F467000

General Info

Members Datasets Scaffolds Average Seq Length
590 296 590 160

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_1056487|Ga0496115_1056487_27_593
Length 188
Sequence MSADATTCTLLMQLAAWTPYSILERDMSSNMAGGVPDPNAQGDNGPTLSLQNVYLKDCSYEAPNGPRVDGNWNPQINLDLHTAATGVAPEMTEVVLTVTVAAKQNDATIFLVEVKQAGVFLIRGLNEADTKRAVASLCPSVLFPYARAAVSHLVTQGGFPQFLLPPVNFDALYAQNVAQQQAAPATTN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
276 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
288 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
289 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 4.92
Rhizosphere 83.73
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002943 3300003203 Bacteria 8030
2 rootH2_10119640 3300003320 Unclassified 2025
3 JGI25405J52794_10034364 3300003911 Bacteria 1060
4 Ga0058861_11703000 3300004800 Bacteria 1098
5 Ga0058862_12292822 3300004803 Bacteria 937
6 Ga0070683_100025169 3300005329 Bacteria 5341
7 Ga0070683_101484541 3300005329 Bacteria 652
8 Ga0070683_102021182 3300005329 Bacteria 554
9 Ga0070690_100045342 3300005330 Bacteria 2792
10 Ga0070690_100323543 3300005330 Bacteria 1112
11 Ga0068869_100560527 3300005334 Bacteria 961
12 Ga0068869_100717076 3300005334 Bacteria 854
13 Ga0070666_10003267 3300005335 Bacteria 9844
14 Ga0070666_10053482 3300005335 Bacteria 2723
15 Ga0070666_10160004 3300005335 Bacteria 1574
16 Ga0070680_100020097 3300005336 Bacteria 5296
17 Ga0070680_100037741 3300005336 Bacteria 3905
18 Ga0070680_100221000 3300005336 Bacteria 1599
19 Ga0070680_101433492 3300005336 Unclassified 598
20 Ga0068868_100505227 3300005338 Bacteria 1059
21 Ga0068868_101166395 3300005338 Unclassified 711
22 Ga0070691_10365462 3300005341 Bacteria 805
23 Ga0070691_10414016 3300005341 Bacteria 762
24 Ga0070687_100299167 3300005343 Unclassified 1020
25 Ga0070668_100758711 3300005347 Unclassified 859
26 Ga0070671_100022423 3300005355 Bacteria 5156
27 Ga0070671_100023210 3300005355 Bacteria 5074
28 Ga0070671_100096811 3300005355 Bacteria 2475
29 Ga0070674_100265904 3300005356 Bacteria 1353
30 Ga0070673_100076382 3300005364 Bacteria 2705
31 Ga0070667_100041662 3300005367 Bacteria 3852
32 Ga0070667_100055355 3300005367 Bacteria 3350
33 Ga0070667_100058291 3300005367 Bacteria 3265
34 Ga0070667_100332338 3300005367 Bacteria 1373
35 Ga0070667_100369988 3300005367 Bacteria 1300
36 Ga0070709_10212867 3300005434 Bacteria 1375
37 Ga0070714_100005029 3300005435 Bacteria 10051
38 Ga0070714_100309261 3300005435 Bacteria 1475
39 Ga0070714_101189174 3300005435 Unclassified 744
40 Ga0070713_100002285 3300005436 Bacteria 12459
41 Ga0070713_100008164 3300005436 Bacteria 7413
42 Ga0070713_100025923 3300005436 Bacteria 4593
43 Ga0070713_100296672 3300005436 Bacteria 1487
44 Ga0070710_10012175 3300005437 Bacteria 4264
45 Ga0070710_10419495 3300005437 Bacteria 901
46 Ga0070711_100033398 3300005439 Bacteria 3426
47 Ga0070711_100057685 3300005439 Bacteria 2690
48 Ga0070711_100241034 3300005439 Bacteria 1414
49 Ga0070663_100050669 3300005455 Bacteria 2954
50 Ga0070678_100010462 3300005456 Bacteria 5671
51 Ga0070681_10000863 3300005458 Bacteria 25500
52 Ga0070681_10005285 3300005458 Bacteria 12467
53 Ga0070681_10005684 3300005458 Bacteria 12052
54 Ga0070681_10006459 3300005458 Bacteria 11410
55 Ga0070681_10028021 3300005458 Bacteria 5662
56 Ga0070681_10069030 3300005458 Bacteria 3501
57 Ga0070681_10089609 3300005458 Bacteria 3027
58 Ga0070681_10454665 3300005458 Bacteria 1193
59 Ga0070706_101144109 3300005467 Bacteria 716
60 Ga0070699_100851211 3300005518 Bacteria 835
61 Ga0070679_100006602 3300005530 Bacteria 10811
62 Ga0070679_100010385 3300005530 Bacteria 8831
63 Ga0070679_100080444 3300005530 Bacteria 3248
64 Ga0070679_100110487 3300005530 Bacteria 2735
65 Ga0070679_100164013 3300005530 Bacteria 2196
66 Ga0070679_100316992 3300005530 Bacteria 1509
67 Ga0070684_100112949 3300005535 Bacteria 2437
68 Ga0070684_100810187 3300005535 Bacteria 876
69 Ga0068853_100108267 3300005539 Bacteria 2465
70 Ga0068853_101177083 3300005539 Bacteria 740
71 Ga0070686_100018554 3300005544 Unclassified 4087
72 Ga0070686_100841140 3300005544 Bacteria 743
73 Ga0070695_100466886 3300005545 Bacteria 970
74 Ga0070693_100096556 3300005547 Bacteria 1792
75 Ga0070665_100008413 3300005548 Bacteria 10438
76 Ga0070665_100010853 3300005548 Bacteria 9213
77 Ga0070665_100017428 3300005548 Bacteria 7211
78 Ga0070665_100056861 3300005548 Bacteria 3923
79 Ga0070665_100134506 3300005548 Bacteria 2474
80 Ga0070704_100708688 3300005549 Bacteria 893
81 Ga0068855_100004720 3300005563 Bacteria 16645
82 Ga0068855_100013913 3300005563 Bacteria 9703
83 Ga0068855_101675569 3300005563 Bacteria 649
84 Ga0070664_100125155 3300005564 Bacteria 2254
85 Ga0070664_100828109 3300005564 Bacteria 866
86 Ga0068854_100100256 3300005578 Bacteria 2170
87 Ga0068854_100272104 3300005578 Bacteria 1360
88 Ga0068856_100037883 3300005614 Bacteria 4732
89 Ga0068856_100044167 3300005614 Bacteria 4384
90 Ga0068856_100784847 3300005614 Bacteria 972
91 Ga0068856_101560933 3300005614 Bacteria 674
92 Ga0070702_100508285 3300005615 Bacteria 886
93 Ga0068852_102269672 3300005616 Unclassified 564
94 Ga0068859_100000376 3300005617 Bacteria 44472
95 Ga0068864_100195910 3300005618 Bacteria 1854
96 Ga0068866_10007786 3300005718 Bacteria 4495
97 Ga0068861_100045156 3300005719 Bacteria 3316
98 Ga0068861_100718347 3300005719 Bacteria 930
99 Ga0068861_101173753 3300005719 Unclassified 741
100 Ga0068861_101426739 3300005719 Bacteria 677
101 Ga0068851_10066014 3300005834 Bacteria 1864
102 Ga0068863_100003148 3300005841 Bacteria 16289
103 Ga0068863_100006529 3300005841 Bacteria 11444
104 Ga0068863_100052991 3300005841 Bacteria 3844
105 Ga0068863_101051510 3300005841 Bacteria 818
106 Ga0068858_100002387 3300005842 Bacteria 18997
107 Ga0068858_100050576 3300005842 Bacteria 3846
108 Ga0068858_100272080 3300005842 Bacteria 1612
109 Ga0068858_100909719 3300005842 Bacteria 860
110 Ga0068858_100994246 3300005842 Unclassified 822
111 Ga0068860_100003079 3300005843 Bacteria 17243
112 Ga0068860_100020608 3300005843 Bacteria 6387
113 Ga0068860_100030656 3300005843 Bacteria 5172
114 Ga0068862_100008883 3300005844 Bacteria 8321
115 Ga0068862_100211468 3300005844 Bacteria 1753
116 Ga0068862_100315755 3300005844 Bacteria 1441
117 Ga0068862_100455869 3300005844 Unclassified 1206
118 Ga0081455_10002817 3300005937 Bacteria 20479
119 Ga0081455_10289442 3300005937 Bacteria 1180
120 Ga0081539_10000007 3300005985 Bacteria 532790
121 Ga0081539_10255625 3300005985 Bacteria 776
122 Ga0070717_10004864 3300006028 Bacteria 9770
123 Ga0070715_10000363 3300006163 Bacteria 11345
124 Ga0070716_100016141 3300006173 Bacteria 3850
125 Ga0070716_100390004 3300006173 Bacteria 998
126 Ga0070712_100893926 3300006175 Bacteria 765
127 Ga0097621_100005189 3300006237 Bacteria 9153
128 Ga0097621_100038041 3300006237 Bacteria 3860
129 Ga0097621_100160611 3300006237 Bacteria 1932
130 Ga0068871_100090361 3300006358 Bacteria 2550
131 Ga0068871_100158496 3300006358 Bacteria 1934
132 Ga0068871_100290077 3300006358 Unclassified 1433
133 Ga0068865_100005789 3300006881 Bacteria 7512
134 Ga0068865_100355428 3300006881 Bacteria 1188
135 Ga0075436_100010985 3300006914 Bacteria 6217
136 Ga0075436_100064201 3300006914 Bacteria 2538
137 Ga0075436_101021081 3300006914 Bacteria 621
138 Ga0097620_100000376 3300006931 Bacteria 44472
139 Ga0075435_100080916 3300007076 Bacteria 2668
140 Ga0105250_10014882 3300009092 Bacteria 3190
141 Ga0105240_10005493 3300009093 Bacteria 18892
142 Ga0105240_10005499 3300009093 Bacteria 18881
143 Ga0105240_10005908 3300009093 Bacteria 18129
144 Ga0105240_10014001 3300009093 Bacteria 10975
145 Ga0105240_10036965 3300009093 Bacteria 6276
146 Ga0105240_10051789 3300009093 Bacteria 5164
147 Ga0105240_10090514 3300009093 Bacteria 3739
148 Ga0105240_10159918 3300009093 Bacteria 2676
149 Ga0105240_10238500 3300009093 Bacteria 2109
150 Ga0105240_10550225 3300009093 Unclassified 1277
151 Ga0105240_10950564 3300009093 Bacteria 922
152 Ga0105245_10079403 3300009098 Bacteria 2996
153 Ga0105245_10909409 3300009098 Unclassified 922
154 Ga0105247_10000119 3300009101 Bacteria 76975
155 Ga0105247_10010643 3300009101 Bacteria 5554
156 Ga0105247_10046620 3300009101 Bacteria 2661
157 Ga0105247_10582949 3300009101 Bacteria 827
158 Ga0105241_10004061 3300009174 Bacteria 10829
159 Ga0105241_10123009 3300009174 Bacteria 2092
160 Ga0105242_10050722 3300009176 Bacteria 3379
161 Ga0105248_10007074 3300009177 Bacteria 12292
162 Ga0105248_10007241 3300009177 Bacteria 12169
163 Ga0105248_10261416 3300009177 Bacteria 1948
164 Ga0105237_10017179 3300009545 Bacteria 7505
165 Ga0105237_10017590 3300009545 Bacteria 7409
166 Ga0105237_10151235 3300009545 Bacteria 2318
167 Ga0105237_10190530 3300009545 Bacteria 2051
168 Ga0105237_10405733 3300009545 Unclassified 1368
169 Ga0105237_10565707 3300009545 Bacteria 1143
170 Ga0105238_10011533 3300009551 Bacteria 8903
171 Ga0105238_10085369 3300009551 Bacteria 3144
172 Ga0105238_10156924 3300009551 Bacteria 2251
173 Ga0105238_10202708 3300009551 Bacteria 1960
174 Ga0105238_10277311 3300009551 Bacteria 1657
175 Ga0105249_10076319 3300009553 Bacteria 3106
176 Ga0105249_10165086 3300009553 Bacteria 2143
177 Ga0105249_10829723 3300009553 Bacteria 989
178 Ga0105239_10014313 3300010375 Bacteria 8800
179 Ga0105239_10049357 3300010375 Bacteria 4615
180 Ga0105246_10227695 3300011119 Bacteria 1466
181 Ga0157324_1029359 3300012506 Unclassified 613
182 Ga0157370_10002010 3300013104 Bacteria 25009
183 Ga0157370_10346606 3300013104 Bacteria 1369
184 Ga0157370_10669945 3300013104 Unclassified 948
185 Ga0157369_10018790 3300013105 Bacteria 7747
186 Ga0157369_10041796 3300013105 Bacteria 5003
187 Ga0157369_10591166 3300013105 Bacteria 1146
188 Ga0157374_10040089 3300013296 Bacteria 4312
189 Ga0157374_10146713 3300013296 Bacteria 2292
190 Ga0157374_10266580 3300013296 Bacteria 1688
191 Ga0157374_10465856 3300013296 Bacteria 1266
192 Ga0157374_10814677 3300013296 Bacteria 950
193 Ga0157378_10005124 3300013297 Bacteria 11505
194 Ga0163162_10013023 3300013306 Bacteria 8118
195 Ga0163162_10044693 3300013306 Bacteria 4437
196 Ga0163162_10676262 3300013306 Unclassified 1155
197 Ga0157372_10064040 3300013307 Unclassified 4124
198 Ga0157372_10721281 3300013307 Bacteria 1160
199 Ga0157372_11370992 3300013307 Bacteria 815
200 Ga0157372_12461970 3300013307 Unclassified 598
201 Ga0157375_10116984 3300013308 Bacteria 2771
202 Ga0163163_10050681 3300014325 Bacteria 4089
203 Ga0163163_10114622 3300014325 Bacteria 2726
204 Ga0163163_10142415 3300014325 Bacteria 2440
205 Ga0163163_10173106 3300014325 Bacteria 2205
206 Ga0163163_10236959 3300014325 Bacteria 1874
207 Ga0163163_10248503 3300014325 Unclassified 1829
208 Ga0163163_11161468 3300014325 Bacteria 835
209 Ga0163163_11214019 3300014325 Bacteria 817
210 Ga0157379_10034448 3300014968 Bacteria 4515
211 Ga0157379_10035519 3300014968 Bacteria 4444
212 Ga0157379_10068194 3300014968 Bacteria 3180
213 Ga0157379_10151189 3300014968 Bacteria 2094
214 Ga0157379_10277414 3300014968 Unclassified 1525
215 Ga0157379_11009451 3300014968 Bacteria 794
216 Ga0157376_10530034 3300014969 Bacteria 1162
217 Ga0206354_11374159 3300020081 Bacteria 1470
218 Ga0213874_10006886 3300021377 Bacteria 2708
219 Ga0213874_10309042 3300021377 Bacteria 597
220 Ga0213876_10086919 3300021384 Bacteria 1655
221 Ga0213876_10197013 3300021384 Bacteria 1071
222 Ga0213871_10007505 3300021441 Bacteria 2362
223 Ga0207692_10009583 3300025898 Bacteria 4052
224 Ga0207642_10005903 3300025899 Bacteria 4033
225 Ga0207710_10000584 3300025900 Bacteria 21566
226 Ga0207680_10037800 3300025903 Bacteria 2789
227 Ga0207680_10050083 3300025903 Bacteria 2490
228 Ga0207680_10348345 3300025903 Bacteria 1040
229 Ga0207685_10369804 3300025905 Bacteria 728
230 Ga0207699_10008992 3300025906 Bacteria 4952
231 Ga0207699_10013413 3300025906 Bacteria 4194
232 Ga0207654_10454413 3300025911 Bacteria 899
233 Ga0207707_10000213 3300025912 Bacteria 61986
234 Ga0207707_10004427 3300025912 Bacteria 12380
235 Ga0207707_10006819 3300025912 Bacteria 9964
236 Ga0207707_10007539 3300025912 Bacteria 9478
237 Ga0207707_10097836 3300025912 Bacteria 2565
238 Ga0207707_10193275 3300025912 Bacteria 1775
239 Ga0207707_10200402 3300025912 Bacteria 1740
240 Ga0207695_10007808 3300025913 Bacteria 13542
241 Ga0207695_10066718 3300025913 Unclassified 3694
242 Ga0207695_10067744 3300025913 Bacteria 3660
243 Ga0207695_10075075 3300025913 Bacteria 3440
244 Ga0207695_10117921 3300025913 Bacteria 2626
245 Ga0207695_10268109 3300025913 Bacteria 1604
246 Ga0207695_10289529 3300025913 Bacteria 1530
247 Ga0207695_10306800 3300025913 Bacteria 1478
248 Ga0207695_10322465 3300025913 Unclassified 1434
249 Ga0207695_10672730 3300025913 Bacteria 916
250 Ga0207671_10043684 3300025914 Bacteria 3314
251 Ga0207671_10058800 3300025914 Viruses 2850
252 Ga0207693_10002400 3300025915 Bacteria 16262
253 Ga0207663_10048884 3300025916 Bacteria 2620
254 Ga0207663_10082779 3300025916 Bacteria 2106
255 Ga0207660_10058589 3300025917 Bacteria 2762
256 Ga0207660_10087119 3300025917 Bacteria 2307
257 Ga0207660_10148542 3300025917 Bacteria 1799
258 Ga0207660_10152080 3300025917 Bacteria 1779
259 Ga0207660_10219827 3300025917 Bacteria 1490
260 Ga0207660_10237952 3300025917 Bacteria 1434
261 Ga0207652_10001434 3300025921 Bacteria 21125
262 Ga0207652_10006797 3300025921 Bacteria 9220
263 Ga0207652_10076517 3300025921 Bacteria 2919
264 Ga0207652_10100506 3300025921 Bacteria 2553
265 Ga0207652_10315327 3300025921 Bacteria 1411
266 Ga0207652_10767439 3300025921 Bacteria 857
267 Ga0207694_10006364 3300025924 Bacteria 9005
268 Ga0207694_10013501 3300025924 Bacteria 6153
269 Ga0207694_10392284 3300025924 Bacteria 1153
270 Ga0207694_10502721 3300025924 Unclassified 1015
271 Ga0207694_10640594 3300025924 Bacteria 895
272 Ga0207650_10548314 3300025925 Bacteria 969
273 Ga0207700_10049869 3300025928 Bacteria 3116
274 Ga0207700_10113895 3300025928 Bacteria 2181
275 Ga0207700_10148296 3300025928 Bacteria 1936
276 Ga0207700_10515559 3300025928 Bacteria 1059
277 Ga0207664_10281246 3300025929 Bacteria 1460
278 Ga0207644_10012392 3300025931 Bacteria 5662
279 Ga0207644_10267570 3300025931 Unclassified 1368
280 Ga0207644_10382807 3300025931 Bacteria 1147
281 Ga0207686_10143391 3300025934 Bacteria 1654
282 Ga0207686_10342104 3300025934 Bacteria 1124
283 Ga0207669_10273562 3300025937 Bacteria 1270
284 Ga0207704_10239663 3300025938 Bacteria 1354
285 Ga0207704_11049825 3300025938 Unclassified 691
286 Ga0207665_10003249 3300025939 Bacteria 10881
287 Ga0207665_10336404 3300025939 Bacteria 1136
288 Ga0207691_10282536 3300025940 Bacteria 1428
289 Ga0207711_10059125 3300025941 Bacteria 3300
290 Ga0207711_10237575 3300025941 Bacteria 1670
291 Ga0207661_10235066 3300025944 Bacteria 1624
292 Ga0207679_11102387 3300025945 Bacteria 728
293 Ga0207667_10003935 3300025949 Bacteria 18274
294 Ga0207667_10046714 3300025949 Bacteria 4585
295 Ga0207667_10080827 3300025949 Unclassified 3367
296 Ga0207651_10083362 3300025960 Bacteria 2312
297 Ga0207712_10045757 3300025961 Unclassified 3032
298 Ga0207712_10079635 3300025961 Bacteria 2380
299 Ga0207712_10106949 3300025961 Bacteria 2091
300 Ga0207712_10709712 3300025961 Bacteria 878
301 Ga0207640_10084686 3300025981 Bacteria 2178
302 Ga0207640_11499474 3300025981 Bacteria 606
303 Ga0207658_10009211 3300025986 Bacteria 6693
304 Ga0207658_10023297 3300025986 Bacteria 4321
305 Ga0207658_10908864 3300025986 Unclassified 802
306 Ga0207677_11879485 3300026023 Bacteria 556
307 Ga0207703_10001857 3300026035 Bacteria 18781
308 Ga0207703_10013445 3300026035 Bacteria 6375
309 Ga0207703_10075043 3300026035 Bacteria 2801
310 Ga0207703_10404235 3300026035 Bacteria 1268
311 Ga0207703_10704980 3300026035 Unclassified 960
312 Ga0207639_11196655 3300026041 Bacteria 713
313 Ga0207678_10010959 3300026067 Bacteria 7967
314 Ga0207702_10027808 3300026078 Bacteria 4698
315 Ga0207702_10052499 3300026078 Bacteria 3449
316 Ga0207702_10217347 3300026078 Bacteria 1780
317 Ga0207702_10714155 3300026078 Bacteria 988
318 Ga0207641_10002848 3300026088 Bacteria 15721
319 Ga0207641_10025361 3300026088 Bacteria 4888
320 Ga0207641_10246015 3300026088 Bacteria 1668
321 Ga0207676_10835823 3300026095 Bacteria 900
322 Ga0207675_100079258 3300026118 Bacteria 3077
323 Ga0207675_100567168 3300026118 Bacteria 1136
324 Ga0207675_101056992 3300026118 Unclassified 831
325 Ga0207675_102389458 3300026118 Unclassified 541
326 Ga0207683_10001886 3300026121 Bacteria 18558
327 Ga0207698_10230176 3300026142 Bacteria 1682
328 Ga0207698_11508036 3300026142 Unclassified 688
329 Ga0268266_10000926 3300028379 Bacteria 37537
330 Ga0268266_10017254 3300028379 Bacteria 6164
331 Ga0268266_10034382 3300028379 Bacteria 4311
332 Ga0268266_10063145 3300028379 Bacteria 3197
333 Ga0268266_10076380 3300028379 Unclassified 2911
334 Ga0268266_10170621 3300028379 Bacteria 1974
335 Ga0268265_10012800 3300028380 Bacteria 5696
336 Ga0268265_10346400 3300028380 Bacteria 1355
337 Ga0268265_10439022 3300028380 Unclassified 1216
338 Ga0268265_10724782 3300028380 Bacteria 963
339 Ga0268264_10000308 3300028381 Bacteria 78708
340 Ga0268264_10018548 3300028381 Bacteria 5690
341 Ga0265334_10015305 3300028573 Bacteria 3188
342 Ga0307517_10447696 3300028786 Bacteria 670
343 Ga0307515_10049570 3300028794 Bacteria 6312
344 Ga0307511_10000793 3300030521 Bacteria 33672
345 Ga0265339_10050493 3300031249 Bacteria 2274
346 Ga0307513_10161627 3300031456 Bacteria 2131
347 Ga0307513_10605137 3300031456 Bacteria 805
348 Ga0307509_10000008 3300031507 Bacteria 354271
349 Ga0307509_10269132 3300031507 Bacteria 1473
350 Ga0307509_10315944 3300031507 Bacteria 1302
351 Ga0307408_100150990 3300031548 Bacteria 1834
352 Ga0307405_10817946 3300031731 Bacteria 782
353 Ga0307406_10294092 3300031901 Bacteria 1245
354 Ga0307407_10783032 3300031903 Unclassified 724
355 Ga0307412_10065605 3300031911 Bacteria 2458
356 Ga0307409_100069221 3300031995 Bacteria 2795
357 Ga0307411_10534028 3300032005 Bacteria 998
358 Ga0307415_101944020 3300032126 Bacteria 572
359 Ga0307510_10000004 3300033180 Bacteria 654130
360 Ga0373926_0354080 3300035083 Bacteria 577
361 Ga0373957_0039504 3300035120 Bacteria 1770
362 Ga0373943_0020088 3300035170 Bacteria 3077
363 Ga0373955_0111296 3300035172 Bacteria 1583
364 Ga0373935_0117191 3300035692 Bacteria 1775
365 Ga0373947_0015434 3300035725 Bacteria 4385
366 Ga0373937_0279663 3300036401 Unclassified 1576
367 Ga0373937_0859630 3300036401 Bacteria 855
368 Ga0373925_0128033 3300037068 Bacteria 1977
369 Ga0395900_0475763 3300037418 Bacteria 1202
370 Ga0395898_0004801 3300037466 Bacteria 14712
371 Ga0395898_0413210 3300037466 Bacteria 1286
372 Ga0436364_0530634 3300037853 Bacteria 1002
373 Ga0436365_0375377 3300039437 Bacteria 11163
374 Ga0436365_0885394 3300039437 Unclassified 1625
375 Ga0436365_1342030 3300039437 Bacteria 983
376 Ga0436365_1796110 3300039437 Bacteria 3553
377 Ga0436360_0346195 3300039438 Bacteria 2056
378 Ga0436360_0419016 3300039438 Bacteria 3607
379 Ga0436361_0169415 3300039447 Bacteria 626
380 Ga0436361_0544715 3300039447 Bacteria 798
381 Ga0436363_0122190 3300039450 Bacteria 1576
382 Ga0436363_0475575 3300039450 Bacteria 6155
383 Ga0436363_1137318 3300039450 Bacteria 1922
384 Ga0436362_0605076 3300039453 Bacteria 836
385 Ga0436362_0778749 3300039453 Bacteria 2412
386 Ga0436362_0826555 3300039453 Bacteria 2069
387 Ga0436362_0933727 3300039453 Bacteria 1089
388 Ga0436362_1184014 3300039453 Bacteria 3757
389 Ga0439453_0031784 3300041408 Bacteria 1003
390 Ga0451797_1164725 3300041453 Bacteria 1386
391 Ga0451800_1574258 3300041459 Unclassified 532
392 Ga0451807_1232526 3300041486 Unclassified 688
393 Ga0451837_1645436 3300041494 Unclassified 751
394 Ga0439435_0021281 3300042436 Bacteria 1682
395 Ga0466969_0000245 3300044656 Bacteria 29788
396 Ga0466969_0039150 3300044656 Bacteria 2382
397 Ga0466969_0061163 3300044656 Bacteria 1830
398 Ga0466969_0100870 3300044656 Bacteria 1359
399 Ga0466972_0027888 3300044658 Bacteria 2791
400 Ga0466972_0049994 3300044658 Bacteria 2019
401 Ga0466966_0002009 3300044684 Bacteria 13206
402 Ga0466966_0125007 3300044684 Bacteria 1578
403 Ga0466966_0155606 3300044684 Bacteria 1393
404 Ga0466966_0352001 3300044684 Bacteria 885
405 Ga0466961_0001203 3300044693 Bacteria 15940
406 Ga0466964_0000188 3300044706 Bacteria 17072
407 Ga0453684_1049421 3300044712 Bacteria 864
408 Ga0466971_0000534 3300044719 Bacteria 15058
409 Ga0466968_0284202 3300044735 Bacteria 792
410 Ga0466970_0002030 3300044765 Bacteria 9800
411 Ga0466957_0003911 3300044842 Bacteria 8239
412 Ga0466959_0000706 3300045049 Bacteria 19525
413 Ga0466959_0003041 3300045049 Bacteria 10848
414 Ga0466959_0010227 3300045049 Bacteria 6700
415 Ga0466959_0030139 3300045049 Bacteria 4018
416 Ga0466959_0811169 3300045049 Bacteria 625
417 Ga0451576_0356502 3300045051 Unclassified 1531
418 Ga0451576_1135409 3300045051 Bacteria 817
419 Ga0466958_0088068 3300045836 Bacteria 1918
420 Ga0466958_0277212 3300045836 Unclassified 1074
421 Ga0466967_1319199 3300045976 Bacteria 719
422 Ga0495603_0195677 3300046455 Bacteria 1169
423 Ga0495590_0208898 3300046457 Unclassified 719
424 Ga0495591_029904 3300046458 Bacteria 1650
425 Ga0495629_0294120 3300046459 Bacteria 1113
426 Ga0495629_0382110 3300046459 Bacteria 958
427 Ga0495638_0300446 3300046460 Bacteria 865
428 Ga0495580_0021479 3300046472 Bacteria 4762
429 Ga0495582_0118594 3300046473 Bacteria 1490
430 Ga0495639_0174106 3300046475 Bacteria 1046
431 Ga0495606_0061073 3300046507 Bacteria 2412
432 Ga0495606_0494508 3300046507 Unclassified 619
433 Ga0495630_0183445 3300046517 Bacteria 1596
434 Ga0495632_0099969 3300046519 Bacteria 1367
435 Ga0495632_0162963 3300046519 Bacteria 1026
436 Ga0495644_0014518 3300046523 Bacteria 3017
437 Ga0495666_0239774 3300046526 Bacteria 828
438 Ga0495642_0156200 3300046528 Bacteria 988
439 Ga0495586_0160474 3300046535 Bacteria 1268
440 Ga0495586_0294992 3300046535 Unclassified 929
441 Ga0495621_0000091 3300046539 Bacteria 18251
442 Ga0495597_0080012 3300046542 Bacteria 1399
443 Ga0495645_0388157 3300046543 Bacteria 892
444 Ga0495622_0178568 3300046557 Bacteria 953
445 Ga0495668_0735085 3300046616 Unclassified 546
446 Ga0495625_0076177 3300046660 Bacteria 2346
447 Ga0495647_0005576 3300046681 Bacteria 4131
448 Ga0495647_0091182 3300046681 Bacteria 1250
449 Ga0495658_0118811 3300046683 Bacteria 1597
450 Ga0495658_0184425 3300046683 Bacteria 1295
451 Ga0495671_0009176 3300046692 Bacteria 5534
452 Ga0495674_0138144 3300047319 Bacteria 2050
453 Ga0495683_0294930 3300047323 Bacteria 698
454 Ga0495687_017826 3300047443 Bacteria 3527
455 Ga0495687_032862 3300047443 Bacteria 2362
456 Ga0495681_0016395 3300047470 Bacteria 4155
457 Ga0496100_0059578 3300048903 Bacteria 2509
458 Ga0496100_0166261 3300048903 Bacteria 1585
459 Ga0496101_0123071 3300048904 Bacteria 1963
460 Ga0496101_0229814 3300048904 Bacteria 1441
461 Ga0496102_0008566 3300048905 Bacteria 8772
462 Ga0496102_0148863 3300048905 Bacteria 2198
463 Ga0496102_0248973 3300048905 Bacteria 1675
464 Ga0496103_0049426 3300048906 Bacteria 2600
465 Ga0496103_0063295 3300048906 Bacteria 2304
466 Ga0496104_0075089 3300048907 Bacteria 3219
467 Ga0496104_0242029 3300048907 Bacteria 1716
468 Ga0496105_0191388 3300048908 Bacteria 1672
469 Ga0496106_0055434 3300048909 Bacteria 2996
470 Ga0496106_0217635 3300048909 Bacteria 1522
471 Ga0496107_0038151 3300048910 Bacteria 3447
472 Ga0496108_0004541 3300048911 Bacteria 11179
473 Ga0496108_0067997 3300048911 Bacteria 3005
474 Ga0496109_0036912 3300048912 Bacteria 4413
475 Ga0496109_0353058 3300048912 Bacteria 1389
476 Ga0496110_0013721 3300048913 Bacteria 6712
477 Ga0496111_0022901 3300048914 Bacteria 4379
478 Ga0496112_0055308 3300048915 Bacteria 3902
479 Ga0496112_0318261 3300048915 Bacteria 1500
480 Ga0496113_0107284 3300048916 Bacteria 2170
481 Ga0496115_0050011 3300048918 Bacteria 3347
482 Ga0496115_1056487 3300048918 Bacteria 618
483 Ga0496116_0022031 3300048919 Bacteria 4791
484 Ga0496117_0000189 3300048920 Bacteria 126216
485 Ga0496118_0000111 3300048921 Bacteria 152562
486 Ga0496118_0134680 3300048921 Bacteria 1579
487 Ga0496119_0001233 3300048922 Bacteria 31872
488 Ga0496119_0010407 3300048922 Bacteria 7833
489 Ga0496119_0020667 3300048922 Bacteria 4790
490 Ga0496120_0000025 3300048923 Bacteria 235805
491 Ga0496120_0025102 3300048923 Bacteria 3703
492 Ga0496120_0050239 3300048923 Bacteria 2388
493 Ga0496121_0001977 3300048924 Bacteria 32562
494 Ga0496125_0001162 3300048928 Bacteria 39894
495 Ga0496125_0006098 3300048928 Bacteria 13159
496 Ga0496125_0062432 3300048928 Bacteria 2979
497 Ga0496126_0000545 3300048929 Bacteria 72745
498 Ga0496126_0012241 3300048929 Bacteria 8800
499 Ga0496126_0098554 3300048929 Bacteria 2561
500 Ga0496126_0112064 3300048929 Bacteria 2376
501 Ga0496126_0486570 3300048929 Unclassified 988
502 Ga0501031_0102608 3300049568 Bacteria 1866
503 Ga0501031_0259487 3300049568 Bacteria 1129
504 Ga0501032_0158037 3300049569 Bacteria 1489
505 Ga0501033_0047574 3300049570 Bacteria 3189
506 Ga0501033_0223856 3300049570 Bacteria 1338
507 Ga0501036_0014258 3300049572 Bacteria 6614
508 Ga0501037_0100608 3300049573 Bacteria 2087
509 Ga0501038_0006611 3300049574 Bacteria 10726
510 Ga0501038_0148756 3300049574 Bacteria 1910
511 Ga0501039_0009656 3300049575 Bacteria 7356
512 Ga0501039_0089946 3300049575 Bacteria 2392
513 Ga0501040_0000602 3300049576 Bacteria 21944
514 Ga0501040_0020838 3300049576 Bacteria 4371
515 Ga0501041_0031439 3300049577 Bacteria 3207
516 Ga0501041_0199985 3300049577 Bacteria 1252
517 Ga0501042_0006737 3300049578 Bacteria 7488
518 Ga0501042_0032301 3300049578 Bacteria 3706
519 Ga0501043_0125209 3300049579 Bacteria 2015
520 Ga0501043_0918610 3300049579 Unclassified 627
521 Ga0501046_0026264 3300049580 Bacteria 4755
522 Ga0501046_0028966 3300049580 Bacteria 4506
523 Ga0501048_0020464 3300049582 Bacteria 4849
524 Ga0501048_0040418 3300049582 Bacteria 3342
525 Ga0501068_0016459 3300049584 Bacteria 4263
526 Ga0501068_0208195 3300049584 Bacteria 1241
527 Ga0501069_0248358 3300049585 Bacteria 1038
528 Ga0501070_0889599 3300049586 Unclassified 695
529 Ga0501071_0004207 3300049587 Bacteria 9111
530 Ga0501071_0018289 3300049587 Bacteria 4850
531 Ga0501072_0002188 3300049588 Bacteria 14605
532 Ga0501072_0005867 3300049588 Bacteria 9353
533 Ga0501073_0064965 3300049589 Bacteria 2545
534 Ga0501074_0016923 3300049590 Bacteria 5290
535 Ga0501074_0041022 3300049590 Bacteria 3351
536 Ga0501075_0008811 3300049591 Bacteria 7032
537 Ga0501075_0060771 3300049591 Bacteria 2846
538 Ga0501076_0001300 3300049592 Bacteria 16672
539 Ga0501076_0338525 3300049592 Bacteria 1234
540 Ga0501077_0000947 3300049593 Bacteria 17478
541 Ga0501079_0000487 3300049741 Bacteria 26110
542 Ga0501079_0006973 3300049741 Bacteria 8516
543 Ga0501079_0935787 3300049741 Bacteria 682
544 Ga0501080_0002859 3300049742 Bacteria 15180
545 Ga0501081_0000652 3300049743 Bacteria 19843
546 Ga0501081_0062061 3300049743 Bacteria 2591
547 Ga0501083_0043399 3300049744 Bacteria 3047
548 Ga0501083_0187986 3300049744 Bacteria 1348
549 Ga0501035_0007719 3300049822 Bacteria 10049
550 Ga0501035_0060634 3300049822 Bacteria 3368
551 Ga0501044_0656943 3300049823 Bacteria 937
552 Ga0501045_0001321 3300049824 Bacteria 16460
553 Ga0501045_0015814 3300049824 Bacteria 5351
554 nmdc:mga08x19_798372_c1 3300050514 Bacteria 670
555 Ga0495601_0188253 3300053077 Bacteria 1349
556 Ga0500644_0116172 3300053088 Bacteria 1037
557 Ga0500583_0013741 3300053092 Bacteria 3143
558 Ga0500641_0034442 3300053096 Bacteria 2016
559 Ga0500641_0159913 3300053096 Bacteria 971
560 Ga0500556_0000260 3300053104 Bacteria 42121
561 Ga0500556_0071245 3300053104 Bacteria 1298
562 Ga0500556_0116080 3300053104 Bacteria 1041
563 Ga0500572_159242 3300053111 Bacteria 739
564 Ga0500591_024205 3300053115 Bacteria 2948
565 Ga0500595_010853 3300053119 Bacteria 3597
566 Ga0500617_053167 3300053124 Bacteria 1804
567 Ga0500642_0183027 3300053130 Bacteria 979
568 Ga0500642_0439715 3300053130 Bacteria 562
569 Ga0500652_060627 3300053131 Bacteria 1557
570 Ga0500658_0067067 3300053134 Bacteria 1506
571 Ga0500658_0361366 3300053134 Bacteria 666
572 Ga0500559_0432771 3300053136 Unclassified 610
573 Ga0500579_183962 3300053143 Bacteria 815
574 Ga0500588_0002216 3300053146 Bacteria 3901
575 Ga0500616_0000074 3300053153 Bacteria 222910
576 Ga0500627_0217696 3300053158 Bacteria 853
577 Ga0500639_266695 3300053163 Bacteria 672
578 Ga0500637_0005730 3300053178 Bacteria 6048
579 Ga0500637_0121594 3300053178 Bacteria 1515
580 Ga0500596_027380 3300053735 Bacteria 875
581 Ga0501084_0008006 3300054114 Bacteria 8702
582 Ga0501084_0075563 3300054114 Bacteria 2822
583 Ga0587077_081383 3300059493 Bacteria 744
584 Ga0587088_077463 3300059508 Bacteria 705
585 Ga0587072_063418 3300059643 Bacteria 766
586 Ga0501082_0004570 3300060353 Bacteria 12084
587 Ga0501082_0059231 3300060353 Bacteria 3300
588 Ga0501082_0646681 3300060353 Bacteria 925
589 Ga0466962_0000370 3300061719 Bacteria 19378
590 Ga0530510_0032835 3300061734 Bacteria 3735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031249 Ga0265339_10050493 Ga0265339_100504934 149
2 3300031995 Ga0307409_100069221 Ga0307409_1000692213 149
3 3300032005 Ga0307411_10534028 Ga0307411_105340282 149
4 3300032126 Ga0307415_101944020 Ga0307415_1019440201 149
5 3300047443 Ga0495687_032862 Ga0495687_032862_845_1312 149
6 3300005435 Ga0070714_100005029 Ga0070714_1000050295 150
7 3300005436 Ga0070713_100008164 Ga0070713_1000081645 150
8 3300005439 Ga0070711_100241034 Ga0070711_1002410342 150
9 3300005467 Ga0070706_101144109 Ga0070706_1011441091 150
10 3300005614 Ga0068856_100037883 Ga0068856_1000378834 150
11 3300006028 Ga0070717_10004864 Ga0070717_100048648 150
12 3300006173 Ga0070716_100390004 Ga0070716_1003900042 150
13 3300006914 Ga0075436_100010985 Ga0075436_1000109852 150
14 3300006914 Ga0075436_101021081 Ga0075436_1010210811 150
15 3300007076 Ga0075435_100080916 Ga0075435_1000809161 150
16 3300009092 Ga0105250_10014882 Ga0105250_100148824 150
17 3300009101 Ga0105247_10000119 Ga0105247_1000011958 150
18 3300009101 Ga0105247_10010643 Ga0105247_100106435 150
19 3300009177 Ga0105248_10007241 Ga0105248_100072414 150
20 3300009177 Ga0105248_10261416 Ga0105248_102614162 150
21 3300009553 Ga0105249_10076319 Ga0105249_100763192 150
22 3300009553 Ga0105249_10165086 Ga0105249_101650862 150
23 3300012506 Ga0157324_1029359 Ga0157324_10293592 150
24 3300013296 Ga0157374_10146713 Ga0157374_101467132 150
25 3300013306 Ga0163162_10044693 Ga0163162_100446932 150
26 3300013306 Ga0163162_10676262 Ga0163162_106762622 150
27 3300014325 Ga0163163_10248503 Ga0163163_102485031 150
28 3300014968 Ga0157379_10034448 Ga0157379_100344485 150
29 3300014968 Ga0157379_11009451 Ga0157379_110094512 150
30 3300021441 Ga0213871_10007505 Ga0213871_100075053 150
31 3300025906 Ga0207699_10013413 Ga0207699_100134134 150
32 3300025928 Ga0207700_10113895 Ga0207700_101138952 150
33 3300025938 Ga0207704_11049825 Ga0207704_110498252 150
34 3300025939 Ga0207665_10336404 Ga0207665_103364042 150
35 3300026078 Ga0207702_10027808 Ga0207702_100278082 150
36 3300039438 Ga0436360_0419016 Ga0436360_0419016_870_1340 150
37 3300039447 Ga0436361_0544715 Ga0436361_0544715_233_703 150
38 3300041459 Ga0451800_1574258 Ga0451800_1574258_50_520 150
39 3300044712 Ga0453684_1049421 Ga0453684_1049421_11_481 150
40 3300045051 Ga0451576_0356502 Ga0451576_0356502_512_982 150
41 3300046457 Ga0495590_0208898 Ga0495590_0208898_239_709 150
42 3300046507 Ga0495606_0494508 Ga0495606_0494508_86_553 150
43 3300048904 Ga0496101_0123071 Ga0496101_0123071_1074_1544 150
44 3300048905 Ga0496102_0248973 Ga0496102_0248973_1104_1574 150
45 3300048907 Ga0496104_0075089 Ga0496104_0075089_2259_2729 150
46 3300048909 Ga0496106_0055434 Ga0496106_0055434_1958_2428 150
47 3300048911 Ga0496108_0067997 Ga0496108_0067997_1186_1656 150
48 3300048912 Ga0496109_0353058 Ga0496109_0353058_166_636 150
49 3300048915 Ga0496112_0055308 Ga0496112_0055308_2935_3405 150
50 3300048921 Ga0496118_0134680 Ga0496118_0134680_504_974 150
51 3300048924 Ga0496121_0001977 Ga0496121_0001977_11944_12414 150
52 3300048928 Ga0496125_0001162 Ga0496125_0001162_29022_29492 150
53 3300048928 Ga0496125_0006098 Ga0496125_0006098_12110_12580 150
54 3300048929 Ga0496126_0112064 Ga0496126_0112064_1533_2003 150
55 3300048929 Ga0496126_0486570 Ga0496126_0486570_383_853 150
56 3300049568 Ga0501031_0102608 Ga0501031_0102608_1195_1659 150
57 3300049569 Ga0501032_0158037 Ga0501032_0158037_49_513 150
58 3300049570 Ga0501033_0223856 Ga0501033_0223856_814_1278 150
59 3300049572 Ga0501036_0014258 Ga0501036_0014258_4524_4988 150
60 3300049574 Ga0501038_0006611 Ga0501038_0006611_7754_8218 150
61 3300049575 Ga0501039_0009656 Ga0501039_0009656_692_1156 150
62 3300049576 Ga0501040_0000602 Ga0501040_0000602_20808_21272 150
63 3300049577 Ga0501041_0199985 Ga0501041_0199985_729_1193 150
64 3300049578 Ga0501042_0032301 Ga0501042_0032301_3221_3685 150
65 3300049580 Ga0501046_0026264 Ga0501046_0026264_464_928 150
66 3300049582 Ga0501048_0040418 Ga0501048_0040418_1410_1874 150
67 3300049584 Ga0501068_0208195 Ga0501068_0208195_766_1230 150
68 3300049586 Ga0501070_0889599 Ga0501070_0889599_150_614 150
69 3300049587 Ga0501071_0004207 Ga0501071_0004207_1720_2184 150
70 3300049588 Ga0501072_0002188 Ga0501072_0002188_10304_10768 150
71 3300049589 Ga0501073_0064965 Ga0501073_0064965_557_1021 150
72 3300049590 Ga0501074_0016923 Ga0501074_0016923_1031_1495 150
73 3300049591 Ga0501075_0060771 Ga0501075_0060771_795_1259 150
74 3300049592 Ga0501076_0338525 Ga0501076_0338525_749_1213 150
75 3300049593 Ga0501077_0000947 Ga0501077_0000947_3753_4217 150
76 3300049741 Ga0501079_0000487 Ga0501079_0000487_310_774 150
77 3300049743 Ga0501081_0000652 Ga0501081_0000652_2519_2983 150
78 3300049744 Ga0501083_0043399 Ga0501083_0043399_902_1366 150
79 3300049822 Ga0501035_0060634 Ga0501035_0060634_381_845 150
80 3300049824 Ga0501045_0015814 Ga0501045_0015814_1129_1593 150
81 3300050514 nmdc:mga08x19_798372_c1 nmdc:mga08x19_798372_c1_136_606 150
82 3300053163 Ga0500639_266695 Ga0500639_266695_112_582 150
83 3300053178 Ga0500637_0005730 Ga0500637_0005730_1879_2349 150
84 3300053735 Ga0500596_027380 Ga0500596_027380_390_860 150
85 3300054114 Ga0501084_0008006 Ga0501084_0008006_4533_4997 150
86 3300060353 Ga0501082_0004570 Ga0501082_0004570_10049_10513 150
87 3300061734 Ga0530510_0032835 Ga0530510_0032835_796_1260 150
88 3300005437 Ga0070710_10419495 Ga0070710_104194952 151
89 3300014325 Ga0163163_10236959 Ga0163163_102369593 151
90 3300021384 Ga0213876_10197013 Ga0213876_101970132 151
91 3300039437 Ga0436365_1796110 Ga0436365_1796110_2779_3249 151
92 3300039438 Ga0436360_0346195 Ga0436360_0346195_227_697 151
93 3300039453 Ga0436362_0826555 Ga0436362_0826555_674_1147 151
94 3300039453 Ga0436362_0933727 Ga0436362_0933727_523_996 151
95 3300039453 Ga0436362_1184014 Ga0436362_1184014_880_1350 151
96 3300046526 Ga0495666_0239774 Ga0495666_0239774_96_566 151
97 3300049568 Ga0501031_0259487 Ga0501031_0259487_112_588 151
98 3300049570 Ga0501033_0047574 Ga0501033_0047574_532_1008 151
99 3300049573 Ga0501037_0100608 Ga0501037_0100608_1012_1488 151
100 3300049574 Ga0501038_0148756 Ga0501038_0148756_168_644 151
101 3300049575 Ga0501039_0089946 Ga0501039_0089946_1275_1751 151
102 3300049576 Ga0501040_0020838 Ga0501040_0020838_14_490 151
103 3300049577 Ga0501041_0031439 Ga0501041_0031439_1360_1836 151
104 3300049578 Ga0501042_0006737 Ga0501042_0006737_2666_3142 151
105 3300049579 Ga0501043_0125209 Ga0501043_0125209_293_769 151
106 3300049579 Ga0501043_0918610 Ga0501043_0918610_72_548 151
107 3300049580 Ga0501046_0028966 Ga0501046_0028966_2665_3141 151
108 3300049582 Ga0501048_0020464 Ga0501048_0020464_3131_3607 151
109 3300049584 Ga0501068_0016459 Ga0501068_0016459_1839_2315 151
110 3300049587 Ga0501071_0018289 Ga0501071_0018289_3882_4358 151
111 3300049588 Ga0501072_0005867 Ga0501072_0005867_5710_6186 151
112 3300049590 Ga0501074_0041022 Ga0501074_0041022_374_850 151
113 3300049591 Ga0501075_0008811 Ga0501075_0008811_4952_5428 151
114 3300049592 Ga0501076_0001300 Ga0501076_0001300_15446_15922 151
115 3300049741 Ga0501079_0006973 Ga0501079_0006973_6838_7314 151
116 3300049741 Ga0501079_0935787 Ga0501079_0935787_34_510 151
117 3300049742 Ga0501080_0002859 Ga0501080_0002859_9207_9683 151
118 3300049743 Ga0501081_0062061 Ga0501081_0062061_227_703 151
119 3300049744 Ga0501083_0187986 Ga0501083_0187986_691_1167 151
120 3300049822 Ga0501035_0007719 Ga0501035_0007719_227_703 151
121 3300049823 Ga0501044_0656943 Ga0501044_0656943_188_664 151
122 3300049824 Ga0501045_0001321 Ga0501045_0001321_9450_9926 151
123 3300054114 Ga0501084_0075563 Ga0501084_0075563_2102_2578 151
124 3300060353 Ga0501082_0059231 Ga0501082_0059231_1026_1502 151
125 3300060353 Ga0501082_0646681 Ga0501082_0646681_160_636 151
126 3300005330 Ga0070690_100045342 Ga0070690_1000453422 152
127 3300005334 Ga0068869_100717076 Ga0068869_1007170762 152
128 3300005335 Ga0070666_10003267 Ga0070666_100032677 152
129 3300005338 Ga0068868_100505227 Ga0068868_1005052271 152
130 3300005355 Ga0070671_100022423 Ga0070671_1000224234 152
131 3300005356 Ga0070674_100265904 Ga0070674_1002659042 152
132 3300005364 Ga0070673_100076382 Ga0070673_1000763822 152
133 3300005367 Ga0070667_100058291 Ga0070667_1000582912 152
134 3300005434 Ga0070709_10212867 Ga0070709_102128672 152
135 3300005435 Ga0070714_100309261 Ga0070714_1003092613 152
136 3300005436 Ga0070713_100002285 Ga0070713_1000022857 152
137 3300005437 Ga0070710_10012175 Ga0070710_100121754 152
138 3300005439 Ga0070711_100033398 Ga0070711_1000333985 152
139 3300005439 Ga0070711_100057685 Ga0070711_1000576852 152
140 3300005456 Ga0070678_100010462 Ga0070678_1000104623 152
141 3300005458 Ga0070681_10000863 Ga0070681_1000086312 152
142 3300005518 Ga0070699_100851211 Ga0070699_1008512111 152
143 3300005530 Ga0070679_100110487 Ga0070679_1001104873 152
144 3300005544 Ga0070686_100841140 Ga0070686_1008411402 152
145 3300005545 Ga0070695_100466886 Ga0070695_1004668861 152
146 3300005548 Ga0070665_100017428 Ga0070665_1000174286 152
147 3300005549 Ga0070704_100708688 Ga0070704_1007086882 152
148 3300005614 Ga0068856_100044167 Ga0068856_1000441674 152
149 3300005615 Ga0070702_100508285 Ga0070702_1005082852 152
150 3300005718 Ga0068866_10007786 Ga0068866_100077863 152
151 3300005841 Ga0068863_100052991 Ga0068863_1000529916 152
152 3300005841 Ga0068863_101051510 Ga0068863_1010515102 152
153 3300005842 Ga0068858_100272080 Ga0068858_1002720803 152
154 3300005842 Ga0068858_100909719 Ga0068858_1009097191 152
155 3300005843 Ga0068860_100020608 Ga0068860_1000206081 152
156 3300006163 Ga0070715_10000363 Ga0070715_100003635 152
157 3300006173 Ga0070716_100016141 Ga0070716_1000161413 152
158 3300006175 Ga0070712_100893926 Ga0070712_1008939262 152
159 3300006237 Ga0097621_100005189 Ga0097621_1000051896 152
160 3300006358 Ga0068871_100090361 Ga0068871_1000903614 152
161 3300006881 Ga0068865_100005789 Ga0068865_1000057896 152
162 3300006881 Ga0068865_100355428 Ga0068865_1003554282 152
163 3300006914 Ga0075436_100064201 Ga0075436_1000642014 152
164 3300009098 Ga0105245_10079403 Ga0105245_100794033 152
165 3300009101 Ga0105247_10046620 Ga0105247_100466204 152
166 3300009174 Ga0105241_10004061 Ga0105241_100040618 152
167 3300009176 Ga0105242_10050722 Ga0105242_100507222 152
168 3300009177 Ga0105248_10007074 Ga0105248_100070743 152
169 3300009545 Ga0105237_10017179 Ga0105237_100171795 152
170 3300010375 Ga0105239_10049357 Ga0105239_100493573 152
171 3300013296 Ga0157374_10040089 Ga0157374_100400894 152
172 3300013297 Ga0157378_10005124 Ga0157378_100051246 152
173 3300013306 Ga0163162_10013023 Ga0163162_100130239 152
174 3300013308 Ga0157375_10116984 Ga0157375_101169844 152
175 3300014325 Ga0163163_10142415 Ga0163163_101424154 152
176 3300014325 Ga0163163_10173106 Ga0163163_101731064 152
177 3300014968 Ga0157379_10068194 Ga0157379_100681945 152
178 3300021377 Ga0213874_10006886 Ga0213874_100068865 152
179 3300025898 Ga0207692_10009583 Ga0207692_100095836 152
180 3300025899 Ga0207642_10005903 Ga0207642_100059033 152
181 3300025903 Ga0207680_10348345 Ga0207680_103483453 152
182 3300025905 Ga0207685_10369804 Ga0207685_103698042 152
183 3300025906 Ga0207699_10008992 Ga0207699_100089924 152
184 3300025912 Ga0207707_10006819 Ga0207707_100068197 152
185 3300025914 Ga0207671_10043684 Ga0207671_100436844 152
186 3300025915 Ga0207693_10002400 Ga0207693_1000240027 152
187 3300025916 Ga0207663_10048884 Ga0207663_100488842 152
188 3300025916 Ga0207663_10082779 Ga0207663_100827793 152
189 3300025917 Ga0207660_10237952 Ga0207660_102379524 152
190 3300025928 Ga0207700_10148296 Ga0207700_101482964 152
191 3300025929 Ga0207664_10281246 Ga0207664_102812462 152
192 3300025931 Ga0207644_10382807 Ga0207644_103828072 152
193 3300025934 Ga0207686_10143391 Ga0207686_101433912 152
194 3300025937 Ga0207669_10273562 Ga0207669_102735621 152
195 3300025938 Ga0207704_10239663 Ga0207704_102396632 152
196 3300025939 Ga0207665_10003249 Ga0207665_100032495 152
197 3300025941 Ga0207711_10059125 Ga0207711_100591255 152
198 3300025960 Ga0207651_10083362 Ga0207651_100833621 152
199 3300026023 Ga0207677_11879485 Ga0207677_118794851 152
200 3300026035 Ga0207703_10075043 Ga0207703_100750434 152
201 3300026035 Ga0207703_10404235 Ga0207703_104042352 152
202 3300026078 Ga0207702_10052499 Ga0207702_100524994 152
203 3300026088 Ga0207641_10246015 Ga0207641_102460152 152
204 3300026121 Ga0207683_10001886 Ga0207683_1000188615 152
205 3300028379 Ga0268266_10170621 Ga0268266_101706212 152
206 3300028794 Ga0307515_10049570 Ga0307515_100495706 152
207 3300031456 Ga0307513_10161627 Ga0307513_101616273 152
208 3300035083 Ga0373926_0354080 Ga0373926_0354080_23_496 152
209 3300035120 Ga0373957_0039504 Ga0373957_0039504_255_728 152
210 3300035170 Ga0373943_0020088 Ga0373943_0020088_1073_1546 152
211 3300035172 Ga0373955_0111296 Ga0373955_0111296_385_858 152
212 3300035692 Ga0373935_0117191 Ga0373935_0117191_650_1123 152
213 3300035725 Ga0373947_0015434 Ga0373947_0015434_2661_3134 152
214 3300036401 Ga0373937_0859630 Ga0373937_0859630_239_712 152
215 3300037068 Ga0373925_0128033 Ga0373925_0128033_825_1298 152
216 3300039437 Ga0436365_1342030 Ga0436365_1342030_132_605 152
217 3300039447 Ga0436361_0169415 Ga0436361_0169415_74_550 152
218 3300039450 Ga0436363_0475575 Ga0436363_0475575_2407_2880 152
219 3300039453 Ga0436362_0778749 Ga0436362_0778749_668_1144 152
220 3300046459 Ga0495629_0382110 Ga0495629_0382110_164_637 152
221 3300046473 Ga0495582_0118594 Ga0495582_0118594_458_931 152
222 3300046517 Ga0495630_0183445 Ga0495630_0183445_844_1317 152
223 3300046519 Ga0495632_0162963 Ga0495632_0162963_145_627 152
224 3300046535 Ga0495586_0160474 Ga0495586_0160474_664_1137 152
225 3300046543 Ga0495645_0388157 Ga0495645_0388157_200_673 152
226 3300046681 Ga0495647_0091182 Ga0495647_0091182_720_1193 152
227 3300046683 Ga0495658_0118811 Ga0495658_0118811_383_856 152
228 3300047319 Ga0495674_0138144 Ga0495674_0138144_1348_1821 152
229 3300048903 Ga0496100_0059578 Ga0496100_0059578_1187_1660 152
230 3300048904 Ga0496101_0229814 Ga0496101_0229814_122_595 152
231 3300048905 Ga0496102_0148863 Ga0496102_0148863_30_503 152
232 3300048906 Ga0496103_0063295 Ga0496103_0063295_293_766 152
233 3300048907 Ga0496104_0242029 Ga0496104_0242029_1203_1676 152
234 3300048908 Ga0496105_0191388 Ga0496105_0191388_1042_1515 152
235 3300048909 Ga0496106_0217635 Ga0496106_0217635_309_782 152
236 3300048910 Ga0496107_0038151 Ga0496107_0038151_2061_2534 152
237 3300048911 Ga0496108_0004541 Ga0496108_0004541_3717_4190 152
238 3300048912 Ga0496109_0036912 Ga0496109_0036912_843_1316 152
239 3300048913 Ga0496110_0013721 Ga0496110_0013721_1365_1838 152
240 3300048914 Ga0496111_0022901 Ga0496111_0022901_1127_1600 152
241 3300048915 Ga0496112_0318261 Ga0496112_0318261_74_547 152
242 3300048916 Ga0496113_0107284 Ga0496113_0107284_850_1323 152
243 3300048918 Ga0496115_0050011 Ga0496115_0050011_2112_2585 152
244 3300053077 Ga0495601_0188253 Ga0495601_0188253_33_506 152
245 3300053088 Ga0500644_0116172 Ga0500644_0116172_14_496 152
246 3300053096 Ga0500641_0159913 Ga0500641_0159913_124_606 152
247 3300053134 Ga0500658_0361366 Ga0500658_0361366_94_576 152
248 3300005329 Ga0070683_101484541 Ga0070683_1014845411 153
249 3300005336 Ga0070680_100221000 Ga0070680_1002210002 153
250 3300005336 Ga0070680_101433492 Ga0070680_1014334921 153
251 3300005367 Ga0070667_100332338 Ga0070667_1003323381 153
252 3300005458 Ga0070681_10069030 Ga0070681_100690304 153
253 3300009093 Ga0105240_10051789 Ga0105240_100517892 153
254 3300009093 Ga0105240_10090514 Ga0105240_100905144 153
255 3300021384 Ga0213876_10086919 Ga0213876_100869192 153
256 3300025912 Ga0207707_10200402 Ga0207707_102004022 153
257 3300025913 Ga0207695_10075075 Ga0207695_100750751 153
258 3300025917 Ga0207660_10087119 Ga0207660_100871193 153
259 3300025921 Ga0207652_10006797 Ga0207652_100067974 153
260 3300025981 Ga0207640_11499474 Ga0207640_114994742 153
261 3300025986 Ga0207658_10908864 Ga0207658_109088641 153
262 3300031731 Ga0307405_10817946 Ga0307405_108179461 153
263 3300031903 Ga0307407_10783032 Ga0307407_107830322 153
264 3300036401 Ga0373937_0279663 Ga0373937_0279663_470_955 153
265 3300037418 Ga0395900_0475763 Ga0395900_0475763_593_1066 153
266 3300037466 Ga0395898_0004801 Ga0395898_0004801_5265_5738 153
267 3300037466 Ga0395898_0413210 Ga0395898_0413210_493_966 153
268 3300039437 Ga0436365_0375377 Ga0436365_0375377_4394_4876 153
269 3300039450 Ga0436363_1137318 Ga0436363_1137318_469_951 153
270 3300039453 Ga0436362_0605076 Ga0436362_0605076_155_637 153
271 3300041486 Ga0451807_1232526 Ga0451807_1232526_182_658 153
272 3300044656 Ga0466969_0039150 Ga0466969_0039150_1120_1599 153
273 3300044656 Ga0466969_0061163 Ga0466969_0061163_119_601 153
274 3300044684 Ga0466966_0002009 Ga0466966_0002009_2172_2651 153
275 3300044684 Ga0466966_0125007 Ga0466966_0125007_553_1026 153
276 3300044684 Ga0466966_0352001 Ga0466966_0352001_71_544 153
277 3300044693 Ga0466961_0001203 Ga0466961_0001203_2172_2651 153
278 3300044706 Ga0466964_0000188 Ga0466964_0000188_15739_16218 153
279 3300044719 Ga0466971_0000534 Ga0466971_0000534_13332_13811 153
280 3300044735 Ga0466968_0284202 Ga0466968_0284202_297_776 153
281 3300044765 Ga0466970_0002030 Ga0466970_0002030_1120_1599 153
282 3300044842 Ga0466957_0003911 Ga0466957_0003911_4902_5381 153
283 3300045049 Ga0466959_0000706 Ga0466959_0000706_10215_10694 153
284 3300045049 Ga0466959_0811169 Ga0466959_0811169_85_558 153
285 3300045836 Ga0466958_0088068 Ga0466958_0088068_722_1201 153
286 3300046455 Ga0495603_0195677 Ga0495603_0195677_58_543 153
287 3300046458 Ga0495591_029904 Ga0495591_029904_37_522 153
288 3300046459 Ga0495629_0294120 Ga0495629_0294120_156_641 153
289 3300046460 Ga0495638_0300446 Ga0495638_0300446_156_641 153
290 3300046472 Ga0495580_0021479 Ga0495580_0021479_1715_2200 153
291 3300046475 Ga0495639_0174106 Ga0495639_0174106_515_1000 153
292 3300046523 Ga0495644_0014518 Ga0495644_0014518_749_1234 153
293 3300046528 Ga0495642_0156200 Ga0495642_0156200_50_535 153
294 3300046535 Ga0495586_0294992 Ga0495586_0294992_143_628 153
295 3300046539 Ga0495621_0000091 Ga0495621_0000091_13545_14030 153
296 3300046557 Ga0495622_0178568 Ga0495622_0178568_192_677 153
297 3300046681 Ga0495647_0005576 Ga0495647_0005576_3256_3741 153
298 3300046683 Ga0495658_0184425 Ga0495658_0184425_598_1083 153
299 3300047323 Ga0495683_0294930 Ga0495683_0294930_110_595 153
300 3300047470 Ga0495681_0016395 Ga0495681_0016395_1779_2264 153
301 3300049585 Ga0501069_0248358 Ga0501069_0248358_68_550 153
302 3300061719 Ga0466962_0000370 Ga0466962_0000370_2699_3178 153
303 3300005330 Ga0070690_100323543 Ga0070690_1003235432 154
304 3300005335 Ga0070666_10053482 Ga0070666_100534822 154
305 3300005335 Ga0070666_10160004 Ga0070666_101600043 154
306 3300005338 Ga0068868_101166395 Ga0068868_1011663952 154
307 3300005341 Ga0070691_10414016 Ga0070691_104140162 154
308 3300005343 Ga0070687_100299167 Ga0070687_1002991672 154
309 3300005347 Ga0070668_100758711 Ga0070668_1007587111 154
310 3300005355 Ga0070671_100023210 Ga0070671_1000232104 154
311 3300005355 Ga0070671_100096811 Ga0070671_1000968114 154
312 3300005367 Ga0070667_100041662 Ga0070667_1000416624 154
313 3300005367 Ga0070667_100055355 Ga0070667_1000553551 154
314 3300005436 Ga0070713_100296672 Ga0070713_1002966722 154
315 3300005455 Ga0070663_100050669 Ga0070663_1000506694 154
316 3300005458 Ga0070681_10005684 Ga0070681_1000568413 154
317 3300005458 Ga0070681_10454665 Ga0070681_104546652 154
318 3300005535 Ga0070684_100810187 Ga0070684_1008101871 154
319 3300005539 Ga0068853_100108267 Ga0068853_1001082674 154
320 3300005544 Ga0070686_100018554 Ga0070686_1000185546 154
321 3300005547 Ga0070693_100096556 Ga0070693_1000965562 154
322 3300005548 Ga0070665_100008413 Ga0070665_1000084132 154
323 3300005548 Ga0070665_100010853 Ga0070665_1000108538 154
324 3300005548 Ga0070665_100056861 Ga0070665_1000568615 154
325 3300005564 Ga0070664_100125155 Ga0070664_1001251553 154
326 3300005616 Ga0068852_102269672 Ga0068852_1022696721 154
327 3300005617 Ga0068859_100000376 Ga0068859_10000037626 154
328 3300005618 Ga0068864_100195910 Ga0068864_1001959102 154
329 3300005719 Ga0068861_101173753 Ga0068861_1011737531 154
330 3300005834 Ga0068851_10066014 Ga0068851_100660143 154
331 3300005841 Ga0068863_100003148 Ga0068863_10000314815 154
332 3300005841 Ga0068863_100006529 Ga0068863_1000065296 154
333 3300005842 Ga0068858_100002387 Ga0068858_1000023877 154
334 3300005842 Ga0068858_100050576 Ga0068858_1000505763 154
335 3300005843 Ga0068860_100003079 Ga0068860_1000030795 154
336 3300005843 Ga0068860_100030656 Ga0068860_1000306564 154
337 3300005844 Ga0068862_100008883 Ga0068862_1000088835 154
338 3300005937 Ga0081455_10289442 Ga0081455_102894421 154
339 3300006237 Ga0097621_100160611 Ga0097621_1001606112 154
340 3300006358 Ga0068871_100290077 Ga0068871_1002900774 154
341 3300006931 Ga0097620_100000376 Ga0097620_10000037626 154
342 3300009551 Ga0105238_10156924 Ga0105238_101569243 154
343 3300013296 Ga0157374_10266580 Ga0157374_102665802 154
344 3300014325 Ga0163163_10114622 Ga0163163_101146224 154
345 3300025900 Ga0207710_10000584 Ga0207710_1000058418 154
346 3300025903 Ga0207680_10037800 Ga0207680_100378004 154
347 3300025903 Ga0207680_10050083 Ga0207680_100500833 154
348 3300025911 Ga0207654_10454413 Ga0207654_104544132 154
349 3300025912 Ga0207707_10004427 Ga0207707_100044276 154
350 3300025913 Ga0207695_10268109 Ga0207695_102681093 154
351 3300025924 Ga0207694_10640594 Ga0207694_106405942 154
352 3300025928 Ga0207700_10515559 Ga0207700_105155592 154
353 3300025931 Ga0207644_10012392 Ga0207644_100123925 154
354 3300025931 Ga0207644_10267570 Ga0207644_102675703 154
355 3300025934 Ga0207686_10342104 Ga0207686_103421042 154
356 3300025940 Ga0207691_10282536 Ga0207691_102825362 154
357 3300025941 Ga0207711_10237575 Ga0207711_102375752 154
358 3300025945 Ga0207679_11102387 Ga0207679_111023872 154
359 3300025961 Ga0207712_10045757 Ga0207712_100457574 154
360 3300025961 Ga0207712_10079635 Ga0207712_100796353 154
361 3300025961 Ga0207712_10106949 Ga0207712_101069494 154
362 3300025986 Ga0207658_10009211 Ga0207658_100092116 154
363 3300025986 Ga0207658_10023297 Ga0207658_100232973 154
364 3300026035 Ga0207703_10001857 Ga0207703_1000185714 154
365 3300026035 Ga0207703_10013445 Ga0207703_100134452 154
366 3300026067 Ga0207678_10010959 Ga0207678_100109595 154
367 3300026088 Ga0207641_10002848 Ga0207641_1000284815 154
368 3300026088 Ga0207641_10025361 Ga0207641_100253616 154
369 3300026095 Ga0207676_10835823 Ga0207676_108358232 154
370 3300026118 Ga0207675_100567168 Ga0207675_1005671683 154
371 3300026118 Ga0207675_101056992 Ga0207675_1010569921 154
372 3300028379 Ga0268266_10017254 Ga0268266_100172542 154
373 3300028379 Ga0268266_10063145 Ga0268266_100631453 154
374 3300028380 Ga0268265_10724782 Ga0268265_107247822 154
375 3300028381 Ga0268264_10000308 Ga0268264_1000030815 154
376 3300028381 Ga0268264_10018548 Ga0268264_100185486 154
377 3300030521 Ga0307511_10000793 Ga0307511_1000079318 154
378 3300031456 Ga0307513_10605137 Ga0307513_106051372 154
379 3300031507 Ga0307509_10000008 Ga0307509_1000000842 154
380 3300031548 Ga0307408_100150990 Ga0307408_1001509902 154
381 3300031901 Ga0307406_10294092 Ga0307406_102940923 154
382 3300031911 Ga0307412_10065605 Ga0307412_100656053 154
383 3300033180 Ga0307510_10000004 Ga0307510_10000004389 154
384 3300041408 Ga0439453_0031784 Ga0439453_0031784_174_656 154
385 3300042436 Ga0439435_0021281 Ga0439435_0021281_792_1274 154
386 3300044656 Ga0466969_0100870 Ga0466969_0100870_193_669 154
387 3300045049 Ga0466959_0030139 Ga0466959_0030139_1970_2446 154
388 3300045836 Ga0466958_0277212 Ga0466958_0277212_480_956 154
389 3300046519 Ga0495632_0099969 Ga0495632_0099969_401_883 154
390 3300046616 Ga0495668_0735085 Ga0495668_0735085_46_528 154
391 3300053096 Ga0500641_0034442 Ga0500641_0034442_1364_1828 154
392 3300053111 Ga0500572_159242 Ga0500572_159242_213_692 154
393 3300053143 Ga0500579_183962 Ga0500579_183962_293_757 154
394 3300053153 Ga0500616_0000074 Ga0500616_0000074_66200_66664 154
395 3300053178 Ga0500637_0121594 Ga0500637_0121594_287_766 154
396 3300004800 Ga0058861_11703000 Ga0058861_117030002 155
397 3300004803 Ga0058862_12292822 Ga0058862_122928222 155
398 3300005329 Ga0070683_100025169 Ga0070683_1000251692 155
399 3300005329 Ga0070683_102021182 Ga0070683_1020211821 155
400 3300005334 Ga0068869_100560527 Ga0068869_1005605272 155
401 3300005336 Ga0070680_100020097 Ga0070680_1000200974 155
402 3300005336 Ga0070680_100037741 Ga0070680_1000377414 155
403 3300005341 Ga0070691_10365462 Ga0070691_103654621 155
404 3300005435 Ga0070714_101189174 Ga0070714_1011891742 155
405 3300005436 Ga0070713_100025923 Ga0070713_1000259234 155
406 3300005458 Ga0070681_10005285 Ga0070681_100052858 155
407 3300005458 Ga0070681_10006459 Ga0070681_1000645910 155
408 3300005458 Ga0070681_10028021 Ga0070681_100280212 155
409 3300005458 Ga0070681_10089609 Ga0070681_100896094 155
410 3300005530 Ga0070679_100006602 Ga0070679_10000660210 155
411 3300005530 Ga0070679_100080444 Ga0070679_1000804446 155
412 3300005530 Ga0070679_100164013 Ga0070679_1001640133 155
413 3300005530 Ga0070679_100316992 Ga0070679_1003169923 155
414 3300005535 Ga0070684_100112949 Ga0070684_1001129494 155
415 3300005539 Ga0068853_101177083 Ga0068853_1011770831 155
416 3300005548 Ga0070665_100134506 Ga0070665_1001345061 155
417 3300005563 Ga0068855_100004720 Ga0068855_10000472010 155
418 3300005563 Ga0068855_100013913 Ga0068855_1000139136 155
419 3300005563 Ga0068855_101675569 Ga0068855_1016755691 155
420 3300005564 Ga0070664_100828109 Ga0070664_1008281092 155
421 3300005578 Ga0068854_100100256 Ga0068854_1001002564 155
422 3300005578 Ga0068854_100272104 Ga0068854_1002721042 155
423 3300005614 Ga0068856_100784847 Ga0068856_1007848472 155
424 3300005614 Ga0068856_101560933 Ga0068856_1015609332 155
425 3300005719 Ga0068861_101426739 Ga0068861_1014267391 155
426 3300005842 Ga0068858_100994246 Ga0068858_1009942461 155
427 3300005844 Ga0068862_100315755 Ga0068862_1003157552 155
428 3300006237 Ga0097621_100038041 Ga0097621_1000380415 155
429 3300006358 Ga0068871_100158496 Ga0068871_1001584962 155
430 3300009093 Ga0105240_10005493 Ga0105240_1000549312 155
431 3300009093 Ga0105240_10005499 Ga0105240_100054997 155
432 3300009093 Ga0105240_10005908 Ga0105240_1000590811 155
433 3300009093 Ga0105240_10014001 Ga0105240_100140012 155
434 3300009093 Ga0105240_10159918 Ga0105240_101599184 155
435 3300009093 Ga0105240_10238500 Ga0105240_102385001 155
436 3300009093 Ga0105240_10550225 Ga0105240_105502251 155
437 3300009093 Ga0105240_10950564 Ga0105240_109505642 155
438 3300009098 Ga0105245_10909409 Ga0105245_109094092 155
439 3300009174 Ga0105241_10123009 Ga0105241_101230092 155
440 3300009545 Ga0105237_10017590 Ga0105237_100175902 155
441 3300009545 Ga0105237_10151235 Ga0105237_101512353 155
442 3300009545 Ga0105237_10190530 Ga0105237_101905302 155
443 3300009545 Ga0105237_10565707 Ga0105237_105657073 155
444 3300009551 Ga0105238_10011533 Ga0105238_100115334 155
445 3300009551 Ga0105238_10202708 Ga0105238_102027083 155
446 3300009551 Ga0105238_10277311 Ga0105238_102773111 155
447 3300010375 Ga0105239_10014313 Ga0105239_100143134 155
448 3300011119 Ga0105246_10227695 Ga0105246_102276953 155
449 3300013104 Ga0157370_10002010 Ga0157370_1000201010 155
450 3300013104 Ga0157370_10346606 Ga0157370_103466062 155
451 3300013104 Ga0157370_10669945 Ga0157370_106699452 155
452 3300013105 Ga0157369_10018790 Ga0157369_100187905 155
453 3300013105 Ga0157369_10041796 Ga0157369_100417964 155
454 3300013105 Ga0157369_10591166 Ga0157369_105911662 155
455 3300013296 Ga0157374_10465856 Ga0157374_104658563 155
456 3300013296 Ga0157374_10814677 Ga0157374_108146772 155
457 3300013307 Ga0157372_10064040 Ga0157372_100640405 155
458 3300013307 Ga0157372_10721281 Ga0157372_107212811 155
459 3300013307 Ga0157372_11370992 Ga0157372_113709921 155
460 3300013307 Ga0157372_12461970 Ga0157372_124619701 155
461 3300014325 Ga0163163_11161468 Ga0163163_111614682 155
462 3300014325 Ga0163163_11214019 Ga0163163_112140192 155
463 3300014968 Ga0157379_10035519 Ga0157379_100355195 155
464 3300020081 Ga0206354_11374159 Ga0206354_113741591 155
465 3300021377 Ga0213874_10309042 Ga0213874_103090421 155
466 3300025912 Ga0207707_10000213 Ga0207707_1000021310 155
467 3300025912 Ga0207707_10007539 Ga0207707_100075392 155
468 3300025912 Ga0207707_10193275 Ga0207707_101932751 155
469 3300025913 Ga0207695_10007808 Ga0207695_100078086 155
470 3300025913 Ga0207695_10066718 Ga0207695_100667182 155
471 3300025913 Ga0207695_10117921 Ga0207695_101179212 155
472 3300025913 Ga0207695_10289529 Ga0207695_102895292 155
473 3300025913 Ga0207695_10306800 Ga0207695_103068002 155
474 3300025913 Ga0207695_10322465 Ga0207695_103224652 155
475 3300025913 Ga0207695_10672730 Ga0207695_106727302 155
476 3300025914 Ga0207671_10058800 Ga0207671_100588004 155
477 3300025917 Ga0207660_10058589 Ga0207660_100585894 155
478 3300025917 Ga0207660_10148542 Ga0207660_101485422 155
479 3300025917 Ga0207660_10152080 Ga0207660_101520803 155
480 3300025917 Ga0207660_10219827 Ga0207660_102198273 155
481 3300025921 Ga0207652_10001434 Ga0207652_1000143417 155
482 3300025921 Ga0207652_10076517 Ga0207652_100765171 155
483 3300025921 Ga0207652_10100506 Ga0207652_101005064 155
484 3300025921 Ga0207652_10767439 Ga0207652_107674392 155
485 3300025924 Ga0207694_10006364 Ga0207694_100063645 155
486 3300025924 Ga0207694_10013501 Ga0207694_100135015 155
487 3300025924 Ga0207694_10392284 Ga0207694_103922842 155
488 3300025924 Ga0207694_10502721 Ga0207694_105027211 155
489 3300025925 Ga0207650_10548314 Ga0207650_105483142 155
490 3300025928 Ga0207700_10049869 Ga0207700_100498695 155
491 3300025944 Ga0207661_10235066 Ga0207661_102350661 155
492 3300025949 Ga0207667_10003935 Ga0207667_100039355 155
493 3300025949 Ga0207667_10046714 Ga0207667_100467143 155
494 3300025949 Ga0207667_10080827 Ga0207667_100808274 155
495 3300025981 Ga0207640_10084686 Ga0207640_100846862 155
496 3300026035 Ga0207703_10704980 Ga0207703_107049802 155
497 3300026041 Ga0207639_11196655 Ga0207639_111966552 155
498 3300026078 Ga0207702_10217347 Ga0207702_102173471 155
499 3300026078 Ga0207702_10714155 Ga0207702_107141551 155
500 3300026118 Ga0207675_102389458 Ga0207675_1023894581 155
501 3300026142 Ga0207698_10230176 Ga0207698_102301764 155
502 3300026142 Ga0207698_11508036 Ga0207698_115080362 155
503 3300028379 Ga0268266_10000926 Ga0268266_1000092627 155
504 3300028379 Ga0268266_10076380 Ga0268266_100763804 155
505 3300028380 Ga0268265_10346400 Ga0268265_103464002 155
506 3300028573 Ga0265334_10015305 Ga0265334_100153055 155
507 3300037853 Ga0436364_0530634 Ga0436364_0530634_497_982 155
508 3300039437 Ga0436365_0885394 Ga0436365_0885394_78_563 155
509 3300039450 Ga0436363_0122190 Ga0436363_0122190_503_991 155
510 3300041453 Ga0451797_1164725 Ga0451797_1164725_144_632 155
511 3300041494 Ga0451837_1645436 Ga0451837_1645436_42_530 155
512 3300044656 Ga0466969_0000245 Ga0466969_0000245_20684_21172 155
513 3300044658 Ga0466972_0027888 Ga0466972_0027888_2092_2580 155
514 3300044684 Ga0466966_0155606 Ga0466966_0155606_537_1025 155
515 3300045049 Ga0466959_0003041 Ga0466959_0003041_4980_5468 155
516 3300045049 Ga0466959_0010227 Ga0466959_0010227_5958_6446 155
517 3300045976 Ga0466967_1319199 Ga0466967_1319199_179_667 155
518 3300046692 Ga0495671_0009176 Ga0495671_0009176_352_837 155
519 3300047443 Ga0495687_017826 Ga0495687_017826_1160_1645 155
520 3300048929 Ga0496126_0000545 Ga0496126_0000545_6297_6782 155
521 3300048929 Ga0496126_0098554 Ga0496126_0098554_425_913 155
522 3300053119 Ga0500595_010853 Ga0500595_010853_382_870 155
523 3300059493 Ga0587077_081383 Ga0587077_081383_222_710 155
524 3300059508 Ga0587088_077463 Ga0587088_077463_182_670 155
525 3300059643 Ga0587072_063418 Ga0587072_063418_55_543 155
526 3300005530 Ga0070679_100010385 Ga0070679_1000103854 156
527 3300005719 Ga0068861_100045156 Ga0068861_1000451563 156
528 3300005844 Ga0068862_100211468 Ga0068862_1002114682 156
529 3300005844 Ga0068862_100455869 Ga0068862_1004558692 156
530 3300005985 Ga0081539_10255625 Ga0081539_102556251 156
531 3300009101 Ga0105247_10582949 Ga0105247_105829492 156
532 3300009553 Ga0105249_10829723 Ga0105249_108297232 156
533 3300014968 Ga0157379_10277414 Ga0157379_102774144 156
534 3300025912 Ga0207707_10097836 Ga0207707_100978363 156
535 3300025921 Ga0207652_10315327 Ga0207652_103153273 156
536 3300025961 Ga0207712_10709712 Ga0207712_107097122 156
537 3300026118 Ga0207675_100079258 Ga0207675_1000792584 156
538 3300028380 Ga0268265_10439022 Ga0268265_104390223 156
539 3300053104 Ga0500556_0000260 Ga0500556_0000260_22980_23465 156
540 3300053130 Ga0500642_0439715 Ga0500642_0439715_69_539 156
541 3300003320 rootH2_10119640 rootH2_101196404 157
542 3300005367 Ga0070667_100369988 Ga0070667_1003699882 157
543 3300009093 Ga0105240_10036965 Ga0105240_100369654 157
544 3300009545 Ga0105237_10405733 Ga0105237_104057332 157
545 3300009551 Ga0105238_10085369 Ga0105238_100853692 157
546 3300014325 Ga0163163_10050681 Ga0163163_100506815 157
547 3300014968 Ga0157379_10151189 Ga0157379_101511893 157
548 3300014969 Ga0157376_10530034 Ga0157376_105300342 157
549 3300025913 Ga0207695_10067744 Ga0207695_100677442 157
550 3300028379 Ga0268266_10034382 Ga0268266_100343825 157
551 3300028380 Ga0268265_10012800 Ga0268265_100128004 157
552 3300046507 Ga0495606_0061073 Ga0495606_0061073_690_1250 157
553 3300046660 Ga0495625_0076177 Ga0495625_0076177_499_1026 157
554 3300048903 Ga0496100_0166261 Ga0496100_0166261_388_948 157
555 3300048905 Ga0496102_0008566 Ga0496102_0008566_3523_4083 157
556 3300048906 Ga0496103_0049426 Ga0496103_0049426_1521_2081 157
557 3300048919 Ga0496116_0022031 Ga0496116_0022031_1103_1663 157
558 3300048920 Ga0496117_0000189 Ga0496117_0000189_115944_116504 157
559 3300048921 Ga0496118_0000111 Ga0496118_0000111_35889_36449 157
560 3300048922 Ga0496119_0001233 Ga0496119_0001233_6539_7066 157
561 3300048922 Ga0496119_0010407 Ga0496119_0010407_7120_7680 157
562 3300048922 Ga0496119_0020667 Ga0496119_0020667_884_1444 157
563 3300048923 Ga0496120_0000025 Ga0496120_0000025_235247_235774 157
564 3300048923 Ga0496120_0025102 Ga0496120_0025102_3061_3621 157
565 3300048923 Ga0496120_0050239 Ga0496120_0050239_12_572 157
566 3300048928 Ga0496125_0062432 Ga0496125_0062432_410_970 157
567 3300048929 Ga0496126_0012241 Ga0496126_0012241_1421_1981 157
568 3300053092 Ga0500583_0013741 Ga0500583_0013741_1064_1546 157
569 3300053115 Ga0500591_024205 Ga0500591_024205_2160_2687 157
570 3300053124 Ga0500617_053167 Ga0500617_053167_612_1094 157
571 3300053130 Ga0500642_0183027 Ga0500642_0183027_10_492 157
572 3300053131 Ga0500652_060627 Ga0500652_060627_94_576 157
573 3300053134 Ga0500658_0067067 Ga0500658_0067067_280_762 157
574 3300053136 Ga0500559_0432771 Ga0500559_0432771_17_544 157
575 3300053146 Ga0500588_0002216 Ga0500588_0002216_1133_1615 157
576 3300053158 Ga0500627_0217696 Ga0500627_0217696_56_529 157
577 3300003203 JGI25406J46586_10002943 JGI25406J46586_100029438 158
578 3300003911 JGI25405J52794_10034364 JGI25405J52794_100343642 158
579 3300005719 Ga0068861_100718347 Ga0068861_1007183472 158
580 3300005937 Ga0081455_10002817 Ga0081455_1000281713 158
581 3300005985 Ga0081539_10000007 Ga0081539_10000007144 158
582 3300028786 Ga0307517_10447696 Ga0307517_104476962 158
583 3300031507 Ga0307509_10269132 Ga0307509_102691322 158
584 3300031507 Ga0307509_10315944 Ga0307509_103159442 158
585 3300044658 Ga0466972_0049994 Ga0466972_0049994_1233_1712 158
586 3300045051 Ga0451576_1135409 Ga0451576_1135409_48_530 158
587 3300046542 Ga0495597_0080012 Ga0495597_0080012_721_1254 158
588 3300048918 Ga0496115_1056487 Ga0496115_1056487_27_593 158
589 3300053104 Ga0500556_0071245 Ga0500556_0071245_53_538 158
590 3300053104 Ga0500556_0116080 Ga0500556_0116080_418_903 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02556

SecB

Preprotein translocase subunit SecB

41

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.8244 19 147
1fx3-assembly1.cif.gz_D crystal structure of h. influenzae secb 0.8206 19 147
1ozb-assembly1.cif.gz_A crystal structure of secb complexed with seca c-terminus 0.8125 18 148
5mtw-assembly1.cif.gz_D mycobacterium tuberculosis rv1957 secb-like chaperone in complex with a chad peptide from rv1956 higa1 antitoxin 0.8082 20 132
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.8004 19 147
ID Description Score Start End Superfamily
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7917 19 152 3.10.420.10
af_P95257_21_163_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7866 20 132 3.10.420.10
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7749 19 152 3.10.420.10
af_B0G139_402_524_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.7072 48 79 2.60.40.1470
af_P9WK27_1_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.703 46 108 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A351DN78-F1-model_v4 Protein-export chaperone SecB 0.9406 13 125 GO:0015031
GO:0051082
GO:0051262
AF-A0A2G6CJZ6-F1-model_v4 Protein-export chaperone SecB 0.9314 14 108 GO:0015031
GO:0051082
GO:0051262
AF-A0A659XY36-F1-model_v4 Protein-export chaperone SecB 0.9158 21 116 GO:0015031
GO:0051082
GO:0051262
AF-A0A3D3ARW2-F1-model_v4 deleted 0.9108 13 116
AF-A0A351DN78-F1-model_v4 Protein-export chaperone SecB 0.9094 13 125 GO:0015031
GO:0051082
GO:0051262

Feature Viewer

pLDDT pTM Quality
81.73 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map