 | Bacteria | 3783 |
| 20 | Ga0065715_10096779 | 3300005293 | Bacteria | 3820 |
| 21 | Ga0070658_10050471 | 3300005327 | Bacteria | 3372 |
| 22 | Ga0070676_10008160 | 3300005328 | Bacteria | 5633 |
| 23 | Ga0070683_100092802 | 3300005329 | Bacteria | 2836 |
| 24 | Ga0070690_100007404 | 3300005330 | Bacteria | 6287 |
| 25 | Ga0070670_100011258 | 3300005331 | Bacteria | 7646 |
| 26 | Ga0068869_100005075 | 3300005334 | Bacteria | 8254 |
| 27 | Ga0070682_100087022 | 3300005337 | Bacteria | 2036 |
| 28 | Ga0068868_100047158 | 3300005338 | Bacteria | 3375 |
| 29 | Ga0070660_100000032 | 3300005339 | Bacteria | 85304 |
| 30 | Ga0070689_100001773 | 3300005340 | Bacteria | 13844 |
| 31 | Ga0070687_100001091 | 3300005343 | Bacteria | 9326 |
| 32 | Ga0070661_100004510 | 3300005344 | Bacteria | 9588 |
| 33 | Ga0070692_10021763 | 3300005345 | Bacteria | 3122 |
| 34 | Ga0070669_100032108 | 3300005353 | Bacteria | 3793 |
| 35 | Ga0070675_100020801 | 3300005354 | Bacteria | 5237 |
| 36 | Ga0070673_100000964 | 3300005364 | Bacteria | 16319 |
| 37 | Ga0070688_100015862 | 3300005365 | Bacteria | 4295 |
| 38 | Ga0070659_100000035 | 3300005366 | Bacteria | 115022 |
| 39 | Ga0070701_10064522 | 3300005438 | Bacteria | 1941 |
| 40 | Ga0070705_100022729 | 3300005440 | Bacteria | 3355 |
| 41 | Ga0070700_100072775 | 3300005441 | Bacteria | 2198 |
| 42 | Ga0070694_100022460 | 3300005444 | Bacteria | 4042 |
| 43 | Ga0070663_100001341 | 3300005455 | Bacteria | 13444 |
| 44 | Ga0070662_100031143 | 3300005457 | Bacteria | 3741 |
| 45 | Ga0070662_100074061 | 3300005457 | Bacteria | 2518 |
| 46 | Ga0068867_100007456 | 3300005459 | Bacteria | 7738 |
| 47 | Ga0070685_10018645 | 3300005466 | Bacteria | 3735 |
| 48 | Ga0070684_100005098 | 3300005535 | Bacteria | 10037 |
| 49 | Ga0070686_100003171 | 3300005544 | Bacteria | 9000 |
| 50 | Ga0070665_100231753 | 3300005548 | Bacteria | 1847 |
| 51 | Ga0070664_100003939 | 3300005564 | Bacteria | 11974 |
| 52 | Ga0070702_100244755 | 3300005615 | Bacteria | 1212 |
| 53 | Ga0068852_100039241 | 3300005616 | Bacteria | 3985 |
| 54 | Ga0068859_100002841 | 3300005617 | Bacteria | 17568 |
| 55 | Ga0068864_100013233 | 3300005618 | Bacteria | 6833 |
| 56 | Ga0068861_100001395 | 3300005719 | Bacteria | 15176 |
| 57 | Ga0068861_100007235 | 3300005719 | Bacteria | 7605 |
| 58 | Ga0068863_100004099 | 3300005841 | Bacteria | 14394 |
| 59 | Ga0068860_100081077 | 3300005843 | Bacteria | 3086 |
| 60 | Ga0068862_100002154 | 3300005844 | Bacteria | 17709 |
| 61 | Ga0075432_10000949 | 3300006058 | Bacteria | 9146 |
| 62 | Ga0075432_10013134 | 3300006058 | Bacteria | 2814 |
| 63 | Ga0068871_100060188 | 3300006358 | Bacteria | 3097 |
| 64 | Ga0075428_100034198 | 3300006844 | Bacteria | 5608 |
| 65 | Ga0075428_100082352 | 3300006844 | Bacteria | 3511 |
| 66 | Ga0075431_100000002 | 3300006847 | Bacteria | 153069 |
| 67 | Ga0075429_100017681 | 3300006880 | Bacteria | 6166 |
| 68 | Ga0075429_100052780 | 3300006880 | Bacteria | 3537 |
| 69 | Ga0097620_100002841 | 3300006931 | Bacteria | 17568 |
| 70 | Ga0105251_10005374 | 3300009011 | Bacteria | 8394 |
| 71 | Ga0105244_10015632 | 3300009036 | Bacteria | 4347 |
| 72 | Ga0105244_10019652 | 3300009036 | Bacteria | 3765 |
| 73 | Ga0105244_10053380 | 3300009036 | Bacteria | 2054 |
| 74 | Ga0105250_10000084 | 3300009092 | Bacteria | 82520 |
| 75 | Ga0105250_10000549 | 3300009092 | Bacteria | 25642 |
| 76 | Ga0105250_10003112 | 3300009092 | Bacteria | 7983 |
| 77 | Ga0105250_10099049 | 3300009092 | Bacteria | 1189 |
| 78 | Ga0105240_10117814 | 3300009093 | Bacteria | 3201 |
| 79 | Ga0111539_10001191 | 3300009094 | Bacteria | 34561 |
| 80 | Ga0111539_10019623 | 3300009094 | Bacteria | 8341 |
| 81 | Ga0111539_10092884 | 3300009094 | Bacteria | 3545 |
| 82 | Ga0111539_10147229 | 3300009094 | Bacteria | 2757 |
| 83 | Ga0114129_10061189 | 3300009147 | Bacteria | 5261 |
| 84 | Ga0114129_10367788 | 3300009147 | Bacteria | 1901 |
| 85 | Ga0105241_10401529 | 3300009174 | Bacteria | 1202 |
| 86 | Ga0105248_10016878 | 3300009177 | Bacteria | 8038 |
| 87 | Ga0105238_10132314 | 3300009551 | Bacteria | 2473 |
| 88 | Ga0105249_10037754 | 3300009553 | Bacteria | 4383 |
| 89 | Ga0105239_10017732 | 3300010375 | Bacteria | 7877 |
| 90 | Ga0105246_10026618 | 3300011119 | Bacteria | 3782 |
| 91 | Ga0105246_10041298 | 3300011119 | Bacteria | 3117 |
| 92 | Ga0157373_10008632 | 3300013100 | Bacteria | 7561 |
| 93 | Ga0157371_10000189 | 3300013102 | Bacteria | 91155 |
| 94 | Ga0157371_10007038 | 3300013102 | Bacteria | 9153 |
| 95 | Ga0157370_10100427 | 3300013104 | Bacteria | 2711 |
| 96 | Ga0157369_10000802 | 3300013105 | Bacteria | 40181 |
| 97 | Ga0163162_10009747 | 3300013306 | Bacteria | 9351 |
| 98 | Ga0163162_10049179 | 3300013306 | Bacteria | 4226 |
| 99 | Ga0157375_10016404 | 3300013308 | Bacteria | 6654 |
| 100 | Ga0163163_10011164 | 3300014325 | Bacteria | 8134 |
| 101 | Ga0157377_10004934 | 3300014745 | Bacteria | 6215 |
| 102 | Ga0157376_10091077 | 3300014969 | Bacteria | 2641 |
| 103 | Ga0182006_1000191 | 3300015261 | Bacteria | 63183 |
| 104 | Ga0182006_1020569 | 3300015261 | Bacteria | 2764 |
| 105 | Ga0182005_1000092 | 3300015265 | Bacteria | 67804 |
| 106 | Ga0163161_10005213 | 3300017792 | Bacteria | 9042 |
| 107 | Ga0163161_10019022 | 3300017792 | Bacteria | 4814 |
| 108 | Ga0163161_10024765 | 3300017792 | Bacteria | 4242 |
| 109 | Ga0213872_10006341 | 3300021361 | Bacteria | 5954 |
| 110 | Ga0209760_100014 | 3300025207 | Bacteria | 177898 |
| 111 | Ga0209566_101181 | 3300025225 | Bacteria | 9449 |
| 112 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 113 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 114 | Ga0209147_100163 | 3300025229 | Bacteria | 90494 |
| 115 | Ga0209147_100239 | 3300025229 | Bacteria | 53469 |
| 116 | Ga0209147_100259 | 3300025229 | Bacteria | 49184 |
| 117 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 118 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 119 | Ga0209258_100191 | 3300025242 | Bacteria | 125980 |
| 120 | Ga0209258_100289 | 3300025242 | Bacteria | 82650 |
| 121 | Ga0209148_1000081 | 3300025254 | Bacteria | 273676 |
| 122 | Ga0209759_1011057 | 3300025256 | Bacteria | 2595 |
| 123 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 124 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 125 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 126 | Ga0209676_1000105 | 3300025292 | Bacteria | 224151 |
| 127 | Ga0209676_1000855 | 3300025292 | Bacteria | 39250 |
| 128 | Ga0209564_1018517 | 3300025295 | Bacteria | 2649 |
| 129 | Ga0209050_1001141 | 3300025298 | Bacteria | 31960 |
| 130 | Ga0209051_1000064 | 3300025303 | Bacteria | 231735 |
| 131 | Ga0209257_1000109 | 3300025304 | Bacteria | 239439 |
| 132 | Ga0207696_1000222 | 3300025711 | Bacteria | 82527 |
| 133 | Ga0207696_1000607 | 3300025711 | Bacteria | 26704 |
| 134 | Ga0207696_1002327 | 3300025711 | Bacteria | 9423 |
| 135 | Ga0207696_1008008 | 3300025711 | Bacteria | 4085 |
| 136 | Ga0207696_1034175 | 3300025711 | Bacteria | 1520 |
| 137 | Ga0207655_1001108 | 3300025728 | Bacteria | 26310 |
| 138 | Ga0207655_1016969 | 3300025728 | Bacteria | 3951 |
| 139 | Ga0207655_1048637 | 3300025728 | Bacteria | 1739 |
| 140 | Ga0207713_1005227 | 3300025735 | Bacteria | 8184 |
| 141 | Ga0207713_1010201 | 3300025735 | Bacteria | 5218 |
| 142 | Ga0207688_10186432 | 3300025901 | Bacteria | 1239 |
| 143 | Ga0207647_10006816 | 3300025904 | Bacteria | 8282 |
| 144 | Ga0207645_10015033 | 3300025907 | Bacteria | 5158 |
| 145 | Ga0207643_10119786 | 3300025908 | Bacteria | 1558 |
| 146 | Ga0207705_10036150 | 3300025909 | Bacteria | 3535 |
| 147 | Ga0207695_10022380 | 3300025913 | Bacteria | 7176 |
| 148 | Ga0207662_10004095 | 3300025918 | Bacteria | 7623 |
| 149 | Ga0207657_10000051 | 3300025919 | Bacteria | 109129 |
| 150 | Ga0207657_10345090 | 3300025919 | Bacteria | 1175 |
| 151 | Ga0207649_10001844 | 3300025920 | Bacteria | 12107 |
| 152 | Ga0207681_10022636 | 3300025923 | Bacteria | 4010 |
| 153 | Ga0207650_10012826 | 3300025925 | Bacteria | 5791 |
| 154 | Ga0207659_10045263 | 3300025926 | Bacteria | 3101 |
| 155 | Ga0207690_10000034 | 3300025932 | Bacteria | 149574 |
| 156 | Ga0207690_10010955 | 3300025932 | Bacteria | 5406 |
| 157 | Ga0207706_10021203 | 3300025933 | Bacteria | 5837 |
| 158 | Ga0207670_10007311 | 3300025936 | Bacteria | 6151 |
| 159 | Ga0207669_10068150 | 3300025937 | Bacteria | 2221 |
| 160 | Ga0207704_10185245 | 3300025938 | Bacteria | 1508 |
| 161 | Ga0207691_10013069 | 3300025940 | Bacteria | 7949 |
| 162 | Ga0207689_10001689 | 3300025942 | Bacteria | 20967 |
| 163 | Ga0207661_10360974 | 3300025944 | Bacteria | 1312 |
| 164 | Ga0207679_10028989 | 3300025945 | Bacteria | 3849 |
| 165 | Ga0207667_10083069 | 3300025949 | Bacteria | 3317 |
| 166 | Ga0207668_10008961 | 3300025972 | Bacteria | 5984 |
| 167 | Ga0207677_10036586 | 3300026023 | Bacteria | 3201 |
| 168 | Ga0207703_10049319 | 3300026035 | Bacteria | 3404 |
| 169 | Ga0207678_10000508 | 3300026067 | Bacteria | 35274 |
| 170 | Ga0207678_10502322 | 3300026067 | Bacteria | 1057 |
| 171 | Ga0207708_10092538 | 3300026075 | Bacteria | 2333 |
| 172 | Ga0207641_10024452 | 3300026088 | Bacteria | 4979 |
| 173 | Ga0207648_10026094 | 3300026089 | Bacteria | 5195 |
| 174 | Ga0207676_10013416 | 3300026095 | Bacteria | 5885 |
| 175 | Ga0207674_10468378 | 3300026116 | Bacteria | 1218 |
| 176 | Ga0207675_100008825 | 3300026118 | Bacteria | 9462 |
| 177 | Ga0207675_100010477 | 3300026118 | Bacteria | 8683 |
| 178 | Ga0209371_1000439 | 3300027312 | Bacteria | 42232 |
| 179 | Ga0207428_10025777 | 3300027907 | Bacteria | 4916 |
| 180 | Ga0207428_10026239 | 3300027907 | Bacteria | 4864 |
| 181 | Ga0268266_10467697 | 3300028379 | Bacteria | 1200 |
| 182 | Ga0268265_10004923 | 3300028380 | Bacteria | 9183 |
| 183 | Ga0268265_10007323 | 3300028380 | Bacteria | 7448 |
| 184 | Ga0268265_10353293 | 3300028380 | Bacteria | 1343 |
| 185 | Ga0268256_1000895 | 3300030500 | Bacteria | 20555 |
| 186 | Ga0265327_10025325 | 3300031251 | Bacteria | 3463 |
| 187 | Ga0307408_100157814 | 3300031548 | Bacteria | 1799 |
| 188 | Ga0316576_10200465 | 3300031727 | Bacteria | 1503 |
| 189 | Ga0307406_10106614 | 3300031901 | Bacteria | 1920 |
| 190 | Ga0307416_100015666 | 3300032002 | Bacteria | 5244 |
| 191 | Ga0307414_10487093 | 3300032004 | Bacteria | 1089 |
| 192 | Ga0307415_100042319 | 3300032126 | Bacteria | 3031 |
| 193 | Ga0373931_0036871 | 3300035691 | Bacteria | 2551 |
| 194 | Ga0395899_0030038 | 3300037312 | Bacteria | 4090 |
| 195 | Ga0395899_0164633 | 3300037312 | Bacteria | 1565 |
| 196 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 197 | Ga0395900_0003333 | 3300037418 | Bacteria | 17365 |
| 198 | Ga0395900_0061875 | 3300037418 | Bacteria | 3848 |
| 199 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 200 | Ga0395898_0001172 | 3300037466 | Bacteria | 39985 |
| 201 | Ga0395898_0077661 | 3300037466 | Bacteria | 3205 |
| 202 | Ga0395901_0000045 | 3300038443 | Bacteria | 188874 |
| 203 | Ga0395901_0012509 | 3300038443 | Bacteria | 8611 |
| 204 | Ga0395901_0086188 | 3300038443 | Bacteria | 3284 |
| 205 | Ga0436365_0433621 | 3300039437 | Bacteria | 4087 |
| 206 | Ga0436361_1123903 | 3300039447 | Bacteria | 20318 |
| 207 | Ga0439438_001454 | 3300041405 | Bacteria | 10435 |
| 208 | Ga0439432_010954 | 3300042006 | Bacteria | 3128 |
| 209 | Ga0439451_000735 | 3300042009 | Bacteria | 6218 |
| 210 | Ga0439451_003621 | 3300042009 | Bacteria | 3126 |
| 211 | Ga0439452_000146 | 3300042010 | Bacteria | 52810 |
| 212 | Ga0439452_000292 | 3300042010 | Bacteria | 32220 |
| 213 | Ga0439452_005855 | 3300042010 | Bacteria | 3915 |
| 214 | Ga0439456_018778 | 3300042013 | Bacteria | 1452 |
| 215 | Ga0450892_005616 | 3300042130 | Bacteria | 1034 |
| 216 | Ga0450903_000497 | 3300042138 | Bacteria | 8252 |
| 217 | Ga0450904_001470 | 3300042139 | Bacteria | 3284 |
| 218 | Ga0450907_000060 | 3300042146 | Bacteria | 43254 |
| 219 | Ga0439446_0006650 | 3300042156 | Bacteria | 3023 |
| 220 | Ga0450909_011975 | 3300042185 | Bacteria | 1270 |
| 221 | Ga0439434_0000096 | 3300042435 | Bacteria | 22268 |
| 222 | Ga0439460_0001418 | 3300042461 | Bacteria | 5647 |
| 223 | Ga0451577_0000338 | 3300042876 | Bacteria | 87563 |
| 224 | Ga0439440_0007305 | 3300042993 | Bacteria | 2241 |
| 225 | Ga0466969_0001536 | 3300044656 | Bacteria | 12397 |
| 226 | Ga0466972_0000155 | 3300044658 | Bacteria | 55326 |
| 227 | Ga0466965_0011127 | 3300044683 | Bacteria | 4209 |
| 228 | Ga0466966_0029687 | 3300044684 | Bacteria | 3555 |
| 229 | Ga0466961_0000258 | 3300044693 | Bacteria | 35598 |
| 230 | Ga0466961_0001247 | 3300044693 | Bacteria | 15677 |
| 231 | Ga0466963_0003576 | 3300044694 | Bacteria | 8929 |
| 232 | Ga0466963_0006455 | 3300044694 | Bacteria | 6938 |
| 233 | Ga0453684_0000495 | 3300044712 | Bacteria | 155165 |
| 234 | Ga0466971_0000370 | 3300044719 | Bacteria | 17315 |
| 235 | Ga0466971_0003779 | 3300044719 | Bacteria | 6482 |
| 236 | Ga0466971_0006418 | 3300044719 | Bacteria | 5109 |
| 237 | Ga0466957_0001907 | 3300044842 | Bacteria | 11059 |
| 238 | Ga0466960_0136501 | 3300044901 | Bacteria | 1299 |
| 239 | Ga0466959_0007944 | 3300045049 | Bacteria | 7472 |
| 240 | Ga0466959_0055001 | 3300045049 | Bacteria | 2906 |
| 241 | Ga0451576_0040370 | 3300045051 | Bacteria | 4940 |
| 242 | Ga0466958_0019177 | 3300045836 | Bacteria | 3978 |
| 243 | Ga0466958_0030952 | 3300045836 | Bacteria | 3180 |
| 244 | Ga0466967_0065656 | 3300045976 | Bacteria | 3231 |
| 245 | Ga0495617_000844 | 3300046452 | Bacteria | 14558 |
| 246 | Ga0495617_013342 | 3300046452 | Bacteria | 2795 |
| 247 | Ga0495617_014612 | 3300046452 | Bacteria | 2668 |
| 248 | Ga0495627_021602 | 3300046453 | Bacteria | 2131 |
| 249 | Ga0495627_041334 | 3300046453 | Bacteria | 1416 |
| 250 | Ga0495603_0000337 | 3300046455 | Bacteria | 25136 |
| 251 | Ga0495590_0002611 | 3300046457 | Bacteria | 7445 |
| 252 | Ga0495590_0010841 | 3300046457 | Bacteria | 3415 |
| 253 | Ga0495590_0012332 | 3300046457 | Bacteria | 3172 |
| 254 | Ga0495590_0013264 | 3300046457 | Bacteria | 3035 |
| 255 | Ga0495591_000060 | 3300046458 | Bacteria | 129321 |
| 256 | Ga0495591_002550 | 3300046458 | Bacteria | 10037 |
| 257 | Ga0495591_003898 | 3300046458 | Bacteria | 7517 |
| 258 | Ga0495591_024792 | 3300046458 | Bacteria | 1893 |
| 259 | Ga0495629_0004842 | 3300046459 | Bacteria | 10096 |
| 260 | Ga0495638_0001873 | 3300046460 | Bacteria | 18187 |
| 261 | Ga0495638_0008997 | 3300046460 | Bacteria | 7038 |
| 262 | Ga0495638_0030308 | 3300046460 | Bacteria | 3483 |
| 263 | Ga0495638_0081295 | 3300046460 | Bacteria | 1967 |
| 264 | Ga0495638_0089763 | 3300046460 | Bacteria | 1853 |
| 265 | Ga0495653_0001219 | 3300046463 | Bacteria | 19940 |
| 266 | Ga0495653_0005957 | 3300046463 | Bacteria | 9978 |
| 267 | Ga0495650_0001020 | 3300046471 | Bacteria | 31519 |
| 268 | Ga0495650_0001892 | 3300046471 | Bacteria | 18567 |
| 269 | Ga0495650_0002415 | 3300046471 | Bacteria | 15199 |
| 270 | Ga0495650_0005703 | 3300046471 | Bacteria | 7975 |
| 271 | Ga0495650_0015658 | 3300046471 | Bacteria | 3879 |
| 272 | Ga0495650_0048809 | 3300046471 | Bacteria | 1761 |
| 273 | Ga0495580_0011295 | 3300046472 | Bacteria | 6911 |
| 274 | Ga0495580_0038337 | 3300046472 | Bacteria | 3432 |
| 275 | Ga0495582_0020479 | 3300046473 | Bacteria | 3621 |
| 276 | Ga0495605_0004771 | 3300046474 | Bacteria | 7924 |
| 277 | Ga0495605_0008597 | 3300046474 | Bacteria | 5767 |
| 278 | Ga0495605_0013146 | 3300046474 | Bacteria | 4573 |
| 279 | Ga0495605_0014977 | 3300046474 | Bacteria | 4228 |
| 280 | Ga0495605_0028302 | 3300046474 | Bacteria | 2894 |
| 281 | Ga0495605_0032970 | 3300046474 | Bacteria | 2633 |
| 282 | Ga0495605_0042677 | 3300046474 | Bacteria | 2252 |
| 283 | Ga0495605_0062347 | 3300046474 | Bacteria | 1782 |
| 284 | Ga0495639_0000016 | 3300046475 | Bacteria | 76516 |
| 285 | Ga0495584_0012049 | 3300046491 | Bacteria | 4421 |
| 286 | Ga0495584_0036174 | 3300046491 | Bacteria | 2494 |
| 287 | Ga0495584_0048028 | 3300046491 | Bacteria | 2152 |
| 288 | Ga0495584_0079245 | 3300046491 | Bacteria | 1652 |
| 289 | Ga0495585_0000219 | 3300046492 | Bacteria | 59369 |
| 290 | Ga0495585_0001028 | 3300046492 | Bacteria | 23187 |
| 291 | Ga0495585_0014678 | 3300046492 | Bacteria | 4557 |
| 292 | Ga0495594_0003073 | 3300046499 | Bacteria | 8649 |
| 293 | Ga0495594_0043472 | 3300046499 | Bacteria | 2463 |
| 294 | Ga0495596_0000083 | 3300046500 | Bacteria | 65056 |
| 295 | Ga0495607_0002053 | 3300046501 | Bacteria | 16840 |
| 296 | Ga0495607_0008431 | 3300046501 | Bacteria | 7046 |
| 297 | Ga0495607_0009300 | 3300046501 | Bacteria | 6661 |
| 298 | Ga0495607_0017208 | 3300046501 | Bacteria | 4648 |
| 299 | Ga0495583_0000467 | 3300046506 | Bacteria | 59823 |
| 300 | Ga0495583_0004739 | 3300046506 | Bacteria | 9563 |
| 301 | Ga0495583_0064372 | 3300046506 | Bacteria | 1627 |
| 302 | Ga0495606_0001204 | 3300046507 | Bacteria | 36360 |
| 303 | Ga0495606_0004583 | 3300046507 | Bacteria | 13710 |
| 304 | Ga0495606_0009895 | 3300046507 | Bacteria | 7987 |
| 305 | Ga0495606_0012725 | 3300046507 | Bacteria | 6709 |
| 306 | Ga0495610_0000842 | 3300046512 | Bacteria | 28591 |
| 307 | Ga0495610_0008011 | 3300046512 | Bacteria | 6921 |
| 308 | Ga0495610_0011287 | 3300046512 | Bacteria | 5473 |
| 309 | Ga0495616_0001642 | 3300046513 | Bacteria | 15338 |
| 310 | Ga0495616_0027767 | 3300046513 | Bacteria | 3001 |
| 311 | Ga0495620_0006725 | 3300046515 | Bacteria | 6292 |
| 312 | Ga0495620_0013828 | 3300046515 | Bacteria | 4121 |
| 313 | Ga0495628_0011614 | 3300046516 | Bacteria | 7447 |
| 314 | Ga0495628_0099929 | 3300046516 | Bacteria | 2240 |
| 315 | Ga0495630_0004302 | 3300046517 | Bacteria | 9988 |
| 316 | Ga0495630_0076627 | 3300046517 | Bacteria | 2520 |
| 317 | Ga0495630_0099332 | 3300046517 | Bacteria | 2202 |
| 318 | Ga0495631_0000014 | 3300046518 | Bacteria | 109076 |
| 319 | Ga0495631_0003553 | 3300046518 | Bacteria | 8524 |
| 320 | Ga0495632_0000022 | 3300046519 | Bacteria | 187045 |
| 321 | Ga0495632_0000301 | 3300046519 | Bacteria | 47824 |
| 322 | Ga0495632_0002786 | 3300046519 | Bacteria | 12963 |
| 323 | Ga0495632_0003547 | 3300046519 | Bacteria | 11031 |
| 324 | Ga0495632_0003659 | 3300046519 | Bacteria | 10784 |
| 325 | Ga0495632_0084462 | 3300046519 | Bacteria | 1510 |
| 326 | Ga0495632_0101206 | 3300046519 | Bacteria | 1358 |
| 327 | Ga0495637_0000294 | 3300046520 | Bacteria | 38681 |
| 328 | Ga0495637_0000463 | 3300046520 | Bacteria | 29650 |
| 329 | Ga0495637_0007661 | 3300046520 | Bacteria | 5341 |
| 330 | Ga0495637_0016435 | 3300046520 | Bacteria | 3458 |
| 331 | Ga0495637_0039923 | 3300046520 | Bacteria | 2022 |
| 332 | Ga0495643_0040579 | 3300046522 | Bacteria | 2541 |
| 333 | Ga0495644_0000064 | 3300046523 | Bacteria | 51920 |
| 334 | Ga0495644_0023999 | 3300046523 | Bacteria | 2320 |
| 335 | Ga0495648_0011057 | 3300046524 | Bacteria | 6836 |
| 336 | Ga0495648_0030605 | 3300046524 | Bacteria | 3556 |
| 337 | Ga0495648_0039834 | 3300046524 | Bacteria | 2985 |
| 338 | Ga0495648_0085733 | 3300046524 | Bacteria | 1778 |
| 339 | Ga0495648_0094701 | 3300046524 | Bacteria | 1663 |
| 340 | Ga0495666_0001376 | 3300046526 | Bacteria | 11787 |
| 341 | Ga0495666_0087557 | 3300046526 | Bacteria | 1471 |
| 342 | Ga0495666_0096078 | 3300046526 | Bacteria | 1397 |
| 343 | Ga0495642_0000011 | 3300046528 | Bacteria | 128280 |
| 344 | Ga0495652_0029190 | 3300046529 | Bacteria | 4846 |
| 345 | Ga0495654_0000263 | 3300046530 | Bacteria | 47747 |
| 346 | Ga0495654_0002386 | 3300046530 | Bacteria | 12115 |
| 347 | Ga0495654_0020473 | 3300046530 | Bacteria | 3446 |
| 348 | Ga0495654_0026601 | 3300046530 | Bacteria | 2972 |
| 349 | Ga0495654_0061955 | 3300046530 | Bacteria | 1794 |
| 350 | Ga0495654_0069034 | 3300046530 | Bacteria | 1678 |
| 351 | Ga0495654_0070932 | 3300046530 | Bacteria | 1651 |
| 352 | Ga0495665_0045648 | 3300046531 | Bacteria | 2327 |
| 353 | Ga0495587_0001361 | 3300046536 | Bacteria | 16211 |
| 354 | Ga0495609_0000212 | 3300046538 | Bacteria | 57886 |
| 355 | Ga0495609_0087983 | 3300046538 | Bacteria | 1353 |
| 356 | Ga0495597_0001850 | 3300046542 | Bacteria | 14480 |
| 357 | Ga0495597_0003934 | 3300046542 | Bacteria | 8372 |
| 358 | Ga0495597_0024251 | 3300046542 | Bacteria | 2801 |
| 359 | Ga0495597_0045891 | 3300046542 | Bacteria | 1937 |
| 360 | Ga0495622_0000070 | 3300046557 | Bacteria | 89579 |
| 361 | Ga0495622_0000350 | 3300046557 | Bacteria | 32833 |
| 362 | Ga0495633_0002077 | 3300046558 | Bacteria | 14408 |
| 363 | Ga0495668_0000635 | 3300046616 | Bacteria | 42189 |
| 364 | Ga0495634_0000290 | 3300046642 | Bacteria | 48107 |
| 365 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 366 | Ga0495625_0002425 | 3300046660 | Bacteria | 20189 |
| 367 | Ga0495625_0002680 | 3300046660 | Bacteria | 18942 |
| 368 | Ga0495625_0026831 | 3300046660 | Bacteria | 4344 |
| 369 | Ga0495635_0000107 | 3300046663 | Bacteria | 49233 |
| 370 | Ga0495659_0000056 | 3300046664 | Bacteria | 49485 |
| 371 | Ga0495659_0005571 | 3300046664 | Bacteria | 3961 |
| 372 | Ga0495661_0016734 | 3300046665 | Bacteria | 4852 |
| 373 | Ga0495661_0023211 | 3300046665 | Bacteria | 4027 |
| 374 | Ga0495657_0125585 | 3300046675 | Bacteria | 1612 |
| 375 | Ga0495623_0019562 | 3300046679 | Bacteria | 4375 |
| 376 | Ga0495623_0058750 | 3300046679 | Bacteria | 2417 |
| 377 | Ga0495646_0000723 | 3300046680 | Bacteria | 18297 |
| 378 | Ga0495646_0007377 | 3300046680 | Bacteria | 6988 |
| 379 | Ga0495669_0000591 | 3300046684 | Bacteria | 15918 |
| 380 | Ga0495624_0008865 | 3300046690 | Bacteria | 6991 |
| 381 | Ga0495624_0020250 | 3300046690 | Bacteria | 4430 |
| 382 | Ga0495671_0000496 | 3300046692 | Bacteria | 30365 |
| 383 | Ga0495671_0035644 | 3300046692 | Bacteria | 2525 |
| 384 | Ga0495671_0050039 | 3300046692 | Bacteria | 2082 |
| 385 | Ga0495671_0057728 | 3300046692 | Bacteria | 1920 |
| 386 | Ga0495671_0062279 | 3300046692 | Bacteria | 1838 |
| 387 | Ga0495649_0000485 | 3300046694 | Bacteria | 34144 |
| 388 | Ga0495649_0001028 | 3300046694 | Bacteria | 21892 |
| 389 | Ga0495649_0029045 | 3300046694 | Bacteria | 3063 |
| 390 | Ga0495649_0069201 | 3300046694 | Bacteria | 1893 |
| 391 | Ga0495649_0070452 | 3300046694 | Bacteria | 1874 |
| 392 | Ga0495649_0081851 | 3300046694 | Bacteria | 1726 |
| 393 | Ga0495589_0000823 | 3300046794 | Bacteria | 19568 |
| 394 | Ga0495589_0018397 | 3300046794 | Bacteria | 3582 |
| 395 | Ga0495589_0018643 | 3300046794 | Bacteria | 3558 |
| 396 | Ga0495589_0026254 | 3300046794 | Bacteria | 2952 |
| 397 | Ga0495589_0076824 | 3300046794 | Bacteria | 1627 |
| 398 | Ga0495660_0031644 | 3300046810 | Bacteria | 2974 |
| 399 | Ga0495660_0044438 | 3300046810 | Bacteria | 2443 |
| 400 | Ga0495660_0046093 | 3300046810 | Bacteria | 2391 |
| 401 | Ga0495660_0099126 | 3300046810 | Bacteria | 1502 |
| 402 | Ga0495581_0002889 | 3300047315 | Bacteria | 9825 |
| 403 | Ga0495604_0009287 | 3300047317 | Bacteria | 7785 |
| 404 | Ga0495604_0027529 | 3300047317 | Bacteria | 4520 |
| 405 | Ga0495636_0024195 | 3300047318 | Bacteria | 2461 |
| 406 | Ga0495674_0000507 | 3300047319 | Bacteria | 35691 |
| 407 | Ga0495674_0002074 | 3300047319 | Bacteria | 19661 |
| 408 | Ga0495674_0006124 | 3300047319 | Bacteria | 11551 |
| 409 | Ga0495674_0010629 | 3300047319 | Bacteria | 8707 |
| 410 | Ga0495672_0000698 | 3300047320 | Bacteria | 37164 |
| 411 | Ga0495672_0030539 | 3300047320 | Bacteria | 3378 |
| 412 | Ga0495672_0037598 | 3300047320 | Bacteria | 2960 |
| 413 | Ga0495672_0041484 | 3300047320 | Bacteria | 2782 |
| 414 | Ga0495672_0050550 | 3300047320 | Bacteria | 2452 |
| 415 | Ga0495672_0118664 | 3300047320 | Bacteria | 1409 |
| 416 | Ga0495676_0157246 | 3300047321 | Bacteria | 1611 |
| 417 | Ga0495683_0000057 | 3300047323 | Bacteria | 118509 |
| 418 | Ga0495683_0002986 | 3300047323 | Bacteria | 9981 |
| 419 | Ga0495683_0009936 | 3300047323 | Bacteria | 5053 |
| 420 | Ga0495683_0015284 | 3300047323 | Bacteria | 3996 |
| 421 | Ga0495683_0026580 | 3300047323 | Bacteria | 2961 |
| 422 | Ga0495683_0074784 | 3300047323 | Bacteria | 1659 |
| 423 | Ga0495687_003368 | 3300047443 | Bacteria | 11664 |
| 424 | Ga0495687_003616 | 3300047443 | Bacteria | 11044 |
| 425 | Ga0495687_007084 | 3300047443 | Bacteria | 6695 |
| 426 | Ga0495679_000054 | 3300047446 | Bacteria | 114312 |
| 427 | Ga0495679_001048 | 3300047446 | Bacteria | 16854 |
| 428 | Ga0495679_027634 | 3300047446 | Bacteria | 1868 |
| 429 | Ga0495673_0000234 | 3300047469 | Bacteria | 80453 |
| 430 | Ga0495673_0000717 | 3300047469 | Bacteria | 32108 |
| 431 | Ga0495673_0000829 | 3300047469 | Bacteria | 28864 |
| 432 | Ga0495673_0000891 | 3300047469 | Bacteria | 27479 |
| 433 | Ga0495673_0004176 | 3300047469 | Bacteria | 9125 |
| 434 | Ga0495673_0007511 | 3300047469 | Bacteria | 6253 |
| 435 | Ga0495673_0043354 | 3300047469 | Bacteria | 2014 |
| 436 | Ga0495673_0045372 | 3300047469 | Bacteria | 1954 |
| 437 | Ga0495681_0000372 | 3300047470 | Bacteria | 35092 |
| 438 | Ga0495681_0000533 | 3300047470 | Bacteria | 29141 |
| 439 | Ga0495681_0003850 | 3300047470 | Bacteria | 10376 |
| 440 | Ga0495681_0018258 | 3300047470 | Bacteria | 3867 |
| 441 | Ga0495681_0049707 | 3300047470 | Bacteria | 1980 |
| 442 | Ga0495684_0169533 | 3300047471 | Bacteria | 1624 |
| 443 | Ga0495686_0002045 | 3300047472 | Bacteria | 19859 |
| 444 | Ga0495686_0011147 | 3300047472 | Bacteria | 6344 |
| 445 | Ga0495593_0003972 | 3300047673 | Bacteria | 8825 |
| 446 | Ga0495593_0027760 | 3300047673 | Bacteria | 3113 |
| 447 | Ga0495593_0028898 | 3300047673 | Bacteria | 3044 |
| 448 | Ga0495593_0065136 | 3300047673 | Bacteria | 1900 |
| 449 | Ga0495614_0017913 | 3300048089 | Bacteria | 3071 |
| 450 | Ga0495626_0000066 | 3300048091 | Bacteria | 141280 |
| 451 | Ga0495626_0000077 | 3300048091 | Bacteria | 130910 |
| 452 | Ga0495626_0000268 | 3300048091 | Bacteria | 58845 |
| 453 | Ga0495626_0000513 | 3300048091 | Bacteria | 38809 |
| 454 | Ga0495626_0016477 | 3300048091 | Bacteria | 3752 |
| 455 | Ga0495626_0032165 | 3300048091 | Bacteria | 2520 |
| 456 | Ga0495626_0041723 | 3300048091 | Bacteria | 2158 |
| 457 | Ga0495626_0082129 | 3300048091 | Bacteria | 1430 |
| 458 | Ga0496100_0049028 | 3300048903 | Bacteria | 2728 |
| 459 | Ga0496102_0000394 | 3300048905 | Bacteria | 50983 |
| 460 | Ga0496102_0285136 | 3300048905 | Bacteria | 1557 |
| 461 | Ga0496103_0000807 | 3300048906 | Bacteria | 23036 |
| 462 | Ga0496104_0008299 | 3300048907 | Bacteria | 9225 |
| 463 | Ga0496104_0225084 | 3300048907 | Bacteria | 1788 |
| 464 | Ga0496106_0044530 | 3300048909 | Bacteria | 3331 |
| 465 | Ga0496107_0207349 | 3300048910 | Bacteria | 1457 |
| 466 | Ga0496111_0313577 | 3300048914 | Bacteria | 1162 |
| 467 | Ga0496111_0429002 | 3300048914 | Bacteria | 976 |
| 468 | Ga0496112_0003653 | 3300048915 | Bacteria | 12819 |
| 469 | Ga0496112_0340965 | 3300048915 | Bacteria | 1442 |
| 470 | Ga0496113_0023278 | 3300048916 | Bacteria | 4392 |
| 471 | Ga0496115_0018838 | 3300048918 | Bacteria | 5307 |
| 472 | Ga0496116_0000744 | 3300048919 | Bacteria | 41592 |
| 473 | Ga0496116_0004404 | 3300048919 | Bacteria | 13464 |
| 474 | Ga0496116_0017890 | 3300048919 | Bacteria | 5483 |
| 475 | Ga0496117_0001810 | 3300048920 | Bacteria | 29047 |
| 476 | Ga0496117_0023279 | 3300048920 | Bacteria | 4942 |
| 477 | Ga0496118_0006225 | 3300048921 | Bacteria | 13200 |
| 478 | Ga0496118_0010514 | 3300048921 | Bacteria | 9157 |
| 479 | Ga0496118_0011091 | 3300048921 | Bacteria | 8845 |
| 480 | Ga0496118_0066121 | 3300048921 | Bacteria | 2640 |
| 481 | Ga0496118_0083905 | 3300048921 | Bacteria | 2225 |
| 482 | Ga0496119_0065628 | 3300048922 | Bacteria | 2149 |
| 483 | Ga0496121_0004629 | 3300048924 | Bacteria | 18298 |
| 484 | Ga0496121_0013075 | 3300048924 | Bacteria | 8960 |
| 485 | Ga0496121_0034186 | 3300048924 | Bacteria | 4580 |
| 486 | Ga0496121_0034234 | 3300048924 | Bacteria | 4575 |
| 487 | Ga0496122_0001075 | 3300048925 | Bacteria | 47418 |
| 488 | Ga0496122_0005294 | 3300048925 | Bacteria | 15441 |
| 489 | Ga0496122_0010920 | 3300048925 | Bacteria | 9286 |
| 490 | Ga0496123_0000064 | 3300048926 | Bacteria | 212668 |
| 491 | Ga0496123_0008678 | 3300048926 | Bacteria | 9286 |
| 492 | Ga0496123_0010347 | 3300048926 | Bacteria | 8261 |
| 493 | Ga0496124_0003588 | 3300048927 | Bacteria | 18860 |
| 494 | Ga0496124_0125040 | 3300048927 | Bacteria | 2050 |
| 495 | Ga0496125_0010383 | 3300048928 | Bacteria | 9419 |
| 496 | Ga0496125_0022611 | 3300048928 | Bacteria | 5833 |
| 497 | Ga0496125_0045688 | 3300048928 | Bacteria | 3682 |
| 498 | Ga0496125_0227651 | 3300048928 | Bacteria | 1195 |
| 499 | Ga0496126_0007462 | 3300048929 | Bacteria | 11983 |
| 500 | Ga0496126_0013013 | 3300048929 | Bacteria | 8490 |
| 501 | Ga0495678_001920 | 3300049459 | Bacteria | 15087 |
| 502 | Ga0495678_015692 | 3300049459 | Bacteria | 3479 |
| 503 | Ga0495682_0003682 | 3300049460 | Bacteria | 6758 |
| 504 | Ga0495682_0020493 | 3300049460 | Bacteria | 2482 |
| 505 | Ga0501262_015482 | 3300049759 | Bacteria | 1002 |
| 506 | nmdc:mga05p37_162197_c1 | 3300050507 | Bacteria | 2730 |
| 507 | nmdc:mga05p37_200273_c1 | 3300050507 | Bacteria | 2419 |
| 508 | nmdc:mga09592_7020_c1 | 3300050508 | Bacteria | 9155 |
| 509 | nmdc:mga09592_75657_c1 | 3300050508 | Bacteria | 2863 |
| 510 | nmdc:mga0qj67_323992_c1 | 3300050509 | Bacteria | 1247 |
| 511 | nmdc:mga0qj67_38864_c1 | 3300050509 | Bacteria | 3735 |
| 512 | nmdc:mga06r32_1782_c1 | 3300050510 | Bacteria | 19334 |
| 513 | nmdc:mga06r32_877_c1 | 3300050510 | Bacteria | 26778 |
| 514 | nmdc:mga08y16_1183_c1 | 3300050511 | Bacteria | 25760 |
| 515 | nmdc:mga08y16_151154_c1 | 3300050511 | Bacteria | 2413 |
| 516 | nmdc:mga08y16_39024_c1 | 3300050511 | Bacteria | 4984 |
| 517 | nmdc:mga08y16_627801_c1 | 3300050511 | Bacteria | 1081 |
| 518 | Ga0500658_0000012 | 3300053134 | Bacteria | 160010 |
| 519 | Ga0466962_0003294 | 3300061719 | Bacteria | 7674 |
| 520 | Ga0466962_0020824 | 3300061719 | Bacteria | 3151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_627801_c1 | nmdc:mga08y16_627801_c1_52_825 | 257 |
| 2 | 3300032004 | Ga0307414_10487093 | Ga0307414_104870932 | 284 |
| 3 | 3300046524 | Ga0495648_0039834 | Ga0495648_0039834_2086_2970 | 294 |
| 4 | 3300046530 | Ga0495654_0069034 | Ga0495654_0069034_779_1663 | 294 |
| 5 | 3300047470 | Ga0495681_0018258 | Ga0495681_0018258_2968_3852 | 294 |
| 6 | 3300006844 | Ga0075428_100034198 | Ga0075428_1000341987 | 295 |
| 7 | 3300009147 | Ga0114129_10367788 | Ga0114129_103677881 | 295 |
| 8 | 3300050509 | nmdc:mga0qj67_38864_c1 | nmdc:mga0qj67_38864_c1_1149_2036 | 295 |
| 9 | 3300050510 | nmdc:mga06r32_1782_c1 | nmdc:mga06r32_1782_c1_1197_2084 | 295 |
| 10 | 3300006880 | Ga0075429_100017681 | Ga0075429_1000176817 | 296 |
| 11 | 3300031901 | Ga0307406_10106614 | Ga0307406_101066142 | 296 |
| 12 | 3300032002 | Ga0307416_100015666 | Ga0307416_1000156665 | 296 |
| 13 | 3300050507 | nmdc:mga05p37_162197_c1 | nmdc:mga05p37_162197_c1_484_1374 | 296 |
| 14 | 3300050508 | nmdc:mga09592_7020_c1 | nmdc:mga09592_7020_c1_1357_2247 | 296 |
| 15 | 3300005290 | Ga0065712_10075821 | Ga0065712_100758216 | 298 |
| 16 | 3300005293 | Ga0065715_10096779 | Ga0065715_100967794 | 298 |
| 17 | 3300005328 | Ga0070676_10008160 | Ga0070676_100081603 | 298 |
| 18 | 3300005329 | Ga0070683_100092802 | Ga0070683_1000928025 | 298 |
| 19 | 3300005330 | Ga0070690_100007404 | Ga0070690_1000074044 | 298 |
| 20 | 3300005331 | Ga0070670_100011258 | Ga0070670_1000112589 | 298 |
| 21 | 3300005334 | Ga0068869_100005075 | Ga0068869_1000050758 | 298 |
| 22 | 3300005337 | Ga0070682_100087022 | Ga0070682_1000870223 | 298 |
| 23 | 3300005338 | Ga0068868_100047158 | Ga0068868_1000471583 | 298 |
| 24 | 3300005340 | Ga0070689_100001773 | Ga0070689_10000177314 | 298 |
| 25 | 3300005343 | Ga0070687_100001091 | Ga0070687_1000010918 | 298 |
| 26 | 3300005344 | Ga0070661_100004510 | Ga0070661_1000045106 | 298 |
| 27 | 3300005345 | Ga0070692_10021763 | Ga0070692_100217633 | 298 |
| 28 | 3300005353 | Ga0070669_100032108 | Ga0070669_1000321083 | 298 |
| 29 | 3300005354 | Ga0070675_100020801 | Ga0070675_1000208011 | 298 |
| 30 | 3300005364 | Ga0070673_100000964 | Ga0070673_1000009646 | 298 |
| 31 | 3300005365 | Ga0070688_100015862 | Ga0070688_1000158625 | 298 |
| 32 | 3300005438 | Ga0070701_10064522 | Ga0070701_100645222 | 298 |
| 33 | 3300005440 | Ga0070705_100022729 | Ga0070705_1000227294 | 298 |
| 34 | 3300005441 | Ga0070700_100072775 | Ga0070700_1000727752 | 298 |
| 35 | 3300005444 | Ga0070694_100022460 | Ga0070694_1000224605 | 298 |
| 36 | 3300005457 | Ga0070662_100031143 | Ga0070662_1000311433 | 298 |
| 37 | 3300005457 | Ga0070662_100074061 | Ga0070662_1000740612 | 298 |
| 38 | 3300005459 | Ga0068867_100007456 | Ga0068867_1000074569 | 298 |
| 39 | 3300005466 | Ga0070685_10018645 | Ga0070685_100186456 | 298 |
| 40 | 3300005535 | Ga0070684_100005098 | Ga0070684_1000050985 | 298 |
| 41 | 3300005544 | Ga0070686_100003171 | Ga0070686_10000317110 | 298 |
| 42 | 3300005548 | Ga0070665_100231753 | Ga0070665_1002317532 | 298 |
| 43 | 3300005564 | Ga0070664_100003939 | Ga0070664_1000039398 | 298 |
| 44 | 3300005617 | Ga0068859_100002841 | Ga0068859_10000284110 | 298 |
| 45 | 3300005618 | Ga0068864_100013233 | Ga0068864_1000132334 | 298 |
| 46 | 3300005719 | Ga0068861_100001395 | Ga0068861_10000139514 | 298 |
| 47 | 3300005719 | Ga0068861_100007235 | Ga0068861_1000072355 | 298 |
| 48 | 3300005841 | Ga0068863_100004099 | Ga0068863_1000040999 | 298 |
| 49 | 3300005843 | Ga0068860_100081077 | Ga0068860_1000810773 | 298 |
| 50 | 3300005844 | Ga0068862_100002154 | Ga0068862_1000021544 | 298 |
| 51 | 3300006358 | Ga0068871_100060188 | Ga0068871_1000601884 | 298 |
| 52 | 3300006844 | Ga0075428_100082352 | Ga0075428_1000823523 | 298 |
| 53 | 3300006931 | Ga0097620_100002841 | Ga0097620_10000284114 | 298 |
| 54 | 3300009092 | Ga0105250_10099049 | Ga0105250_100990492 | 298 |
| 55 | 3300009174 | Ga0105241_10401529 | Ga0105241_104015292 | 298 |
| 56 | 3300009177 | Ga0105248_10016878 | Ga0105248_1001687810 | 298 |
| 57 | 3300009553 | Ga0105249_10037754 | Ga0105249_100377544 | 298 |
| 58 | 3300011119 | Ga0105246_10026618 | Ga0105246_100266186 | 298 |
| 59 | 3300013306 | Ga0163162_10009747 | Ga0163162_1000974711 | 298 |
| 60 | 3300013308 | Ga0157375_10016404 | Ga0157375_100164043 | 298 |
| 61 | 3300014325 | Ga0163163_10011164 | Ga0163163_100111645 | 298 |
| 62 | 3300014745 | Ga0157377_10004934 | Ga0157377_100049348 | 298 |
| 63 | 3300014969 | Ga0157376_10091077 | Ga0157376_100910773 | 298 |
| 64 | 3300025901 | Ga0207688_10186432 | Ga0207688_101864321 | 298 |
| 65 | 3300025907 | Ga0207645_10015033 | Ga0207645_100150332 | 298 |
| 66 | 3300025908 | Ga0207643_10119786 | Ga0207643_101197862 | 298 |
| 67 | 3300025918 | Ga0207662_10004095 | Ga0207662_100040956 | 298 |
| 68 | 3300025919 | Ga0207657_10345090 | Ga0207657_103450902 | 298 |
| 69 | 3300025920 | Ga0207649_10001844 | Ga0207649_1000184412 | 298 |
| 70 | 3300025923 | Ga0207681_10022636 | Ga0207681_100226363 | 298 |
| 71 | 3300025925 | Ga0207650_10012826 | Ga0207650_100128265 | 298 |
| 72 | 3300025926 | Ga0207659_10045263 | Ga0207659_100452631 | 298 |
| 73 | 3300025933 | Ga0207706_10021203 | Ga0207706_100212035 | 298 |
| 74 | 3300025936 | Ga0207670_10007311 | Ga0207670_100073118 | 298 |
| 75 | 3300025938 | Ga0207704_10185245 | Ga0207704_101852452 | 298 |
| 76 | 3300025940 | Ga0207691_10013069 | Ga0207691_100130695 | 298 |
| 77 | 3300025942 | Ga0207689_10001689 | Ga0207689_1000168910 | 298 |
| 78 | 3300025944 | Ga0207661_10360974 | Ga0207661_103609742 | 298 |
| 79 | 3300025945 | Ga0207679_10028989 | Ga0207679_100289894 | 298 |
| 80 | 3300025972 | Ga0207668_10008961 | Ga0207668_100089617 | 298 |
| 81 | 3300026023 | Ga0207677_10036586 | Ga0207677_100365864 | 298 |
| 82 | 3300026035 | Ga0207703_10049319 | Ga0207703_100493194 | 298 |
| 83 | 3300026067 | Ga0207678_10502322 | Ga0207678_105023222 | 298 |
| 84 | 3300026075 | Ga0207708_10092538 | Ga0207708_100925382 | 298 |
| 85 | 3300026088 | Ga0207641_10024452 | Ga0207641_100244524 | 298 |
| 86 | 3300026089 | Ga0207648_10026094 | Ga0207648_100260942 | 298 |
| 87 | 3300026095 | Ga0207676_10013416 | Ga0207676_100134166 | 298 |
| 88 | 3300026118 | Ga0207675_100008825 | Ga0207675_1000088258 | 298 |
| 89 | 3300026118 | Ga0207675_100010477 | Ga0207675_10001047710 | 298 |
| 90 | 3300028379 | Ga0268266_10467697 | Ga0268266_104676971 | 298 |
| 91 | 3300028380 | Ga0268265_10004923 | Ga0268265_100049238 | 298 |
| 92 | 3300028380 | Ga0268265_10007323 | Ga0268265_100073239 | 298 |
| 93 | 3300031548 | Ga0307408_100157814 | Ga0307408_1001578142 | 298 |
| 94 | 3300035691 | Ga0373931_0036871 | Ga0373931_0036871_1411_2307 | 298 |
| 95 | 3300045051 | Ga0451576_0040370 | Ga0451576_0040370_28_924 | 298 |
| 96 | 3300048907 | Ga0496104_0225084 | Ga0496104_0225084_645_1541 | 298 |
| 97 | 3300048909 | Ga0496106_0044530 | Ga0496106_0044530_1357_2253 | 298 |
| 98 | 3300048914 | Ga0496111_0313577 | Ga0496111_0313577_177_1073 | 298 |
| 99 | 3300048915 | Ga0496112_0340965 | Ga0496112_0340965_487_1383 | 298 |
| 100 | 3300049759 | Ga0501262_015482 | Ga0501262_015482_90_986 | 298 |
| 101 | 3300009094 | Ga0111539_10019623 | Ga0111539_100196235 | 299 |
| 102 | 3300027907 | Ga0207428_10025777 | Ga0207428_100257775 | 299 |
| 103 | 3300050511 | nmdc:mga08y16_39024_c1 | nmdc:mga08y16_39024_c1_450_1349 | 299 |
| 104 | 3300005615 | Ga0070702_100244755 | Ga0070702_1002447551 | 300 |
| 105 | 3300009094 | Ga0111539_10092884 | Ga0111539_100928844 | 300 |
| 106 | 3300009094 | Ga0111539_10147229 | Ga0111539_101472294 | 300 |
| 107 | 3300025225 | Ga0209566_101181 | Ga0209566_1011817 | 300 |
| 108 | 3300025229 | Ga0209147_100239 | Ga0209147_10023944 | 300 |
| 109 | 3300025937 | Ga0207669_10068150 | Ga0207669_100681502 | 300 |
| 110 | 3300028380 | Ga0268265_10353293 | Ga0268265_103532931 | 300 |
| 111 | 3300031251 | Ga0265327_10025325 | Ga0265327_100253254 | 300 |
| 112 | 3300050509 | nmdc:mga0qj67_323992_c1 | nmdc:mga0qj67_323992_c1_14_916 | 300 |
| 113 | 3300050511 | nmdc:mga08y16_151154_c1 | nmdc:mga08y16_151154_c1_436_1338 | 300 |
| 114 | 3300032126 | Ga0307415_100042319 | Ga0307415_1000423193 | 301 |
| 115 | 3300042130 | Ga0450892_005616 | Ga0450892_005616_81_989 | 302 |
| 116 | iso_pu_bacteria | 2511231018 | 2511338831 | 302 |
| 117 | iso_pu_bacteria | 2511231019 | 2511342180 | 302 |
| 118 | 3300006847 | Ga0075431_100000002 | Ga0075431_10000000278 | 303 |
| 119 | 3300006880 | Ga0075429_100052780 | Ga0075429_1000527806 | 303 |
| 120 | 3300009094 | Ga0111539_10001191 | Ga0111539_1000119111 | 303 |
| 121 | 3300009147 | Ga0114129_10061189 | Ga0114129_100611896 | 303 |
| 122 | 3300027907 | Ga0207428_10026239 | Ga0207428_100262392 | 303 |
| 123 | 3300050507 | nmdc:mga05p37_200273_c1 | nmdc:mga05p37_200273_c1_261_1172 | 303 |
| 124 | 3300050508 | nmdc:mga09592_75657_c1 | nmdc:mga09592_75657_c1_1762_2673 | 303 |
| 125 | 3300050510 | nmdc:mga06r32_877_c1 | nmdc:mga06r32_877_c1_22384_23295 | 303 |
| 126 | 3300050511 | nmdc:mga08y16_1183_c1 | nmdc:mga08y16_1183_c1_1832_2743 | 303 |
| 127 | iso_pu_bacteria | 2501025501 | 2501073572 | 303 |
| 128 | iso_pu_bacteria | 2501025502 | 2501077004 | 303 |
| 129 | iso_pu_bacteria | 2501025504 | 2501407077 | 303 |
| 130 | iso_pu_bacteria | 2510917013 | 2511092691 | 303 |
| 131 | iso_pu_bacteria | 2510917014 | 2511097971 | 303 |
| 132 | iso_pu_bacteria | 2510917015 | 2511108157 | 303 |
| 133 | iso_pu_bacteria | 2511231007 | 2511271663 | 303 |
| 134 | iso_pu_bacteria | 2511231021 | 2511357590 | 303 |
| 135 | iso_pu_bacteria | 2515154122 | 2515681481 | 303 |
| 136 | iso_pu_bacteria | 2515154189 | 2516019788 | 303 |
| 137 | iso_pu_bacteria | 2519103095 | 2519457844 | 303 |
| 138 | iso_pu_bacteria | 2562617112 | 2563063775 | 303 |
| 139 | iso_pu_bacteria | 2582581311 | 2585295150 | 303 |
| 140 | iso_pu_bacteria | 2599185239 | 2599736980 | 303 |
| 141 | iso_pu_bacteria | 2599185292 | 2599903052 | 303 |
| 142 | iso_pu_bacteria | 2600255067 | 2600813410 | 303 |
| 143 | iso_pu_bacteria | 2623620446 | 2624492477 | 303 |
| 144 | iso_pu_bacteria | 2643221565 | 2643844548 | 303 |
| 145 | iso_pu_bacteria | 2643221609 | 2644059919 | 303 |
| 146 | iso_pu_bacteria | 2643221611 | 2644074463 | 303 |
| 147 | iso_pu_bacteria | 2687453129 | 2687578133 | 303 |
| 148 | iso_pu_bacteria | 2711768613 | 2713474665 | 303 |
| 149 | iso_pu_bacteria | 2738543012 | 2739241441 | 303 |
| 150 | iso_pu_bacteria | 2773857670 | 2774120415 | 303 |
| 151 | iso_pu_bacteria | 2784132072 | 2784312888 | 303 |
| 152 | iso_pu_bacteria | 2808606382 | 2808956134 | 303 |
| 153 | iso_pu_bacteria | 2808606384 | 2808971421 | 303 |
| 154 | iso_pu_bacteria | 2808606390 | 2809006195 | 303 |
| 155 | iso_pu_bacteria | 2808606391 | 2809013388 | 303 |
| 156 | iso_pu_bacteria | 2811994881 | 2812366396 | 303 |
| 157 | iso_pu_bacteria | 2816332133 | 2816473605 | 303 |
| 158 | iso_pu_bacteria | 2816332253 | 2817260028 | 303 |
| 159 | iso_pu_bacteria | 2816332256 | 2817277691 | 303 |
| 160 | iso_pu_bacteria | 2816332286 | 2817456896 | 303 |
| 161 | iso_pu_bacteria | 2818991452 | 2819632482 | 303 |
| 162 | iso_pu_bacteria | 2854601825 | 2854602318 | 303 |
| 163 | iso_pu_bacteria | 2856287931 | 2856289846 | 303 |
| 164 | iso_pu_bacteria | 2857357740 | 2857363114 | 303 |
| 165 | iso_pu_bacteria | 2858950400 | 2858950735 | 303 |
| 166 | iso_pu_bacteria | 2860339153 | 2860344755 | 303 |
| 167 | iso_pu_bacteria | 2863421361 | 2863421520 | 303 |
| 168 | iso_pu_bacteria | 2883087390 | 2883091995 | 303 |
| 169 | iso_pu_bacteria | 2904504865 | 2904507276 | 303 |
| 170 | iso_pu_bacteria | 2904564687 | 2904565698 | 303 |
| 171 | iso_pu_bacteria | 2904571731 | 2904572741 | 303 |
| 172 | iso_pu_bacteria | 2919125081 | 2919127731 | 303 |
| 173 | iso_pu_bacteria | 2919697872 | 2919698644 | 303 |
| 174 | iso_pu_bacteria | 2923519811 | 2923520420 | 303 |
| 175 | iso_pu_bacteria | 2928157003 | 2928159901 | 303 |
| 176 | iso_pu_bacteria | 2928163908 | 2928164058 | 303 |
| 177 | iso_pu_bacteria | 2928170801 | 2928173411 | 303 |
| 178 | iso_pu_bacteria | 2928536128 | 2928538736 | 303 |
| 179 | iso_pu_bacteria | 2931396565 | 2931402273 | 303 |
| 180 | iso_pu_bacteria | 2939651529 | 2939653731 | 303 |
| 181 | iso_pu_bacteria | 2981990288 | 2981994339 | 303 |
| 182 | iso_pu_bacteria | 641736154 | 642416620 | 303 |
| 183 | iso_pu_bacteria | 8002745576 | 8002748769 | 303 |
| 184 | iso_pu_bacteria | 8018845410 | 8018850742 | 303 |
| 185 | iso_pu_bacteria | 8019775933 | 8019778888 | 303 |
| 186 | iso_pu_bacteria | 8020807995 | 8020812497 | 303 |
| 187 | iso_pu_bacteria | 8020945358 | 8020947649 | 303 |
| 188 | iso_pu_bacteria | 8021120328 | 8021126777 | 303 |
| 189 | iso_pu_bacteria | 8039098773 | 8039099160 | 303 |
| 190 | iso_pu_bacteria | 8040167225 | 8040172249 | 303 |
| 191 | iso_pu_bacteria | 8040173305 | 8040178078 | 303 |
| 192 | iso_pu_bacteria | 8056161164 | 8056166386 | 303 |
| 193 | iso_pu_bacteria | 8057101203 | 8057103874 | 303 |
| 194 | 3300031727 | Ga0316576_10200465 | Ga0316576_102004651 | 305 |
| 195 | 3300002737 | JGI25162J39368_1000051 | JGI25162J39368_100005170 | 306 |
| 196 | 3300002771 | JGI25163J39215_1000030 | JGI25163J39215_10000304 | 306 |
| 197 | 3300002772 | JGI25164J39214_1000027 | JGI25164J39214_100002751 | 306 |
| 198 | 3300003214 | JGI25165J46597_1000101 | JGI25165J46597_100010151 | 306 |
| 199 | 3300003781 | Ga0055536_1003447 | Ga0055536_10034472 | 306 |
| 200 | 3300003791 | Ga0055530_10007923 | Ga0055530_100079235 | 306 |
| 201 | 3300003792 | Ga0055540_1000420 | Ga0055540_100042011 | 306 |
| 202 | 3300003792 | Ga0055540_1000492 | Ga0055540_100049218 | 306 |
| 203 | 3300003794 | Ga0055531_10000309 | Ga0055531_1000030936 | 306 |
| 204 | 3300006058 | Ga0075432_10013134 | Ga0075432_100131344 | 306 |
| 205 | 3300025207 | Ga0209760_100014 | Ga0209760_10001469 | 306 |
| 206 | 3300025231 | Ga0207427_100011 | Ga0207427_100011318 | 306 |
| 207 | 3300025233 | Ga0209437_100025 | Ga0209437_100025252 | 306 |
| 208 | 3300025261 | Ga0209233_1000012 | Ga0209233_1000012771 | 306 |
| 209 | 3300025292 | Ga0209676_1000105 | Ga0209676_100010567 | 306 |
| 210 | 3300025298 | Ga0209050_1001141 | Ga0209050_10011413 | 306 |
| 211 | 3300025303 | Ga0209051_1000064 | Ga0209051_1000064154 | 306 |
| 212 | 3300025304 | Ga0209257_1000109 | Ga0209257_1000109154 | 306 |
| 213 | 3300046458 | Ga0495591_002550 | Ga0495591_002550_1885_2805 | 306 |
| 214 | 3300046542 | Ga0495597_0003934 | Ga0495597_0003934_5647_6567 | 306 |
| 215 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_93722_94642 | 306 |
| 216 | 3300046692 | Ga0495671_0035644 | Ga0495671_0035644_1402_2322 | 306 |
| 217 | 3300047470 | Ga0495681_0000372 | Ga0495681_0000372_18007_18945 | 306 |
| 218 | 3300053134 | Ga0500658_0000012 | Ga0500658_0000012_22897_23817 | 306 |
| 219 | 3300001989 | JGI24739J22299_10019145 | JGI24739J22299_100191452 | 307 |
| 220 | 3300002067 | JGI24735J21928_10069460 | JGI24735J21928_100694601 | 307 |
| 221 | 3300003763 | Ga0055529_1000783 | Ga0055529_100078319 | 307 |
| 222 | 3300003781 | Ga0055536_1012362 | Ga0055536_10123623 | 307 |
| 223 | 3300003790 | Ga0055528_1004283 | Ga0055528_10042831 | 307 |
| 224 | 3300005288 | Ga0065714_10003773 | Ga0065714_100037732 | 307 |
| 225 | 3300005288 | Ga0065714_10013835 | Ga0065714_100138353 | 307 |
| 226 | 3300005288 | Ga0065714_10018286 | Ga0065714_100182862 | 307 |
| 227 | 3300005290 | Ga0065712_10002138 | Ga0065712_100021385 | 307 |
| 228 | 3300005327 | Ga0070658_10050471 | Ga0070658_100504714 | 307 |
| 229 | 3300005339 | Ga0070660_100000032 | Ga0070660_10000003225 | 307 |
| 230 | 3300005366 | Ga0070659_100000035 | Ga0070659_10000003558 | 307 |
| 231 | 3300005455 | Ga0070663_100001341 | Ga0070663_1000013412 | 307 |
| 232 | 3300005616 | Ga0068852_100039241 | Ga0068852_1000392412 | 307 |
| 233 | 3300006058 | Ga0075432_10000949 | Ga0075432_100009495 | 307 |
| 234 | 3300009011 | Ga0105251_10005374 | Ga0105251_100053742 | 307 |
| 235 | 3300009036 | Ga0105244_10015632 | Ga0105244_100156322 | 307 |
| 236 | 3300009036 | Ga0105244_10019652 | Ga0105244_100196524 | 307 |
| 237 | 3300009036 | Ga0105244_10053380 | Ga0105244_100533802 | 307 |
| 238 | 3300009092 | Ga0105250_10000084 | Ga0105250_1000008453 | 307 |
| 239 | 3300009092 | Ga0105250_10000549 | Ga0105250_1000054910 | 307 |
| 240 | 3300009092 | Ga0105250_10003112 | Ga0105250_100031122 | 307 |
| 241 | 3300009093 | Ga0105240_10117814 | Ga0105240_101178142 | 307 |
| 242 | 3300009551 | Ga0105238_10132314 | Ga0105238_101323142 | 307 |
| 243 | 3300010375 | Ga0105239_10017732 | Ga0105239_100177325 | 307 |
| 244 | 3300011119 | Ga0105246_10041298 | Ga0105246_100412985 | 307 |
| 245 | 3300013100 | Ga0157373_10008632 | Ga0157373_100086322 | 307 |
| 246 | 3300013102 | Ga0157371_10000189 | Ga0157371_100001897 | 307 |
| 247 | 3300013102 | Ga0157371_10007038 | Ga0157371_100070382 | 307 |
| 248 | 3300013104 | Ga0157370_10100427 | Ga0157370_101004272 | 307 |
| 249 | 3300013105 | Ga0157369_10000802 | Ga0157369_1000080217 | 307 |
| 250 | 3300013306 | Ga0163162_10049179 | Ga0163162_100491796 | 307 |
| 251 | 3300015261 | Ga0182006_1000191 | Ga0182006_100019134 | 307 |
| 252 | 3300015261 | Ga0182006_1020569 | Ga0182006_10205692 | 307 |
| 253 | 3300015265 | Ga0182005_1000092 | Ga0182005_100009234 | 307 |
| 254 | 3300017792 | Ga0163161_10005213 | Ga0163161_100052137 | 307 |
| 255 | 3300017792 | Ga0163161_10019022 | Ga0163161_100190225 | 307 |
| 256 | 3300017792 | Ga0163161_10024765 | Ga0163161_100247655 | 307 |
| 257 | 3300021361 | Ga0213872_10006341 | Ga0213872_100063415 | 307 |
| 258 | 3300025228 | Ga0209672_100028 | Ga0209672_100028129 | 307 |
| 259 | 3300025228 | Ga0209672_100038 | Ga0209672_100038192 | 307 |
| 260 | 3300025229 | Ga0209147_100163 | Ga0209147_10016359 | 307 |
| 261 | 3300025229 | Ga0209147_100259 | Ga0209147_10025936 | 307 |
| 262 | 3300025242 | Ga0209258_100191 | Ga0209258_10019118 | 307 |
| 263 | 3300025242 | Ga0209258_100289 | Ga0209258_10028917 | 307 |
| 264 | 3300025254 | Ga0209148_1000081 | Ga0209148_1000081109 | 307 |
| 265 | 3300025256 | Ga0209759_1011057 | Ga0209759_10110573 | 307 |
| 266 | 3300025272 | Ga0209455_1000050 | Ga0209455_1000050191 | 307 |
| 267 | 3300025273 | Ga0209673_1000038 | Ga0209673_1000038126 | 307 |
| 268 | 3300025292 | Ga0209676_1000855 | Ga0209676_100085530 | 307 |
| 269 | 3300025295 | Ga0209564_1018517 | Ga0209564_10185173 | 307 |
| 270 | 3300025711 | Ga0207696_1000222 | Ga0207696_100022252 | 307 |
| 271 | 3300025711 | Ga0207696_1000607 | Ga0207696_100060726 | 307 |
| 272 | 3300025711 | Ga0207696_1002327 | Ga0207696_10023278 | 307 |
| 273 | 3300025711 | Ga0207696_1008008 | Ga0207696_10080085 | 307 |
| 274 | 3300025711 | Ga0207696_1034175 | Ga0207696_10341751 | 307 |
| 275 | 3300025728 | Ga0207655_1001108 | Ga0207655_10011088 | 307 |
| 276 | 3300025728 | Ga0207655_1016969 | Ga0207655_10169692 | 307 |
| 277 | 3300025728 | Ga0207655_1048637 | Ga0207655_10486372 | 307 |
| 278 | 3300025735 | Ga0207713_1005227 | Ga0207713_10052278 | 307 |
| 279 | 3300025735 | Ga0207713_1010201 | Ga0207713_10102012 | 307 |
| 280 | 3300025904 | Ga0207647_10006816 | Ga0207647_100068162 | 307 |
| 281 | 3300025909 | Ga0207705_10036150 | Ga0207705_100361502 | 307 |
| 282 | 3300025913 | Ga0207695_10022380 | Ga0207695_100223804 | 307 |
| 283 | 3300025919 | Ga0207657_10000051 | Ga0207657_1000005122 | 307 |
| 284 | 3300025932 | Ga0207690_10000034 | Ga0207690_1000003457 | 307 |
| 285 | 3300025932 | Ga0207690_10010955 | Ga0207690_100109554 | 307 |
| 286 | 3300025949 | Ga0207667_10083069 | Ga0207667_100830694 | 307 |
| 287 | 3300026067 | Ga0207678_10000508 | Ga0207678_1000050814 | 307 |
| 288 | 3300026116 | Ga0207674_10468378 | Ga0207674_104683782 | 307 |
| 289 | 3300027312 | Ga0209371_1000439 | Ga0209371_100043915 | 307 |
| 290 | 3300030500 | Ga0268256_1000895 | Ga0268256_10008956 | 307 |
| 291 | 3300037312 | Ga0395899_0030038 | Ga0395899_0030038_1665_2597 | 307 |
| 292 | 3300037312 | Ga0395899_0164633 | Ga0395899_0164633_42_974 | 307 |
| 293 | 3300037418 | Ga0395900_0000003 | Ga0395900_0000003_48816_49748 | 307 |
| 294 | 3300037418 | Ga0395900_0003333 | Ga0395900_0003333_9122_10054 | 307 |
| 295 | 3300037418 | Ga0395900_0061875 | Ga0395900_0061875_292_1224 | 307 |
| 296 | 3300037466 | Ga0395898_0000003 | Ga0395898_0000003_723239_724171 | 307 |
| 297 | 3300037466 | Ga0395898_0001172 | Ga0395898_0001172_24615_25547 | 307 |
| 298 | 3300037466 | Ga0395898_0077661 | Ga0395898_0077661_1644_2576 | 307 |
| 299 | 3300038443 | Ga0395901_0000045 | Ga0395901_0000045_99239_100171 | 307 |
| 300 | 3300038443 | Ga0395901_0012509 | Ga0395901_0012509_3372_4304 | 307 |
| 301 | 3300038443 | Ga0395901_0086188 | Ga0395901_0086188_1854_2789 | 307 |
| 302 | 3300039437 | Ga0436365_0433621 | Ga0436365_0433621_2856_3779 | 307 |
| 303 | 3300039447 | Ga0436361_1123903 | Ga0436361_1123903_14614_15537 | 307 |
| 304 | 3300041405 | Ga0439438_001454 | Ga0439438_001454_5457_6380 | 307 |
| 305 | 3300042006 | Ga0439432_010954 | Ga0439432_010954_1511_2434 | 307 |
| 306 | 3300042009 | Ga0439451_000735 | Ga0439451_000735_1697_2623 | 307 |
| 307 | 3300042009 | Ga0439451_003621 | Ga0439451_003621_1274_2197 | 307 |
| 308 | 3300042010 | Ga0439452_000146 | Ga0439452_000146_23773_24696 | 307 |
| 309 | 3300042010 | Ga0439452_000292 | Ga0439452_000292_13116_14039 | 307 |
| 310 | 3300042010 | Ga0439452_005855 | Ga0439452_005855_2090_3013 | 307 |
| 311 | 3300042013 | Ga0439456_018778 | Ga0439456_018778_49_972 | 307 |
| 312 | 3300042138 | Ga0450903_000497 | Ga0450903_000497_1489_2412 | 307 |
| 313 | 3300042139 | Ga0450904_001470 | Ga0450904_001470_1070_1993 | 307 |
| 314 | 3300042146 | Ga0450907_000060 | Ga0450907_000060_10963_11886 | 307 |
| 315 | 3300042156 | Ga0439446_0006650 | Ga0439446_0006650_722_1645 | 307 |
| 316 | 3300042185 | Ga0450909_011975 | Ga0450909_011975_101_1024 | 307 |
| 317 | 3300042435 | Ga0439434_0000096 | Ga0439434_0000096_1606_2529 | 307 |
| 318 | 3300042461 | Ga0439460_0001418 | Ga0439460_0001418_752_1675 | 307 |
| 319 | 3300042876 | Ga0451577_0000338 | Ga0451577_0000338_58874_59797 | 307 |
| 320 | 3300042993 | Ga0439440_0007305 | Ga0439440_0007305_999_1922 | 307 |
| 321 | 3300044656 | Ga0466969_0001536 | Ga0466969_0001536_11260_12237 | 307 |
| 322 | 3300044658 | Ga0466972_0000155 | Ga0466972_0000155_25306_26229 | 307 |
| 323 | 3300044683 | Ga0466965_0011127 | Ga0466965_0011127_326_1303 | 307 |
| 324 | 3300044684 | Ga0466966_0029687 | Ga0466966_0029687_1170_2102 | 307 |
| 325 | 3300044693 | Ga0466961_0000258 | Ga0466961_0000258_24584_25510 | 307 |
| 326 | 3300044693 | Ga0466961_0001247 | Ga0466961_0001247_9283_10260 | 307 |
| 327 | 3300044694 | Ga0466963_0003576 | Ga0466963_0003576_1395_2327 | 307 |
| 328 | 3300044694 | Ga0466963_0006455 | Ga0466963_0006455_4226_5152 | 307 |
| 329 | 3300044712 | Ga0453684_0000495 | Ga0453684_0000495_153541_154464 | 307 |
| 330 | 3300044719 | Ga0466971_0000370 | Ga0466971_0000370_12947_13879 | 307 |
| 331 | 3300044719 | Ga0466971_0003779 | Ga0466971_0003779_711_1688 | 307 |
| 332 | 3300044719 | Ga0466971_0006418 | Ga0466971_0006418_872_1798 | 307 |
| 333 | 3300044842 | Ga0466957_0001907 | Ga0466957_0001907_528_1505 | 307 |
| 334 | 3300044901 | Ga0466960_0136501 | Ga0466960_0136501_302_1228 | 307 |
| 335 | 3300045049 | Ga0466959_0007944 | Ga0466959_0007944_4993_5919 | 307 |
| 336 | 3300045049 | Ga0466959_0055001 | Ga0466959_0055001_408_1385 | 307 |
| 337 | 3300045836 | Ga0466958_0019177 | Ga0466958_0019177_1319_2245 | 307 |
| 338 | 3300045836 | Ga0466958_0030952 | Ga0466958_0030952_728_1705 | 307 |
| 339 | 3300045976 | Ga0466967_0065656 | Ga0466967_0065656_1208_2284 | 307 |
| 340 | 3300046452 | Ga0495617_000844 | Ga0495617_000844_10462_11433 | 307 |
| 341 | 3300046452 | Ga0495617_013342 | Ga0495617_013342_113_1036 | 307 |
| 342 | 3300046452 | Ga0495617_014612 | Ga0495617_014612_879_1802 | 307 |
| 343 | 3300046453 | Ga0495627_021602 | Ga0495627_021602_793_1716 | 307 |
| 344 | 3300046453 | Ga0495627_041334 | Ga0495627_041334_222_1145 | 307 |
| 345 | 3300046455 | Ga0495603_0000337 | Ga0495603_0000337_23520_24443 | 307 |
| 346 | 3300046457 | Ga0495590_0002611 | Ga0495590_0002611_4701_5657 | 307 |
| 347 | 3300046457 | Ga0495590_0010841 | Ga0495590_0010841_232_1173 | 307 |
| 348 | 3300046457 | Ga0495590_0012332 | Ga0495590_0012332_1217_2140 | 307 |
| 349 | 3300046457 | Ga0495590_0013264 | Ga0495590_0013264_1026_1949 | 307 |
| 350 | 3300046458 | Ga0495591_000060 | Ga0495591_000060_70776_71699 | 307 |
| 351 | 3300046458 | Ga0495591_003898 | Ga0495591_003898_953_1876 | 307 |
| 352 | 3300046458 | Ga0495591_024792 | Ga0495591_024792_474_1397 | 307 |
| 353 | 3300046459 | Ga0495629_0004842 | Ga0495629_0004842_3163_4119 | 307 |
| 354 | 3300046460 | Ga0495638_0001873 | Ga0495638_0001873_15445_16368 | 307 |
| 355 | 3300046460 | Ga0495638_0008997 | Ga0495638_0008997_3258_4181 | 307 |
| 356 | 3300046460 | Ga0495638_0030308 | Ga0495638_0030308_2152_3075 | 307 |
| 357 | 3300046460 | Ga0495638_0081295 | Ga0495638_0081295_10_933 | 307 |
| 358 | 3300046460 | Ga0495638_0089763 | Ga0495638_0089763_205_1161 | 307 |
| 359 | 3300046463 | Ga0495653_0001219 | Ga0495653_0001219_5595_6518 | 307 |
| 360 | 3300046463 | Ga0495653_0005957 | Ga0495653_0005957_3083_4039 | 307 |
| 361 | 3300046471 | Ga0495650_0001020 | Ga0495650_0001020_25305_26228 | 307 |
| 362 | 3300046471 | Ga0495650_0001892 | Ga0495650_0001892_1809_2732 | 307 |
| 363 | 3300046471 | Ga0495650_0002415 | Ga0495650_0002415_9190_10131 | 307 |
| 364 | 3300046471 | Ga0495650_0005703 | Ga0495650_0005703_2489_3412 | 307 |
| 365 | 3300046471 | Ga0495650_0015658 | Ga0495650_0015658_2241_3197 | 307 |
| 366 | 3300046471 | Ga0495650_0048809 | Ga0495650_0048809_261_1184 | 307 |
| 367 | 3300046472 | Ga0495580_0011295 | Ga0495580_0011295_1672_2628 | 307 |
| 368 | 3300046472 | Ga0495580_0038337 | Ga0495580_0038337_564_1520 | 307 |
| 369 | 3300046473 | Ga0495582_0020479 | Ga0495582_0020479_2269_3225 | 307 |
| 370 | 3300046474 | Ga0495605_0004771 | Ga0495605_0004771_1284_2207 | 307 |
| 371 | 3300046474 | Ga0495605_0008597 | Ga0495605_0008597_3701_4624 | 307 |
| 372 | 3300046474 | Ga0495605_0013146 | Ga0495605_0013146_1907_2830 | 307 |
| 373 | 3300046474 | Ga0495605_0014977 | Ga0495605_0014977_584_1540 | 307 |
| 374 | 3300046474 | Ga0495605_0028302 | Ga0495605_0028302_184_1107 | 307 |
| 375 | 3300046474 | Ga0495605_0032970 | Ga0495605_0032970_833_1756 | 307 |
| 376 | 3300046474 | Ga0495605_0042677 | Ga0495605_0042677_463_1386 | 307 |
| 377 | 3300046474 | Ga0495605_0062347 | Ga0495605_0062347_727_1650 | 307 |
| 378 | 3300046475 | Ga0495639_0000016 | Ga0495639_0000016_43953_44876 | 307 |
| 379 | 3300046491 | Ga0495584_0012049 | Ga0495584_0012049_3225_4148 | 307 |
| 380 | 3300046491 | Ga0495584_0036174 | Ga0495584_0036174_983_1906 | 307 |
| 381 | 3300046491 | Ga0495584_0048028 | Ga0495584_0048028_235_1158 | 307 |
| 382 | 3300046491 | Ga0495584_0079245 | Ga0495584_0079245_203_1126 | 307 |
| 383 | 3300046492 | Ga0495585_0000219 | Ga0495585_0000219_13085_14008 | 307 |
| 384 | 3300046492 | Ga0495585_0001028 | Ga0495585_0001028_19896_20837 | 307 |
| 385 | 3300046492 | Ga0495585_0014678 | Ga0495585_0014678_3422_4345 | 307 |
| 386 | 3300046499 | Ga0495594_0003073 | Ga0495594_0003073_6333_7256 | 307 |
| 387 | 3300046499 | Ga0495594_0043472 | Ga0495594_0043472_1237_2208 | 307 |
| 388 | 3300046500 | Ga0495596_0000083 | Ga0495596_0000083_36732_37655 | 307 |
| 389 | 3300046501 | Ga0495607_0002053 | Ga0495607_0002053_15355_16374 | 307 |
| 390 | 3300046501 | Ga0495607_0008431 | Ga0495607_0008431_3711_4634 | 307 |
| 391 | 3300046501 | Ga0495607_0009300 | Ga0495607_0009300_5289_6212 | 307 |
| 392 | 3300046501 | Ga0495607_0017208 | Ga0495607_0017208_2130_3161 | 307 |
| 393 | 3300046506 | Ga0495583_0000467 | Ga0495583_0000467_50038_51069 | 307 |
| 394 | 3300046506 | Ga0495583_0004739 | Ga0495583_0004739_4178_5143 | 307 |
| 395 | 3300046506 | Ga0495583_0064372 | Ga0495583_0064372_295_1218 | 307 |
| 396 | 3300046507 | Ga0495606_0001204 | Ga0495606_0001204_32022_32957 | 307 |
| 397 | 3300046507 | Ga0495606_0004583 | Ga0495606_0004583_349_1272 | 307 |
| 398 | 3300046507 | Ga0495606_0009895 | Ga0495606_0009895_5799_6722 | 307 |
| 399 | 3300046507 | Ga0495606_0012725 | Ga0495606_0012725_2150_3106 | 307 |
| 400 | 3300046512 | Ga0495610_0000842 | Ga0495610_0000842_8257_9180 | 307 |
| 401 | 3300046512 | Ga0495610_0008011 | Ga0495610_0008011_1070_1993 | 307 |
| 402 | 3300046512 | Ga0495610_0011287 | Ga0495610_0011287_1453_2376 | 307 |
| 403 | 3300046513 | Ga0495616_0001642 | Ga0495616_0001642_13677_14600 | 307 |
| 404 | 3300046513 | Ga0495616_0027767 | Ga0495616_0027767_1442_2407 | 307 |
| 405 | 3300046515 | Ga0495620_0006725 | Ga0495620_0006725_1672_2595 | 307 |
| 406 | 3300046515 | Ga0495620_0013828 | Ga0495620_0013828_1403_2326 | 307 |
| 407 | 3300046516 | Ga0495628_0011614 | Ga0495628_0011614_2881_3837 | 307 |
| 408 | 3300046516 | Ga0495628_0099929 | Ga0495628_0099929_609_1643 | 307 |
| 409 | 3300046517 | Ga0495630_0004302 | Ga0495630_0004302_7372_8295 | 307 |
| 410 | 3300046517 | Ga0495630_0076627 | Ga0495630_0076627_619_1542 | 307 |
| 411 | 3300046517 | Ga0495630_0099332 | Ga0495630_0099332_1216_2172 | 307 |
| 412 | 3300046518 | Ga0495631_0000014 | Ga0495631_0000014_12716_13639 | 307 |
| 413 | 3300046518 | Ga0495631_0003553 | Ga0495631_0003553_954_1877 | 307 |
| 414 | 3300046519 | Ga0495632_0000022 | Ga0495632_0000022_107022_107945 | 307 |
| 415 | 3300046519 | Ga0495632_0000301 | Ga0495632_0000301_8900_9841 | 307 |
| 416 | 3300046519 | Ga0495632_0002786 | Ga0495632_0002786_1809_2732 | 307 |
| 417 | 3300046519 | Ga0495632_0003547 | Ga0495632_0003547_9461_10384 | 307 |
| 418 | 3300046519 | Ga0495632_0003659 | Ga0495632_0003659_922_1845 | 307 |
| 419 | 3300046519 | Ga0495632_0084462 | Ga0495632_0084462_28_1047 | 307 |
| 420 | 3300046519 | Ga0495632_0101206 | Ga0495632_0101206_355_1278 | 307 |
| 421 | 3300046520 | Ga0495637_0000294 | Ga0495637_0000294_36999_37922 | 307 |
| 422 | 3300046520 | Ga0495637_0000463 | Ga0495637_0000463_1297_2238 | 307 |
| 423 | 3300046520 | Ga0495637_0007661 | Ga0495637_0007661_4401_5324 | 307 |
| 424 | 3300046520 | Ga0495637_0016435 | Ga0495637_0016435_1407_2330 | 307 |
| 425 | 3300046520 | Ga0495637_0039923 | Ga0495637_0039923_107_1030 | 307 |
| 426 | 3300046522 | Ga0495643_0040579 | Ga0495643_0040579_473_1492 | 307 |
| 427 | 3300046523 | Ga0495644_0000064 | Ga0495644_0000064_40673_41596 | 307 |
| 428 | 3300046523 | Ga0495644_0023999 | Ga0495644_0023999_1098_2021 | 307 |
| 429 | 3300046524 | Ga0495648_0011057 | Ga0495648_0011057_1470_2435 | 307 |
| 430 | 3300046524 | Ga0495648_0030605 | Ga0495648_0030605_45_968 | 307 |
| 431 | 3300046524 | Ga0495648_0085733 | Ga0495648_0085733_543_1499 | 307 |
| 432 | 3300046524 | Ga0495648_0094701 | Ga0495648_0094701_628_1599 | 307 |
| 433 | 3300046526 | Ga0495666_0001376 | Ga0495666_0001376_9571_10494 | 307 |
| 434 | 3300046526 | Ga0495666_0087557 | Ga0495666_0087557_398_1357 | 307 |
| 435 | 3300046526 | Ga0495666_0096078 | Ga0495666_0096078_374_1330 | 307 |
| 436 | 3300046528 | Ga0495642_0000011 | Ga0495642_0000011_76433_77464 | 307 |
| 437 | 3300046529 | Ga0495652_0029190 | Ga0495652_0029190_113_1072 | 307 |
| 438 | 3300046530 | Ga0495654_0000263 | Ga0495654_0000263_35040_35963 | 307 |
| 439 | 3300046530 | Ga0495654_0002386 | Ga0495654_0002386_6663_7586 | 307 |
| 440 | 3300046530 | Ga0495654_0020473 | Ga0495654_0020473_1034_1957 | 307 |
| 441 | 3300046530 | Ga0495654_0026601 | Ga0495654_0026601_1893_2816 | 307 |
| 442 | 3300046530 | Ga0495654_0061955 | Ga0495654_0061955_100_1023 | 307 |
| 443 | 3300046530 | Ga0495654_0070932 | Ga0495654_0070932_36_977 | 307 |
| 444 | 3300046531 | Ga0495665_0045648 | Ga0495665_0045648_583_1539 | 307 |
| 445 | 3300046536 | Ga0495587_0001361 | Ga0495587_0001361_7204_8127 | 307 |
| 446 | 3300046538 | Ga0495609_0000212 | Ga0495609_0000212_27714_28745 | 307 |
| 447 | 3300046538 | Ga0495609_0087983 | Ga0495609_0087983_276_1232 | 307 |
| 448 | 3300046542 | Ga0495597_0001850 | Ga0495597_0001850_13043_14062 | 307 |
| 449 | 3300046542 | Ga0495597_0024251 | Ga0495597_0024251_995_1918 | 307 |
| 450 | 3300046542 | Ga0495597_0045891 | Ga0495597_0045891_768_1691 | 307 |
| 451 | 3300046557 | Ga0495622_0000070 | Ga0495622_0000070_51892_52815 | 307 |
| 452 | 3300046557 | Ga0495622_0000350 | Ga0495622_0000350_17664_18635 | 307 |
| 453 | 3300046558 | Ga0495633_0002077 | Ga0495633_0002077_2046_2969 | 307 |
| 454 | 3300046616 | Ga0495668_0000635 | Ga0495668_0000635_1576_2499 | 307 |
| 455 | 3300046642 | Ga0495634_0000290 | Ga0495634_0000290_35896_36819 | 307 |
| 456 | 3300046660 | Ga0495625_0002425 | Ga0495625_0002425_1808_2731 | 307 |
| 457 | 3300046660 | Ga0495625_0002680 | Ga0495625_0002680_1173_2096 | 307 |
| 458 | 3300046660 | Ga0495625_0026831 | Ga0495625_0026831_261_1184 | 307 |
| 459 | 3300046663 | Ga0495635_0000107 | Ga0495635_0000107_1043_1966 | 307 |
| 460 | 3300046664 | Ga0495659_0000056 | Ga0495659_0000056_11098_12021 | 307 |
| 461 | 3300046664 | Ga0495659_0005571 | Ga0495659_0005571_2629_3660 | 307 |
| 462 | 3300046665 | Ga0495661_0016734 | Ga0495661_0016734_2731_3654 | 307 |
| 463 | 3300046665 | Ga0495661_0023211 | Ga0495661_0023211_2023_2979 | 307 |
| 464 | 3300046675 | Ga0495657_0125585 | Ga0495657_0125585_395_1318 | 307 |
| 465 | 3300046679 | Ga0495623_0019562 | Ga0495623_0019562_2341_3375 | 307 |
| 466 | 3300046679 | Ga0495623_0058750 | Ga0495623_0058750_1090_2013 | 307 |
| 467 | 3300046680 | Ga0495646_0000723 | Ga0495646_0000723_6451_7374 | 307 |
| 468 | 3300046680 | Ga0495646_0007377 | Ga0495646_0007377_3038_3994 | 307 |
| 469 | 3300046684 | Ga0495669_0000591 | Ga0495669_0000591_762_1685 | 307 |
| 470 | 3300046690 | Ga0495624_0008865 | Ga0495624_0008865_2604_3560 | 307 |
| 471 | 3300046690 | Ga0495624_0020250 | Ga0495624_0020250_2555_3511 | 307 |
| 472 | 3300046692 | Ga0495671_0000496 | Ga0495671_0000496_2828_3751 | 307 |
| 473 | 3300046692 | Ga0495671_0050039 | Ga0495671_0050039_1090_2013 | 307 |
| 474 | 3300046692 | Ga0495671_0057728 | Ga0495671_0057728_779_1702 | 307 |
| 475 | 3300046692 | Ga0495671_0062279 | Ga0495671_0062279_761_1684 | 307 |
| 476 | 3300046694 | Ga0495649_0000485 | Ga0495649_0000485_4643_5566 | 307 |
| 477 | 3300046694 | Ga0495649_0001028 | Ga0495649_0001028_20491_21414 | 307 |
| 478 | 3300046694 | Ga0495649_0029045 | Ga0495649_0029045_664_1587 | 307 |
| 479 | 3300046694 | Ga0495649_0069201 | Ga0495649_0069201_708_1631 | 307 |
| 480 | 3300046694 | Ga0495649_0070452 | Ga0495649_0070452_589_1512 | 307 |
| 481 | 3300046694 | Ga0495649_0081851 | Ga0495649_0081851_697_1716 | 307 |
| 482 | 3300046794 | Ga0495589_0000823 | Ga0495589_0000823_18540_19472 | 307 |
| 483 | 3300046794 | Ga0495589_0018397 | Ga0495589_0018397_1784_2707 | 307 |
| 484 | 3300046794 | Ga0495589_0018643 | Ga0495589_0018643_1926_2849 | 307 |
| 485 | 3300046794 | Ga0495589_0026254 | Ga0495589_0026254_393_1358 | 307 |
| 486 | 3300046794 | Ga0495589_0076824 | Ga0495589_0076824_315_1238 | 307 |
| 487 | 3300046810 | Ga0495660_0031644 | Ga0495660_0031644_1764_2783 | 307 |
| 488 | 3300046810 | Ga0495660_0044438 | Ga0495660_0044438_682_1605 | 307 |
| 489 | 3300046810 | Ga0495660_0046093 | Ga0495660_0046093_637_1560 | 307 |
| 490 | 3300046810 | Ga0495660_0099126 | Ga0495660_0099126_113_1036 | 307 |
| 491 | 3300047315 | Ga0495581_0002889 | Ga0495581_0002889_2396_3319 | 307 |
| 492 | 3300047317 | Ga0495604_0009287 | Ga0495604_0009287_5346_6269 | 307 |
| 493 | 3300047317 | Ga0495604_0027529 | Ga0495604_0027529_2265_3188 | 307 |
| 494 | 3300047318 | Ga0495636_0024195 | Ga0495636_0024195_805_1746 | 307 |
| 495 | 3300047319 | Ga0495674_0000507 | Ga0495674_0000507_10904_11863 | 307 |
| 496 | 3300047319 | Ga0495674_0002074 | Ga0495674_0002074_16458_17414 | 307 |
| 497 | 3300047319 | Ga0495674_0006124 | Ga0495674_0006124_2328_3293 | 307 |
| 498 | 3300047319 | Ga0495674_0010629 | Ga0495674_0010629_6537_7460 | 307 |
| 499 | 3300047320 | Ga0495672_0000698 | Ga0495672_0000698_33678_34601 | 307 |
| 500 | 3300047320 | Ga0495672_0030539 | Ga0495672_0030539_956_1921 | 307 |
| 501 | 3300047320 | Ga0495672_0037598 | Ga0495672_0037598_686_1609 | 307 |
| 502 | 3300047320 | Ga0495672_0041484 | Ga0495672_0041484_684_1607 | 307 |
| 503 | 3300047320 | Ga0495672_0050550 | Ga0495672_0050550_736_1677 | 307 |
| 504 | 3300047320 | Ga0495672_0118664 | Ga0495672_0118664_27_950 | 307 |
| 505 | 3300047321 | Ga0495676_0157246 | Ga0495676_0157246_341_1297 | 307 |
| 506 | 3300047323 | Ga0495683_0000057 | Ga0495683_0000057_10239_11162 | 307 |
| 507 | 3300047323 | Ga0495683_0002986 | Ga0495683_0002986_736_1659 | 307 |
| 508 | 3300047323 | Ga0495683_0009936 | Ga0495683_0009936_3159_4082 | 307 |
| 509 | 3300047323 | Ga0495683_0015284 | Ga0495683_0015284_2007_2930 | 307 |
| 510 | 3300047323 | Ga0495683_0026580 | Ga0495683_0026580_1432_2355 | 307 |
| 511 | 3300047323 | Ga0495683_0074784 | Ga0495683_0074784_539_1504 | 307 |
| 512 | 3300047443 | Ga0495687_003368 | Ga0495687_003368_9556_10587 | 307 |
| 513 | 3300047443 | Ga0495687_003616 | Ga0495687_003616_9188_10111 | 307 |
| 514 | 3300047443 | Ga0495687_007084 | Ga0495687_007084_284_1249 | 307 |
| 515 | 3300047446 | Ga0495679_000054 | Ga0495679_000054_20806_21762 | 307 |
| 516 | 3300047446 | Ga0495679_001048 | Ga0495679_001048_15792_16724 | 307 |
| 517 | 3300047446 | Ga0495679_027634 | Ga0495679_027634_835_1758 | 307 |
| 518 | 3300047469 | Ga0495673_0000234 | Ga0495673_0000234_13633_14556 | 307 |
| 519 | 3300047469 | Ga0495673_0000717 | Ga0495673_0000717_25234_26157 | 307 |
| 520 | 3300047469 | Ga0495673_0000829 | Ga0495673_0000829_8129_9052 | 307 |
| 521 | 3300047469 | Ga0495673_0000891 | Ga0495673_0000891_25226_26149 | 307 |
| 522 | 3300047469 | Ga0495673_0004176 | Ga0495673_0004176_1243_2199 | 307 |
| 523 | 3300047469 | Ga0495673_0007511 | Ga0495673_0007511_4446_5411 | 307 |
| 524 | 3300047469 | Ga0495673_0043354 | Ga0495673_0043354_92_1024 | 307 |
| 525 | 3300047469 | Ga0495673_0045372 | Ga0495673_0045372_810_1841 | 307 |
| 526 | 3300047470 | Ga0495681_0000533 | Ga0495681_0000533_14929_15852 | 307 |
| 527 | 3300047470 | Ga0495681_0003850 | Ga0495681_0003850_3030_3953 | 307 |
| 528 | 3300047470 | Ga0495681_0049707 | Ga0495681_0049707_501_1520 | 307 |
| 529 | 3300047471 | Ga0495684_0169533 | Ga0495684_0169533_517_1440 | 307 |
| 530 | 3300047472 | Ga0495686_0002045 | Ga0495686_0002045_1752_2675 | 307 |
| 531 | 3300047472 | Ga0495686_0011147 | Ga0495686_0011147_2847_3770 | 307 |
| 532 | 3300047673 | Ga0495593_0003972 | Ga0495593_0003972_1672_2628 | 307 |
| 533 | 3300047673 | Ga0495593_0027760 | Ga0495593_0027760_1753_2676 | 307 |
| 534 | 3300047673 | Ga0495593_0028898 | Ga0495593_0028898_64_1020 | 307 |
| 535 | 3300047673 | Ga0495593_0065136 | Ga0495593_0065136_684_1607 | 307 |
| 536 | 3300048089 | Ga0495614_0017913 | Ga0495614_0017913_1509_2468 | 307 |
| 537 | 3300048091 | Ga0495626_0000066 | Ga0495626_0000066_128252_129178 | 307 |
| 538 | 3300048091 | Ga0495626_0000077 | Ga0495626_0000077_106328_107251 | 307 |
| 539 | 3300048091 | Ga0495626_0000268 | Ga0495626_0000268_35335_36258 | 307 |
| 540 | 3300048091 | Ga0495626_0000513 | Ga0495626_0000513_11968_12891 | 307 |
| 541 | 3300048091 | Ga0495626_0016477 | Ga0495626_0016477_2644_3600 | 307 |
| 542 | 3300048091 | Ga0495626_0032165 | Ga0495626_0032165_318_1349 | 307 |
| 543 | 3300048091 | Ga0495626_0041723 | Ga0495626_0041723_744_1685 | 307 |
| 544 | 3300048091 | Ga0495626_0082129 | Ga0495626_0082129_274_1239 | 307 |
| 545 | 3300048903 | Ga0496100_0049028 | Ga0496100_0049028_1569_2534 | 307 |
| 546 | 3300048905 | Ga0496102_0000394 | Ga0496102_0000394_14256_15290 | 307 |
| 547 | 3300048905 | Ga0496102_0285136 | Ga0496102_0285136_535_1491 | 307 |
| 548 | 3300048906 | Ga0496103_0000807 | Ga0496103_0000807_1191_2225 | 307 |
| 549 | 3300048907 | Ga0496104_0008299 | Ga0496104_0008299_521_1444 | 307 |
| 550 | 3300048910 | Ga0496107_0207349 | Ga0496107_0207349_445_1410 | 307 |
| 551 | 3300048914 | Ga0496111_0429002 | Ga0496111_0429002_17_940 | 307 |
| 552 | 3300048915 | Ga0496112_0003653 | Ga0496112_0003653_6134_7099 | 307 |
| 553 | 3300048916 | Ga0496113_0023278 | Ga0496113_0023278_2842_3807 | 307 |
| 554 | 3300048918 | Ga0496115_0018838 | Ga0496115_0018838_1648_2682 | 307 |
| 555 | 3300048919 | Ga0496116_0000744 | Ga0496116_0000744_9600_10523 | 307 |
| 556 | 3300048919 | Ga0496116_0004404 | Ga0496116_0004404_11942_12865 | 307 |
| 557 | 3300048919 | Ga0496116_0017890 | Ga0496116_0017890_399_1322 | 307 |
| 558 | 3300048920 | Ga0496117_0001810 | Ga0496117_0001810_6191_7114 | 307 |
| 559 | 3300048920 | Ga0496117_0023279 | Ga0496117_0023279_999_2033 | 307 |
| 560 | 3300048921 | Ga0496118_0006225 | Ga0496118_0006225_1225_2259 | 307 |
| 561 | 3300048921 | Ga0496118_0010514 | Ga0496118_0010514_5145_6101 | 307 |
| 562 | 3300048921 | Ga0496118_0011091 | Ga0496118_0011091_1721_2644 | 307 |
| 563 | 3300048921 | Ga0496118_0066121 | Ga0496118_0066121_1561_2484 | 307 |
| 564 | 3300048921 | Ga0496118_0083905 | Ga0496118_0083905_1216_2139 | 307 |
| 565 | 3300048922 | Ga0496119_0065628 | Ga0496119_0065628_33_998 | 307 |
| 566 | 3300048924 | Ga0496121_0004629 | Ga0496121_0004629_2891_3856 | 307 |
| 567 | 3300048924 | Ga0496121_0013075 | Ga0496121_0013075_6203_7126 | 307 |
| 568 | 3300048924 | Ga0496121_0034186 | Ga0496121_0034186_2663_3586 | 307 |
| 569 | 3300048924 | Ga0496121_0034234 | Ga0496121_0034234_3243_4166 | 307 |
| 570 | 3300048925 | Ga0496122_0001075 | Ga0496122_0001075_37451_38374 | 307 |
| 571 | 3300048925 | Ga0496122_0005294 | Ga0496122_0005294_8317_9240 | 307 |
| 572 | 3300048925 | Ga0496122_0010920 | Ga0496122_0010920_692_1615 | 307 |
| 573 | 3300048926 | Ga0496123_0000064 | Ga0496123_0000064_30340_31263 | 307 |
| 574 | 3300048926 | Ga0496123_0008678 | Ga0496123_0008678_692_1615 | 307 |
| 575 | 3300048926 | Ga0496123_0010347 | Ga0496123_0010347_2372_3295 | 307 |
| 576 | 3300048927 | Ga0496124_0003588 | Ga0496124_0003588_11407_12330 | 307 |
| 577 | 3300048927 | Ga0496124_0125040 | Ga0496124_0125040_313_1236 | 307 |
| 578 | 3300048928 | Ga0496125_0010383 | Ga0496125_0010383_4807_5730 | 307 |
| 579 | 3300048928 | Ga0496125_0022611 | Ga0496125_0022611_2307_3230 | 307 |
| 580 | 3300048928 | Ga0496125_0045688 | Ga0496125_0045688_386_1309 | 307 |
| 581 | 3300048928 | Ga0496125_0227651 | Ga0496125_0227651_199_1122 | 307 |
| 582 | 3300048929 | Ga0496126_0007462 | Ga0496126_0007462_5694_6617 | 307 |
| 583 | 3300048929 | Ga0496126_0013013 | Ga0496126_0013013_2358_3281 | 307 |
| 584 | 3300049459 | Ga0495678_001920 | Ga0495678_001920_1316_2335 | 307 |
| 585 | 3300049459 | Ga0495678_015692 | Ga0495678_015692_757_1680 | 307 |
| 586 | 3300049460 | Ga0495682_0003682 | Ga0495682_0003682_2838_3803 | 307 |
| 587 | 3300049460 | Ga0495682_0020493 | Ga0495682_0020493_1275_2309 | 307 |
| 588 | 3300061719 | Ga0466962_0003294 | Ga0466962_0003294_4903_5835 | 307 |
| 589 | 3300061719 | Ga0466962_0020824 | Ga0466962_0020824_728_1705 | 307 |
| 590 | iso_pu_bacteria | 2902682994 | 2902686069 | 307 |
| 591 | iso_pu_bacteria | 2978975091 | 2978979684 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j31-assembly2.cif.gz_D | crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii | 0.9008 | 4 | 274 |
| 7ovg-assembly1.cif.gz_B | the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide | 0.8859 | 3 | 274 |
| 6i00-assembly1.cif.gz_J | cryo-em informed directed evolution of nitrilase 4 leads to a change in quaternary structure. | 0.8833 | 4 | 307 |
| 6i00-assembly1.cif.gz_J | cryo-em informed directed evolution of nitrilase 4 leads to a change in quaternary structure. | 0.8747 | 4 | 307 |
| 3wuy-assembly1.cif.gz_A | crystal structure of nit6803 | 0.8712 | 3 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P40447_2_198_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9324 | 6 | 193 | 3.60.110.10 |
| af_P32961_18_309_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9192 | 2 | 280 | 3.60.110.10 |
| af_Q23384_2_280_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9014 | 5 | 280 | 3.60.110.10 |
| 1j31B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.898 | 5 | 274 | 3.60.110.10 |
| af_Q23384_2_280_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.8891 | 5 | 280 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7K712-F1-model_v4 | deleted | 0.9476 | 4 | 209 |
|
| AF-A0A2R7S9V7-F1-model_v4 | deleted | 0.9457 | 4 | 141 |
|
| AF-A0A434NWG8-F1-model_v4 | Nitrilase | 0.9337 | 6 | 216 |
GO:0000257
|
| AF-B8LLF1-F1-model_v4 | cyanoalanine nitrilase (EC 3.5.5.4) | 0.9312 | 6 | 136 |
GO:0018822
GO:0047427 GO:0051410 |
| AF-A0A1I7T015-F1-model_v4 | CN hydrolase domain-containing protein | 0.923 | 6 | 204 |
GO:0000257
GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar