F467000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 296 | 590 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_1056487|Ga0496115_1056487_27_593 |
| Length | 188 |
| Sequence | MSADATTCTLLMQLAAWTPYSILERDMSSNMAGGVPDPNAQGDNGPTLSLQNVYLKDCSYEAPNGPRVDGNWNPQINLDLHTAATGVAPEMTEVVLTVTVAAKQNDATIFLVEVKQAGVFLIRGLNEADTKRAVASLCPSVLFPYARAAVSHLVTQGGFPQFLLPPVNFDALYAQNVAQQQAAPATTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 153 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 168 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 169 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 173 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 180 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 181 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 273 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 277 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 281 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 284 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 288 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 289 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 1.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.24 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 83.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002943 | 3300003203 | Bacteria | 8030 |
| 2 | rootH2_10119640 | 3300003320 | Unclassified | 2025 |
| 3 | JGI25405J52794_10034364 | 3300003911 | Bacteria | 1060 |
| 4 | Ga0058861_11703000 | 3300004800 | Bacteria | 1098 |
| 5 | Ga0058862_12292822 | 3300004803 | Bacteria | 937 |
| 6 | Ga0070683_100025169 | 3300005329 | Bacteria | 5341 |
| 7 | Ga0070683_101484541 | 3300005329 | Bacteria | 652 |
| 8 | Ga0070683_102021182 | 3300005329 | Bacteria | 554 |
| 9 | Ga0070690_100045342 | 3300005330 | Bacteria | 2792 |
| 10 | Ga0070690_100323543 | 3300005330 | Bacteria | 1112 |
| 11 | Ga0068869_100560527 | 3300005334 | Bacteria | 961 |
| 12 | Ga0068869_100717076 | 3300005334 | Bacteria | 854 |
| 13 | Ga0070666_10003267 | 3300005335 | Bacteria | 9844 |
| 14 | Ga0070666_10053482 | 3300005335 | Bacteria | 2723 |
| 15 | Ga0070666_10160004 | 3300005335 | Bacteria | 1574 |
| 16 | Ga0070680_100020097 | 3300005336 | Bacteria | 5296 |
| 17 | Ga0070680_100037741 | 3300005336 | Bacteria | 3905 |
| 18 | Ga0070680_100221000 | 3300005336 | Bacteria | 1599 |
| 19 | Ga0070680_101433492 | 3300005336 | Unclassified | 598 |
| 20 | Ga0068868_100505227 | 3300005338 | Bacteria | 1059 |
| 21 | Ga0068868_101166395 | 3300005338 | Unclassified | 711 |
| 22 | Ga0070691_10365462 | 3300005341 | Bacteria | 805 |
| 23 | Ga0070691_10414016 | 3300005341 | Bacteria | 762 |
| 24 | Ga0070687_100299167 | 3300005343 | Unclassified | 1020 |
| 25 | Ga0070668_100758711 | 3300005347 | Unclassified | 859 |
| 26 | Ga0070671_100022423 | 3300005355 | Bacteria | 5156 |
| 27 | Ga0070671_100023210 | 3300005355 | Bacteria | 5074 |
| 28 | Ga0070671_100096811 | 3300005355 | Bacteria | 2475 |
| 29 | Ga0070674_100265904 | 3300005356 | Bacteria | 1353 |
| 30 | Ga0070673_100076382 | 3300005364 | Bacteria | 2705 |
| 31 | Ga0070667_100041662 | 3300005367 | Bacteria | 3852 |
| 32 | Ga0070667_100055355 | 3300005367 | Bacteria | 3350 |
| 33 | Ga0070667_100058291 | 3300005367 | Bacteria | 3265 |
| 34 | Ga0070667_100332338 | 3300005367 | Bacteria | 1373 |
| 35 | Ga0070667_100369988 | 3300005367 | Bacteria | 1300 |
| 36 | Ga0070709_10212867 | 3300005434 | Bacteria | 1375 |
| 37 | Ga0070714_100005029 | 3300005435 | Bacteria | 10051 |
| 38 | Ga0070714_100309261 | 3300005435 | Bacteria | 1475 |
| 39 | Ga0070714_101189174 | 3300005435 | Unclassified | 744 |
| 40 | Ga0070713_100002285 | 3300005436 | Bacteria | 12459 |
| 41 | Ga0070713_100008164 | 3300005436 | Bacteria | 7413 |
| 42 | Ga0070713_100025923 | 3300005436 | Bacteria | 4593 |
| 43 | Ga0070713_100296672 | 3300005436 | Bacteria | 1487 |
| 44 | Ga0070710_10012175 | 3300005437 | Bacteria | 4264 |
| 45 | Ga0070710_10419495 | 3300005437 | Bacteria | 901 |
| 46 | Ga0070711_100033398 | 3300005439 | Bacteria | 3426 |
| 47 | Ga0070711_100057685 | 3300005439 | Bacteria | 2690 |
| 48 | Ga0070711_100241034 | 3300005439 | Bacteria | 1414 |
| 49 | Ga0070663_100050669 | 3300005455 | Bacteria | 2954 |
| 50 | Ga0070678_100010462 | 3300005456 | Bacteria | 5671 |
| 51 | Ga0070681_10000863 | 3300005458 | Bacteria | 25500 |
| 52 | Ga0070681_10005285 | 3300005458 | Bacteria | 12467 |
| 53 | Ga0070681_10005684 | 3300005458 | Bacteria | 12052 |
| 54 | Ga0070681_10006459 | 3300005458 | Bacteria | 11410 |
| 55 | Ga0070681_10028021 | 3300005458 | Bacteria | 5662 |
| 56 | Ga0070681_10069030 | 3300005458 | Bacteria | 3501 |
| 57 | Ga0070681_10089609 | 3300005458 | Bacteria | 3027 |
| 58 | Ga0070681_10454665 | 3300005458 | Bacteria | 1193 |
| 59 | Ga0070706_101144109 | 3300005467 | Bacteria | 716 |
| 60 | Ga0070699_100851211 | 3300005518 | Bacteria | 835 |
| 61 | Ga0070679_100006602 | 3300005530 | Bacteria | 10811 |
| 62 | Ga0070679_100010385 | 3300005530 | Bacteria | 8831 |
| 63 | Ga0070679_100080444 | 3300005530 | Bacteria | 3248 |
| 64 | Ga0070679_100110487 | 3300005530 | Bacteria | 2735 |
| 65 | Ga0070679_100164013 | 3300005530 | Bacteria | 2196 |
| 66 | Ga0070679_100316992 | 3300005530 | Bacteria | 1509 |
| 67 | Ga0070684_100112949 | 3300005535 | Bacteria | 2437 |
| 68 | Ga0070684_100810187 | 3300005535 | Bacteria | 876 |
| 69 | Ga0068853_100108267 | 3300005539 | Bacteria | 2465 |
| 70 | Ga0068853_101177083 | 3300005539 | Bacteria | 740 |
| 71 | Ga0070686_100018554 | 3300005544 | Unclassified | 4087 |
| 72 | Ga0070686_100841140 | 3300005544 | Bacteria | 743 |
| 73 | Ga0070695_100466886 | 3300005545 | Bacteria | 970 |
| 74 | Ga0070693_100096556 | 3300005547 | Bacteria | 1792 |
| 75 | Ga0070665_100008413 | 3300005548 | Bacteria | 10438 |
| 76 | Ga0070665_100010853 | 3300005548 | Bacteria | 9213 |
| 77 | Ga0070665_100017428 | 3300005548 | Bacteria | 7211 |
| 78 | Ga0070665_100056861 | 3300005548 | Bacteria | 3923 |
| 79 | Ga0070665_100134506 | 3300005548 | Bacteria | 2474 |
| 80 | Ga0070704_100708688 | 3300005549 | Bacteria | 893 |
| 81 | Ga0068855_100004720 | 3300005563 | Bacteria | 16645 |
| 82 | Ga0068855_100013913 | 3300005563 | Bacteria | 9703 |
| 83 | Ga0068855_101675569 | 3300005563 | Bacteria | 649 |
| 84 | Ga0070664_100125155 | 3300005564 | Bacteria | 2254 |
| 85 | Ga0070664_100828109 | 3300005564 | Bacteria | 866 |
| 86 | Ga0068854_100100256 | 3300005578 | Bacteria | 2170 |
| 87 | Ga0068854_100272104 | 3300005578 | Bacteria | 1360 |
| 88 | Ga0068856_100037883 | 3300005614 | Bacteria | 4732 |
| 89 | Ga0068856_100044167 | 3300005614 | Bacteria | 4384 |
| 90 | Ga0068856_100784847 | 3300005614 | Bacteria | 972 |
| 91 | Ga0068856_101560933 | 3300005614 | Bacteria | 674 |
| 92 | Ga0070702_100508285 | 3300005615 | Bacteria | 886 |
| 93 | Ga0068852_102269672 | 3300005616 | Unclassified | 564 |
| 94 | Ga0068859_100000376 | 3300005617 | Bacteria | 44472 |
| 95 | Ga0068864_100195910 | 3300005618 | Bacteria | 1854 |
| 96 | Ga0068866_10007786 | 3300005718 | Bacteria | 4495 |
| 97 | Ga0068861_100045156 | 3300005719 | Bacteria | 3316 |
| 98 | Ga0068861_100718347 | 3300005719 | Bacteria | 930 |
| 99 | Ga0068861_101173753 | 3300005719 | Unclassified | 741 |
| 100 | Ga0068861_101426739 | 3300005719 | Bacteria | 677 |
| 101 | Ga0068851_10066014 | 3300005834 | Bacteria | 1864 |
| 102 | Ga0068863_100003148 | 3300005841 | Bacteria | 16289 |
| 103 | Ga0068863_100006529 | 3300005841 | Bacteria | 11444 |
| 104 | Ga0068863_100052991 | 3300005841 | Bacteria | 3844 |
| 105 | Ga0068863_101051510 | 3300005841 | Bacteria | 818 |
| 106 | Ga0068858_100002387 | 3300005842 | Bacteria | 18997 |
| 107 | Ga0068858_100050576 | 3300005842 | Bacteria | 3846 |
| 108 | Ga0068858_100272080 | 3300005842 | Bacteria | 1612 |
| 109 | Ga0068858_100909719 | 3300005842 | Bacteria | 860 |
| 110 | Ga0068858_100994246 | 3300005842 | Unclassified | 822 |
| 111 | Ga0068860_100003079 | 3300005843 | Bacteria | 17243 |
| 112 | Ga0068860_100020608 | 3300005843 | Bacteria | 6387 |
| 113 | Ga0068860_100030656 | 3300005843 | Bacteria | 5172 |
| 114 | Ga0068862_100008883 | 3300005844 | Bacteria | 8321 |
| 115 | Ga0068862_100211468 | 3300005844 | Bacteria | 1753 |
| 116 | Ga0068862_100315755 | 3300005844 | Bacteria | 1441 |
| 117 | Ga0068862_100455869 | 3300005844 | Unclassified | 1206 |
| 118 | Ga0081455_10002817 | 3300005937 | Bacteria | 20479 |
| 119 | Ga0081455_10289442 | 3300005937 | Bacteria | 1180 |
| 120 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 121 | Ga0081539_10255625 | 3300005985 | Bacteria | 776 |
| 122 | Ga0070717_10004864 | 3300006028 | Bacteria | 9770 |
| 123 | Ga0070715_10000363 | 3300006163 | Bacteria | 11345 |
| 124 | Ga0070716_100016141 | 3300006173 | Bacteria | 3850 |
| 125 | Ga0070716_100390004 | 3300006173 | Bacteria | 998 |
| 126 | Ga0070712_100893926 | 3300006175 | Bacteria | 765 |
| 127 | Ga0097621_100005189 | 3300006237 | Bacteria | 9153 |
| 128 | Ga0097621_100038041 | 3300006237 | Bacteria | 3860 |
| 129 | Ga0097621_100160611 | 3300006237 | Bacteria | 1932 |
| 130 | Ga0068871_100090361 | 3300006358 | Bacteria | 2550 |
| 131 | Ga0068871_100158496 | 3300006358 | Bacteria | 1934 |
| 132 | Ga0068871_100290077 | 3300006358 | Unclassified | 1433 |
| 133 | Ga0068865_100005789 | 3300006881 | Bacteria | 7512 |
| 134 | Ga0068865_100355428 | 3300006881 | Bacteria | 1188 |
| 135 | Ga0075436_100010985 | 3300006914 | Bacteria | 6217 |
| 136 | Ga0075436_100064201 | 3300006914 | Bacteria | 2538 |
| 137 | Ga0075436_101021081 | 3300006914 | Bacteria | 621 |
| 138 | Ga0097620_100000376 | 3300006931 | Bacteria | 44472 |
| 139 | Ga0075435_100080916 | 3300007076 | Bacteria | 2668 |
| 140 | Ga0105250_10014882 | 3300009092 | Bacteria | 3190 |
| 141 | Ga0105240_10005493 | 3300009093 | Bacteria | 18892 |
| 142 | Ga0105240_10005499 | 3300009093 | Bacteria | 18881 |
| 143 | Ga0105240_10005908 | 3300009093 | Bacteria | 18129 |
| 144 | Ga0105240_10014001 | 3300009093 | Bacteria | 10975 |
| 145 | Ga0105240_10036965 | 3300009093 | Bacteria | 6276 |
| 146 | Ga0105240_10051789 | 3300009093 | Bacteria | 5164 |
| 147 | Ga0105240_10090514 | 3300009093 | Bacteria | 3739 |
| 148 | Ga0105240_10159918 | 3300009093 | Bacteria | 2676 |
| 149 | Ga0105240_10238500 | 3300009093 | Bacteria | 2109 |
| 150 | Ga0105240_10550225 | 3300009093 | Unclassified | 1277 |
| 151 | Ga0105240_10950564 | 3300009093 | Bacteria | 922 |
| 152 | Ga0105245_10079403 | 3300009098 | Bacteria | 2996 |
| 153 | Ga0105245_10909409 | 3300009098 | Unclassified | 922 |
| 154 | Ga0105247_10000119 | 3300009101 | Bacteria | 76975 |
| 155 | Ga0105247_10010643 | 3300009101 | Bacteria | 5554 |
| 156 | Ga0105247_10046620 | 3300009101 | Bacteria | 2661 |
| 157 | Ga0105247_10582949 | 3300009101 | Bacteria | 827 |
| 158 | Ga0105241_10004061 | 3300009174 | Bacteria | 10829 |
| 159 | Ga0105241_10123009 | 3300009174 | Bacteria | 2092 |
| 160 | Ga0105242_10050722 | 3300009176 | Bacteria | 3379 |
| 161 | Ga0105248_10007074 | 3300009177 | Bacteria | 12292 |
| 162 | Ga0105248_10007241 | 3300009177 | Bacteria | 12169 |
| 163 | Ga0105248_10261416 | 3300009177 | Bacteria | 1948 |
| 164 | Ga0105237_10017179 | 3300009545 | Bacteria | 7505 |
| 165 | Ga0105237_10017590 | 3300009545 | Bacteria | 7409 |
| 166 | Ga0105237_10151235 | 3300009545 | Bacteria | 2318 |
| 167 | Ga0105237_10190530 | 3300009545 | Bacteria | 2051 |
| 168 | Ga0105237_10405733 | 3300009545 | Unclassified | 1368 |
| 169 | Ga0105237_10565707 | 3300009545 | Bacteria | 1143 |
| 170 | Ga0105238_10011533 | 3300009551 | Bacteria | 8903 |
| 171 | Ga0105238_10085369 | 3300009551 | Bacteria | 3144 |
| 172 | Ga0105238_10156924 | 3300009551 | Bacteria | 2251 |
| 173 | Ga0105238_10202708 | 3300009551 | Bacteria | 1960 |
| 174 | Ga0105238_10277311 | 3300009551 | Bacteria | 1657 |
| 175 | Ga0105249_10076319 | 3300009553 | Bacteria | 3106 |
| 176 | Ga0105249_10165086 | 3300009553 | Bacteria | 2143 |
| 177 | Ga0105249_10829723 | 3300009553 | Bacteria | 989 |
| 178 | Ga0105239_10014313 | 3300010375 | Bacteria | 8800 |
| 179 | Ga0105239_10049357 | 3300010375 | Bacteria | 4615 |
| 180 | Ga0105246_10227695 | 3300011119 | Bacteria | 1466 |
| 181 | Ga0157324_1029359 | 3300012506 | Unclassified | 613 |
| 182 | Ga0157370_10002010 | 3300013104 | Bacteria | 25009 |
| 183 | Ga0157370_10346606 | 3300013104 | Bacteria | 1369 |
| 184 | Ga0157370_10669945 | 3300013104 | Unclassified | 948 |
| 185 | Ga0157369_10018790 | 3300013105 | Bacteria | 7747 |
| 186 | Ga0157369_10041796 | 3300013105 | Bacteria | 5003 |
| 187 | Ga0157369_10591166 | 3300013105 | Bacteria | 1146 |
| 188 | Ga0157374_10040089 | 3300013296 | Bacteria | 4312 |
| 189 | Ga0157374_10146713 | 3300013296 | Bacteria | 2292 |
| 190 | Ga0157374_10266580 | 3300013296 | Bacteria | 1688 |
| 191 | Ga0157374_10465856 | 3300013296 | Bacteria | 1266 |
| 192 | Ga0157374_10814677 | 3300013296 | Bacteria | 950 |
| 193 | Ga0157378_10005124 | 3300013297 | Bacteria | 11505 |
| 194 | Ga0163162_10013023 | 3300013306 | Bacteria | 8118 |
| 195 | Ga0163162_10044693 | 3300013306 | Bacteria | 4437 |
| 196 | Ga0163162_10676262 | 3300013306 | Unclassified | 1155 |
| 197 | Ga0157372_10064040 | 3300013307 | Unclassified | 4124 |
| 198 | Ga0157372_10721281 | 3300013307 | Bacteria | 1160 |
| 199 | Ga0157372_11370992 | 3300013307 | Bacteria | 815 |
| 200 | Ga0157372_12461970 | 3300013307 | Unclassified | 598 |
| 201 | Ga0157375_10116984 | 3300013308 | Bacteria | 2771 |
| 202 | Ga0163163_10050681 | 3300014325 | Bacteria | 4089 |
| 203 | Ga0163163_10114622 | 3300014325 | Bacteria | 2726 |
| 204 | Ga0163163_10142415 | 3300014325 | Bacteria | 2440 |
| 205 | Ga0163163_10173106 | 3300014325 | Bacteria | 2205 |
| 206 | Ga0163163_10236959 | 3300014325 | Bacteria | 1874 |
| 207 | Ga0163163_10248503 | 3300014325 | Unclassified | 1829 |
| 208 | Ga0163163_11161468 | 3300014325 | Bacteria | 835 |
| 209 | Ga0163163_11214019 | 3300014325 | Bacteria | 817 |
| 210 | Ga0157379_10034448 | 3300014968 | Bacteria | 4515 |
| 211 | Ga0157379_10035519 | 3300014968 | Bacteria | 4444 |
| 212 | Ga0157379_10068194 | 3300014968 | Bacteria | 3180 |
| 213 | Ga0157379_10151189 | 3300014968 | Bacteria | 2094 |
| 214 | Ga0157379_10277414 | 3300014968 | Unclassified | 1525 |
| 215 | Ga0157379_11009451 | 3300014968 | Bacteria | 794 |
| 216 | Ga0157376_10530034 | 3300014969 | Bacteria | 1162 |
| 217 | Ga0206354_11374159 | 3300020081 | Bacteria | 1470 |
| 218 | Ga0213874_10006886 | 3300021377 | Bacteria | 2708 |
| 219 | Ga0213874_10309042 | 3300021377 | Bacteria | 597 |
| 220 | Ga0213876_10086919 | 3300021384 | Bacteria | 1655 |
| 221 | Ga0213876_10197013 | 3300021384 | Bacteria | 1071 |
| 222 | Ga0213871_10007505 | 3300021441 | Bacteria | 2362 |
| 223 | Ga0207692_10009583 | 3300025898 | Bacteria | 4052 |
| 224 | Ga0207642_10005903 | 3300025899 | Bacteria | 4033 |
| 225 | Ga0207710_10000584 | 3300025900 | Bacteria | 21566 |
| 226 | Ga0207680_10037800 | 3300025903 | Bacteria | 2789 |
| 227 | Ga0207680_10050083 | 3300025903 | Bacteria | 2490 |
| 228 | Ga0207680_10348345 | 3300025903 | Bacteria | 1040 |
| 229 | Ga0207685_10369804 | 3300025905 | Bacteria | 728 |
| 230 | Ga0207699_10008992 | 3300025906 | Bacteria | 4952 |
| 231 | Ga0207699_10013413 | 3300025906 | Bacteria | 4194 |
| 232 | Ga0207654_10454413 | 3300025911 | Bacteria | 899 |
| 233 | Ga0207707_10000213 | 3300025912 | Bacteria | 61986 |
| 234 | Ga0207707_10004427 | 3300025912 | Bacteria | 12380 |
| 235 | Ga0207707_10006819 | 3300025912 | Bacteria | 9964 |
| 236 | Ga0207707_10007539 | 3300025912 | Bacteria | 9478 |
| 237 | Ga0207707_10097836 | 3300025912 | Bacteria | 2565 |
| 238 | Ga0207707_10193275 | 3300025912 | Bacteria | 1775 |
| 239 | Ga0207707_10200402 | 3300025912 | Bacteria | 1740 |
| 240 | Ga0207695_10007808 | 3300025913 | Bacteria | 13542 |
| 241 | Ga0207695_10066718 | 3300025913 | Unclassified | 3694 |
| 242 | Ga0207695_10067744 | 3300025913 | Bacteria | 3660 |
| 243 | Ga0207695_10075075 | 3300025913 | Bacteria | 3440 |
| 244 | Ga0207695_10117921 | 3300025913 | Bacteria | 2626 |
| 245 | Ga0207695_10268109 | 3300025913 | Bacteria | 1604 |
| 246 | Ga0207695_10289529 | 3300025913 | Bacteria | 1530 |
| 247 | Ga0207695_10306800 | 3300025913 | Bacteria | 1478 |
| 248 | Ga0207695_10322465 | 3300025913 | Unclassified | 1434 |
| 249 | Ga0207695_10672730 | 3300025913 | Bacteria | 916 |
| 250 | Ga0207671_10043684 | 3300025914 | Bacteria | 3314 |
| 251 | Ga0207671_10058800 | 3300025914 | Viruses | 2850 |
| 252 | Ga0207693_10002400 | 3300025915 | Bacteria | 16262 |
| 253 | Ga0207663_10048884 | 3300025916 | Bacteria | 2620 |
| 254 | Ga0207663_10082779 | 3300025916 | Bacteria | 2106 |
| 255 | Ga0207660_10058589 | 3300025917 | Bacteria | 2762 |
| 256 | Ga0207660_10087119 | 3300025917 | Bacteria | 2307 |
| 257 | Ga0207660_10148542 | 3300025917 | Bacteria | 1799 |
| 258 | Ga0207660_10152080 | 3300025917 | Bacteria | 1779 |
| 259 | Ga0207660_10219827 | 3300025917 | Bacteria | 1490 |
| 260 | Ga0207660_10237952 | 3300025917 | Bacteria | 1434 |
| 261 | Ga0207652_10001434 | 3300025921 | Bacteria | 21125 |
| 262 | Ga0207652_10006797 | 3300025921 | Bacteria | 9220 |
| 263 | Ga0207652_10076517 | 3300025921 | Bacteria | 2919 |
| 264 | Ga0207652_10100506 | 3300025921 | Bacteria | 2553 |
| 265 | Ga0207652_10315327 | 3300025921 | Bacteria | 1411 |
| 266 | Ga0207652_10767439 | 3300025921 | Bacteria | 857 |
| 267 | Ga0207694_10006364 | 3300025924 | Bacteria | 9005 |
| 268 | Ga0207694_10013501 | 3300025924 | Bacteria | 6153 |
| 269 | Ga0207694_10392284 | 3300025924 | Bacteria | 1153 |
| 270 | Ga0207694_10502721 | 3300025924 | Unclassified | 1015 |
| 271 | Ga0207694_10640594 | 3300025924 | Bacteria | 895 |
| 272 | Ga0207650_10548314 | 3300025925 | Bacteria | 969 |
| 273 | Ga0207700_10049869 | 3300025928 | Bacteria | 3116 |
| 274 | Ga0207700_10113895 | 3300025928 | Bacteria | 2181 |
| 275 | Ga0207700_10148296 | 3300025928 | Bacteria | 1936 |
| 276 | Ga0207700_10515559 | 3300025928 | Bacteria | 1059 |
| 277 | Ga0207664_10281246 | 3300025929 | Bacteria | 1460 |
| 278 | Ga0207644_10012392 | 3300025931 | Bacteria | 5662 |
| 279 | Ga0207644_10267570 | 3300025931 | Unclassified | 1368 |
| 280 | Ga0207644_10382807 | 3300025931 | Bacteria | 1147 |
| 281 | Ga0207686_10143391 | 3300025934 | Bacteria | 1654 |
| 282 | Ga0207686_10342104 | 3300025934 | Bacteria | 1124 |
| 283 | Ga0207669_10273562 | 3300025937 | Bacteria | 1270 |
| 284 | Ga0207704_10239663 | 3300025938 | Bacteria | 1354 |
| 285 | Ga0207704_11049825 | 3300025938 | Unclassified | 691 |
| 286 | Ga0207665_10003249 | 3300025939 | Bacteria | 10881 |
| 287 | Ga0207665_10336404 | 3300025939 | Bacteria | 1136 |
| 288 | Ga0207691_10282536 | 3300025940 | Bacteria | 1428 |
| 289 | Ga0207711_10059125 | 3300025941 | Bacteria | 3300 |
| 290 | Ga0207711_10237575 | 3300025941 | Bacteria | 1670 |
| 291 | Ga0207661_10235066 | 3300025944 | Bacteria | 1624 |
| 292 | Ga0207679_11102387 | 3300025945 | Bacteria | 728 |
| 293 | Ga0207667_10003935 | 3300025949 | Bacteria | 18274 |
| 294 | Ga0207667_10046714 | 3300025949 | Bacteria | 4585 |
| 295 | Ga0207667_10080827 | 3300025949 | Unclassified | 3367 |
| 296 | Ga0207651_10083362 | 3300025960 | Bacteria | 2312 |
| 297 | Ga0207712_10045757 | 3300025961 | Unclassified | 3032 |
| 298 | Ga0207712_10079635 | 3300025961 | Bacteria | 2380 |
| 299 | Ga0207712_10106949 | 3300025961 | Bacteria | 2091 |
| 300 | Ga0207712_10709712 | 3300025961 | Bacteria | 878 |
| 301 | Ga0207640_10084686 | 3300025981 | Bacteria | 2178 |
| 302 | Ga0207640_11499474 | 3300025981 | Bacteria | 606 |
| 303 | Ga0207658_10009211 | 3300025986 | Bacteria | 6693 |
| 304 | Ga0207658_10023297 | 3300025986 | Bacteria | 4321 |
| 305 | Ga0207658_10908864 | 3300025986 | Unclassified | 802 |
| 306 | Ga0207677_11879485 | 3300026023 | Bacteria | 556 |
| 307 | Ga0207703_10001857 | 3300026035 | Bacteria | 18781 |
| 308 | Ga0207703_10013445 | 3300026035 | Bacteria | 6375 |
| 309 | Ga0207703_10075043 | 3300026035 | Bacteria | 2801 |
| 310 | Ga0207703_10404235 | 3300026035 | Bacteria | 1268 |
| 311 | Ga0207703_10704980 | 3300026035 | Unclassified | 960 |
| 312 | Ga0207639_11196655 | 3300026041 | Bacteria | 713 |
| 313 | Ga0207678_10010959 | 3300026067 | Bacteria | 7967 |
| 314 | Ga0207702_10027808 | 3300026078 | Bacteria | 4698 |
| 315 | Ga0207702_10052499 | 3300026078 | Bacteria | 3449 |
| 316 | Ga0207702_10217347 | 3300026078 | Bacteria | 1780 |
| 317 | Ga0207702_10714155 | 3300026078 | Bacteria | 988 |
| 318 | Ga0207641_10002848 | 3300026088 | Bacteria | 15721 |
| 319 | Ga0207641_10025361 | 3300026088 | Bacteria | 4888 |
| 320 | Ga0207641_10246015 | 3300026088 | Bacteria | 1668 |
| 321 | Ga0207676_10835823 | 3300026095 | Bacteria | 900 |
| 322 | Ga0207675_100079258 | 3300026118 | Bacteria | 3077 |
| 323 | Ga0207675_100567168 | 3300026118 | Bacteria | 1136 |
| 324 | Ga0207675_101056992 | 3300026118 | Unclassified | 831 |
| 325 | Ga0207675_102389458 | 3300026118 | Unclassified | 541 |
| 326 | Ga0207683_10001886 | 3300026121 | Bacteria | 18558 |
| 327 | Ga0207698_10230176 | 3300026142 | Bacteria | 1682 |
| 328 | Ga0207698_11508036 | 3300026142 | Unclassified | 688 |
| 329 | Ga0268266_10000926 | 3300028379 | Bacteria | 37537 |
| 330 | Ga0268266_10017254 | 3300028379 | Bacteria | 6164 |
| 331 | Ga0268266_10034382 | 3300028379 | Bacteria | 4311 |
| 332 | Ga0268266_10063145 | 3300028379 | Bacteria | 3197 |
| 333 | Ga0268266_10076380 | 3300028379 | Unclassified | 2911 |
| 334 | Ga0268266_10170621 | 3300028379 | Bacteria | 1974 |
| 335 | Ga0268265_10012800 | 3300028380 | Bacteria | 5696 |
| 336 | Ga0268265_10346400 | 3300028380 | Bacteria | 1355 |
| 337 | Ga0268265_10439022 | 3300028380 | Unclassified | 1216 |
| 338 | Ga0268265_10724782 | 3300028380 | Bacteria | 963 |
| 339 | Ga0268264_10000308 | 3300028381 | Bacteria | 78708 |
| 340 | Ga0268264_10018548 | 3300028381 | Bacteria | 5690 |
| 341 | Ga0265334_10015305 | 3300028573 | Bacteria | 3188 |
| 342 | Ga0307517_10447696 | 3300028786 | Bacteria | 670 |
| 343 | Ga0307515_10049570 | 3300028794 | Bacteria | 6312 |
| 344 | Ga0307511_10000793 | 3300030521 | Bacteria | 33672 |
| 345 | Ga0265339_10050493 | 3300031249 | Bacteria | 2274 |
| 346 | Ga0307513_10161627 | 3300031456 | Bacteria | 2131 |
| 347 | Ga0307513_10605137 | 3300031456 | Bacteria | 805 |
| 348 | Ga0307509_10000008 | 3300031507 | Bacteria | 354271 |
| 349 | Ga0307509_10269132 | 3300031507 | Bacteria | 1473 |
| 350 | Ga0307509_10315944 | 3300031507 | Bacteria | 1302 |
| 351 | Ga0307408_100150990 | 3300031548 | Bacteria | 1834 |
| 352 | Ga0307405_10817946 | 3300031731 | Bacteria | 782 |
| 353 | Ga0307406_10294092 | 3300031901 | Bacteria | 1245 |
| 354 | Ga0307407_10783032 | 3300031903 | Unclassified | 724 |
| 355 | Ga0307412_10065605 | 3300031911 | Bacteria | 2458 |
| 356 | Ga0307409_100069221 | 3300031995 | Bacteria | 2795 |
| 357 | Ga0307411_10534028 | 3300032005 | Bacteria | 998 |
| 358 | Ga0307415_101944020 | 3300032126 | Bacteria | 572 |
| 359 | Ga0307510_10000004 | 3300033180 | Bacteria | 654130 |
| 360 | Ga0373926_0354080 | 3300035083 | Bacteria | 577 |
| 361 | Ga0373957_0039504 | 3300035120 | Bacteria | 1770 |
| 362 | Ga0373943_0020088 | 3300035170 | Bacteria | 3077 |
| 363 | Ga0373955_0111296 | 3300035172 | Bacteria | 1583 |
| 364 | Ga0373935_0117191 | 3300035692 | Bacteria | 1775 |
| 365 | Ga0373947_0015434 | 3300035725 | Bacteria | 4385 |
| 366 | Ga0373937_0279663 | 3300036401 | Unclassified | 1576 |
| 367 | Ga0373937_0859630 | 3300036401 | Bacteria | 855 |
| 368 | Ga0373925_0128033 | 3300037068 | Bacteria | 1977 |
| 369 | Ga0395900_0475763 | 3300037418 | Bacteria | 1202 |
| 370 | Ga0395898_0004801 | 3300037466 | Bacteria | 14712 |
| 371 | Ga0395898_0413210 | 3300037466 | Bacteria | 1286 |
| 372 | Ga0436364_0530634 | 3300037853 | Bacteria | 1002 |
| 373 | Ga0436365_0375377 | 3300039437 | Bacteria | 11163 |
| 374 | Ga0436365_0885394 | 3300039437 | Unclassified | 1625 |
| 375 | Ga0436365_1342030 | 3300039437 | Bacteria | 983 |
| 376 | Ga0436365_1796110 | 3300039437 | Bacteria | 3553 |
| 377 | Ga0436360_0346195 | 3300039438 | Bacteria | 2056 |
| 378 | Ga0436360_0419016 | 3300039438 | Bacteria | 3607 |
| 379 | Ga0436361_0169415 | 3300039447 | Bacteria | 626 |
| 380 | Ga0436361_0544715 | 3300039447 | Bacteria | 798 |
| 381 | Ga0436363_0122190 | 3300039450 | Bacteria | 1576 |
| 382 | Ga0436363_0475575 | 3300039450 | Bacteria | 6155 |
| 383 | Ga0436363_1137318 | 3300039450 | Bacteria | 1922 |
| 384 | Ga0436362_0605076 | 3300039453 | Bacteria | 836 |
| 385 | Ga0436362_0778749 | 3300039453 | Bacteria | 2412 |
| 386 | Ga0436362_0826555 | 3300039453 | Bacteria | 2069 |
| 387 | Ga0436362_0933727 | 3300039453 | Bacteria | 1089 |
| 388 | Ga0436362_1184014 | 3300039453 | Bacteria | 3757 |
| 389 | Ga0439453_0031784 | 3300041408 | Bacteria | 1003 |
| 390 | Ga0451797_1164725 | 3300041453 | Bacteria | 1386 |
| 391 | Ga0451800_1574258 | 3300041459 | Unclassified | 532 |
| 392 | Ga0451807_1232526 | 3300041486 | Unclassified | 688 |
| 393 | Ga0451837_1645436 | 3300041494 | Unclassified | 751 |
| 394 | Ga0439435_0021281 | 3300042436 | Bacteria | 1682 |
| 395 | Ga0466969_0000245 | 3300044656 | Bacteria | 29788 |
| 396 | Ga0466969_0039150 | 3300044656 | Bacteria | 2382 |
| 397 | Ga0466969_0061163 | 3300044656 | Bacteria | 1830 |
| 398 | Ga0466969_0100870 | 3300044656 | Bacteria | 1359 |
| 399 | Ga0466972_0027888 | 3300044658 | Bacteria | 2791 |
| 400 | Ga0466972_0049994 | 3300044658 | Bacteria | 2019 |
| 401 | Ga0466966_0002009 | 3300044684 | Bacteria | 13206 |
| 402 | Ga0466966_0125007 | 3300044684 | Bacteria | 1578 |
| 403 | Ga0466966_0155606 | 3300044684 | Bacteria | 1393 |
| 404 | Ga0466966_0352001 | 3300044684 | Bacteria | 885 |
| 405 | Ga0466961_0001203 | 3300044693 | Bacteria | 15940 |
| 406 | Ga0466964_0000188 | 3300044706 | Bacteria | 17072 |
| 407 | Ga0453684_1049421 | 3300044712 | Bacteria | 864 |
| 408 | Ga0466971_0000534 | 3300044719 | Bacteria | 15058 |
| 409 | Ga0466968_0284202 | 3300044735 | Bacteria | 792 |
| 410 | Ga0466970_0002030 | 3300044765 | Bacteria | 9800 |
| 411 | Ga0466957_0003911 | 3300044842 | Bacteria | 8239 |
| 412 | Ga0466959_0000706 | 3300045049 | Bacteria | 19525 |
| 413 | Ga0466959_0003041 | 3300045049 | Bacteria | 10848 |
| 414 | Ga0466959_0010227 | 3300045049 | Bacteria | 6700 |
| 415 | Ga0466959_0030139 | 3300045049 | Bacteria | 4018 |
| 416 | Ga0466959_0811169 | 3300045049 | Bacteria | 625 |
| 417 | Ga0451576_0356502 | 3300045051 | Unclassified | 1531 |
| 418 | Ga0451576_1135409 | 3300045051 | Bacteria | 817 |
| 419 | Ga0466958_0088068 | 3300045836 | Bacteria | 1918 |
| 420 | Ga0466958_0277212 | 3300045836 | Unclassified | 1074 |
| 421 | Ga0466967_1319199 | 3300045976 | Bacteria | 719 |
| 422 | Ga0495603_0195677 | 3300046455 | Bacteria | 1169 |
| 423 | Ga0495590_0208898 | 3300046457 | Unclassified | 719 |
| 424 | Ga0495591_029904 | 3300046458 | Bacteria | 1650 |
| 425 | Ga0495629_0294120 | 3300046459 | Bacteria | 1113 |
| 426 | Ga0495629_0382110 | 3300046459 | Bacteria | 958 |
| 427 | Ga0495638_0300446 | 3300046460 | Bacteria | 865 |
| 428 | Ga0495580_0021479 | 3300046472 | Bacteria | 4762 |
| 429 | Ga0495582_0118594 | 3300046473 | Bacteria | 1490 |
| 430 | Ga0495639_0174106 | 3300046475 | Bacteria | 1046 |
| 431 | Ga0495606_0061073 | 3300046507 | Bacteria | 2412 |
| 432 | Ga0495606_0494508 | 3300046507 | Unclassified | 619 |
| 433 | Ga0495630_0183445 | 3300046517 | Bacteria | 1596 |
| 434 | Ga0495632_0099969 | 3300046519 | Bacteria | 1367 |
| 435 | Ga0495632_0162963 | 3300046519 | Bacteria | 1026 |
| 436 | Ga0495644_0014518 | 3300046523 | Bacteria | 3017 |
| 437 | Ga0495666_0239774 | 3300046526 | Bacteria | 828 |
| 438 | Ga0495642_0156200 | 3300046528 | Bacteria | 988 |
| 439 | Ga0495586_0160474 | 3300046535 | Bacteria | 1268 |
| 440 | Ga0495586_0294992 | 3300046535 | Unclassified | 929 |
| 441 | Ga0495621_0000091 | 3300046539 | Bacteria | 18251 |
| 442 | Ga0495597_0080012 | 3300046542 | Bacteria | 1399 |
| 443 | Ga0495645_0388157 | 3300046543 | Bacteria | 892 |
| 444 | Ga0495622_0178568 | 3300046557 | Bacteria | 953 |
| 445 | Ga0495668_0735085 | 3300046616 | Unclassified | 546 |
| 446 | Ga0495625_0076177 | 3300046660 | Bacteria | 2346 |
| 447 | Ga0495647_0005576 | 3300046681 | Bacteria | 4131 |
| 448 | Ga0495647_0091182 | 3300046681 | Bacteria | 1250 |
| 449 | Ga0495658_0118811 | 3300046683 | Bacteria | 1597 |
| 450 | Ga0495658_0184425 | 3300046683 | Bacteria | 1295 |
| 451 | Ga0495671_0009176 | 3300046692 | Bacteria | 5534 |
| 452 | Ga0495674_0138144 | 3300047319 | Bacteria | 2050 |
| 453 | Ga0495683_0294930 | 3300047323 | Bacteria | 698 |
| 454 | Ga0495687_017826 | 3300047443 | Bacteria | 3527 |
| 455 | Ga0495687_032862 | 3300047443 | Bacteria | 2362 |
| 456 | Ga0495681_0016395 | 3300047470 | Bacteria | 4155 |
| 457 | Ga0496100_0059578 | 3300048903 | Bacteria | 2509 |
| 458 | Ga0496100_0166261 | 3300048903 | Bacteria | 1585 |
| 459 | Ga0496101_0123071 | 3300048904 | Bacteria | 1963 |
| 460 | Ga0496101_0229814 | 3300048904 | Bacteria | 1441 |
| 461 | Ga0496102_0008566 | 3300048905 | Bacteria | 8772 |
| 462 | Ga0496102_0148863 | 3300048905 | Bacteria | 2198 |
| 463 | Ga0496102_0248973 | 3300048905 | Bacteria | 1675 |
| 464 | Ga0496103_0049426 | 3300048906 | Bacteria | 2600 |
| 465 | Ga0496103_0063295 | 3300048906 | Bacteria | 2304 |
| 466 | Ga0496104_0075089 | 3300048907 | Bacteria | 3219 |
| 467 | Ga0496104_0242029 | 3300048907 | Bacteria | 1716 |
| 468 | Ga0496105_0191388 | 3300048908 | Bacteria | 1672 |
| 469 | Ga0496106_0055434 | 3300048909 | Bacteria | 2996 |
| 470 | Ga0496106_0217635 | 3300048909 | Bacteria | 1522 |
| 471 | Ga0496107_0038151 | 3300048910 | Bacteria | 3447 |
| 472 | Ga0496108_0004541 | 3300048911 | Bacteria | 11179 |
| 473 | Ga0496108_0067997 | 3300048911 | Bacteria | 3005 |
| 474 | Ga0496109_0036912 | 3300048912 | Bacteria | 4413 |
| 475 | Ga0496109_0353058 | 3300048912 | Bacteria | 1389 |
| 476 | Ga0496110_0013721 | 3300048913 | Bacteria | 6712 |
| 477 | Ga0496111_0022901 | 3300048914 | Bacteria | 4379 |
| 478 | Ga0496112_0055308 | 3300048915 | Bacteria | 3902 |
| 479 | Ga0496112_0318261 | 3300048915 | Bacteria | 1500 |
| 480 | Ga0496113_0107284 | 3300048916 | Bacteria | 2170 |
| 481 | Ga0496115_0050011 | 3300048918 | Bacteria | 3347 |
| 482 | Ga0496115_1056487 | 3300048918 | Bacteria | 618 |
| 483 | Ga0496116_0022031 | 3300048919 | Bacteria | 4791 |
| 484 | Ga0496117_0000189 | 3300048920 | Bacteria | 126216 |
| 485 | Ga0496118_0000111 | 3300048921 | Bacteria | 152562 |
| 486 | Ga0496118_0134680 | 3300048921 | Bacteria | 1579 |
| 487 | Ga0496119_0001233 | 3300048922 | Bacteria | 31872 |
| 488 | Ga0496119_0010407 | 3300048922 | Bacteria | 7833 |
| 489 | Ga0496119_0020667 | 3300048922 | Bacteria | 4790 |
| 490 | Ga0496120_0000025 | 3300048923 | Bacteria | 235805 |
| 491 | Ga0496120_0025102 | 3300048923 | Bacteria | 3703 |
| 492 | Ga0496120_0050239 | 3300048923 | Bacteria | 2388 |
| 493 | Ga0496121_0001977 | 3300048924 | Bacteria | 32562 |
| 494 | Ga0496125_0001162 | 3300048928 | Bacteria | 39894 |
| 495 | Ga0496125_0006098 | 3300048928 | Bacteria | 13159 |
| 496 | Ga0496125_0062432 | 3300048928 | Bacteria | 2979 |
| 497 | Ga0496126_0000545 | 3300048929 | Bacteria | 72745 |
| 498 | Ga0496126_0012241 | 3300048929 | Bacteria | 8800 |
| 499 | Ga0496126_0098554 | 3300048929 | Bacteria | 2561 |
| 500 | Ga0496126_0112064 | 3300048929 | Bacteria | 2376 |
| 501 | Ga0496126_0486570 | 3300048929 | Unclassified | 988 |
| 502 | Ga0501031_0102608 | 3300049568 | Bacteria | 1866 |
| 503 | Ga0501031_0259487 | 3300049568 | Bacteria | 1129 |
| 504 | Ga0501032_0158037 | 3300049569 | Bacteria | 1489 |
| 505 | Ga0501033_0047574 | 3300049570 | Bacteria | 3189 |
| 506 | Ga0501033_0223856 | 3300049570 | Bacteria | 1338 |
| 507 | Ga0501036_0014258 | 3300049572 | Bacteria | 6614 |
| 508 | Ga0501037_0100608 | 3300049573 | Bacteria | 2087 |
| 509 | Ga0501038_0006611 | 3300049574 | Bacteria | 10726 |
| 510 | Ga0501038_0148756 | 3300049574 | Bacteria | 1910 |
| 511 | Ga0501039_0009656 | 3300049575 | Bacteria | 7356 |
| 512 | Ga0501039_0089946 | 3300049575 | Bacteria | 2392 |
| 513 | Ga0501040_0000602 | 3300049576 | Bacteria | 21944 |
| 514 | Ga0501040_0020838 | 3300049576 | Bacteria | 4371 |
| 515 | Ga0501041_0031439 | 3300049577 | Bacteria | 3207 |
| 516 | Ga0501041_0199985 | 3300049577 | Bacteria | 1252 |
| 517 | Ga0501042_0006737 | 3300049578 | Bacteria | 7488 |
| 518 | Ga0501042_0032301 | 3300049578 | Bacteria | 3706 |
| 519 | Ga0501043_0125209 | 3300049579 | Bacteria | 2015 |
| 520 | Ga0501043_0918610 | 3300049579 | Unclassified | 627 |
| 521 | Ga0501046_0026264 | 3300049580 | Bacteria | 4755 |
| 522 | Ga0501046_0028966 | 3300049580 | Bacteria | 4506 |
| 523 | Ga0501048_0020464 | 3300049582 | Bacteria | 4849 |
| 524 | Ga0501048_0040418 | 3300049582 | Bacteria | 3342 |
| 525 | Ga0501068_0016459 | 3300049584 | Bacteria | 4263 |
| 526 | Ga0501068_0208195 | 3300049584 | Bacteria | 1241 |
| 527 | Ga0501069_0248358 | 3300049585 | Bacteria | 1038 |
| 528 | Ga0501070_0889599 | 3300049586 | Unclassified | 695 |
| 529 | Ga0501071_0004207 | 3300049587 | Bacteria | 9111 |
| 530 | Ga0501071_0018289 | 3300049587 | Bacteria | 4850 |
| 531 | Ga0501072_0002188 | 3300049588 | Bacteria | 14605 |
| 532 | Ga0501072_0005867 | 3300049588 | Bacteria | 9353 |
| 533 | Ga0501073_0064965 | 3300049589 | Bacteria | 2545 |
| 534 | Ga0501074_0016923 | 3300049590 | Bacteria | 5290 |
| 535 | Ga0501074_0041022 | 3300049590 | Bacteria | 3351 |
| 536 | Ga0501075_0008811 | 3300049591 | Bacteria | 7032 |
| 537 | Ga0501075_0060771 | 3300049591 | Bacteria | 2846 |
| 538 | Ga0501076_0001300 | 3300049592 | Bacteria | 16672 |
| 539 | Ga0501076_0338525 | 3300049592 | Bacteria | 1234 |
| 540 | Ga0501077_0000947 | 3300049593 | Bacteria | 17478 |
| 541 | Ga0501079_0000487 | 3300049741 | Bacteria | 26110 |
| 542 | Ga0501079_0006973 | 3300049741 | Bacteria | 8516 |
| 543 | Ga0501079_0935787 | 3300049741 | Bacteria | 682 |
| 544 | Ga0501080_0002859 | 3300049742 | Bacteria | 15180 |
| 545 | Ga0501081_0000652 | 3300049743 | Bacteria | 19843 |
| 546 | Ga0501081_0062061 | 3300049743 | Bacteria | 2591 |
| 547 | Ga0501083_0043399 | 3300049744 | Bacteria | 3047 |
| 548 | Ga0501083_0187986 | 3300049744 | Bacteria | 1348 |
| 549 | Ga0501035_0007719 | 3300049822 | Bacteria | 10049 |
| 550 | Ga0501035_0060634 | 3300049822 | Bacteria | 3368 |
| 551 | Ga0501044_0656943 | 3300049823 | Bacteria | 937 |
| 552 | Ga0501045_0001321 | 3300049824 | Bacteria | 16460 |
| 553 | Ga0501045_0015814 | 3300049824 | Bacteria | 5351 |
| 554 | nmdc:mga08x19_798372_c1 | 3300050514 | Bacteria | 670 |
| 555 | Ga0495601_0188253 | 3300053077 | Bacteria | 1349 |
| 556 | Ga0500644_0116172 | 3300053088 | Bacteria | 1037 |
| 557 | Ga0500583_0013741 | 3300053092 | Bacteria | 3143 |
| 558 | Ga0500641_0034442 | 3300053096 | Bacteria | 2016 |
| 559 | Ga0500641_0159913 | 3300053096 | Bacteria | 971 |
| 560 | Ga0500556_0000260 | 3300053104 | Bacteria | 42121 |
| 561 | Ga0500556_0071245 | 3300053104 | Bacteria | 1298 |
| 562 | Ga0500556_0116080 | 3300053104 | Bacteria | 1041 |
| 563 | Ga0500572_159242 | 3300053111 | Bacteria | 739 |
| 564 | Ga0500591_024205 | 3300053115 | Bacteria | 2948 |
| 565 | Ga0500595_010853 | 3300053119 | Bacteria | 3597 |
| 566 | Ga0500617_053167 | 3300053124 | Bacteria | 1804 |
| 567 | Ga0500642_0183027 | 3300053130 | Bacteria | 979 |
| 568 | Ga0500642_0439715 | 3300053130 | Bacteria | 562 |
| 569 | Ga0500652_060627 | 3300053131 | Bacteria | 1557 |
| 570 | Ga0500658_0067067 | 3300053134 | Bacteria | 1506 |
| 571 | Ga0500658_0361366 | 3300053134 | Bacteria | 666 |
| 572 | Ga0500559_0432771 | 3300053136 | Unclassified | 610 |
| 573 | Ga0500579_183962 | 3300053143 | Bacteria | 815 |
| 574 | Ga0500588_0002216 | 3300053146 | Bacteria | 3901 |
| 575 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 576 | Ga0500627_0217696 | 3300053158 | Bacteria | 853 |
| 577 | Ga0500639_266695 | 3300053163 | Bacteria | 672 |
| 578 | Ga0500637_0005730 | 3300053178 | Bacteria | 6048 |
| 579 | Ga0500637_0121594 | 3300053178 | Bacteria | 1515 |
| 580 | Ga0500596_027380 | 3300053735 | Bacteria | 875 |
| 581 | Ga0501084_0008006 | 3300054114 | Bacteria | 8702 |
| 582 | Ga0501084_0075563 | 3300054114 | Bacteria | 2822 |
| 583 | Ga0587077_081383 | 3300059493 | Bacteria | 744 |
| 584 | Ga0587088_077463 | 3300059508 | Bacteria | 705 |
| 585 | Ga0587072_063418 | 3300059643 | Bacteria | 766 |
| 586 | Ga0501082_0004570 | 3300060353 | Bacteria | 12084 |
| 587 | Ga0501082_0059231 | 3300060353 | Bacteria | 3300 |
| 588 | Ga0501082_0646681 | 3300060353 | Bacteria | 925 |
| 589 | Ga0466962_0000370 | 3300061719 | Bacteria | 19378 |
| 590 | Ga0530510_0032835 | 3300061734 | Bacteria | 3735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031249 | Ga0265339_10050493 | Ga0265339_100504934 | 149 |
| 2 | 3300031995 | Ga0307409_100069221 | Ga0307409_1000692213 | 149 |
| 3 | 3300032005 | Ga0307411_10534028 | Ga0307411_105340282 | 149 |
| 4 | 3300032126 | Ga0307415_101944020 | Ga0307415_1019440201 | 149 |
| 5 | 3300047443 | Ga0495687_032862 | Ga0495687_032862_845_1312 | 149 |
| 6 | 3300005435 | Ga0070714_100005029 | Ga0070714_1000050295 | 150 |
| 7 | 3300005436 | Ga0070713_100008164 | Ga0070713_1000081645 | 150 |
| 8 | 3300005439 | Ga0070711_100241034 | Ga0070711_1002410342 | 150 |
| 9 | 3300005467 | Ga0070706_101144109 | Ga0070706_1011441091 | 150 |
| 10 | 3300005614 | Ga0068856_100037883 | Ga0068856_1000378834 | 150 |
| 11 | 3300006028 | Ga0070717_10004864 | Ga0070717_100048648 | 150 |
| 12 | 3300006173 | Ga0070716_100390004 | Ga0070716_1003900042 | 150 |
| 13 | 3300006914 | Ga0075436_100010985 | Ga0075436_1000109852 | 150 |
| 14 | 3300006914 | Ga0075436_101021081 | Ga0075436_1010210811 | 150 |
| 15 | 3300007076 | Ga0075435_100080916 | Ga0075435_1000809161 | 150 |
| 16 | 3300009092 | Ga0105250_10014882 | Ga0105250_100148824 | 150 |
| 17 | 3300009101 | Ga0105247_10000119 | Ga0105247_1000011958 | 150 |
| 18 | 3300009101 | Ga0105247_10010643 | Ga0105247_100106435 | 150 |
| 19 | 3300009177 | Ga0105248_10007241 | Ga0105248_100072414 | 150 |
| 20 | 3300009177 | Ga0105248_10261416 | Ga0105248_102614162 | 150 |
| 21 | 3300009553 | Ga0105249_10076319 | Ga0105249_100763192 | 150 |
| 22 | 3300009553 | Ga0105249_10165086 | Ga0105249_101650862 | 150 |
| 23 | 3300012506 | Ga0157324_1029359 | Ga0157324_10293592 | 150 |
| 24 | 3300013296 | Ga0157374_10146713 | Ga0157374_101467132 | 150 |
| 25 | 3300013306 | Ga0163162_10044693 | Ga0163162_100446932 | 150 |
| 26 | 3300013306 | Ga0163162_10676262 | Ga0163162_106762622 | 150 |
| 27 | 3300014325 | Ga0163163_10248503 | Ga0163163_102485031 | 150 |
| 28 | 3300014968 | Ga0157379_10034448 | Ga0157379_100344485 | 150 |
| 29 | 3300014968 | Ga0157379_11009451 | Ga0157379_110094512 | 150 |
| 30 | 3300021441 | Ga0213871_10007505 | Ga0213871_100075053 | 150 |
| 31 | 3300025906 | Ga0207699_10013413 | Ga0207699_100134134 | 150 |
| 32 | 3300025928 | Ga0207700_10113895 | Ga0207700_101138952 | 150 |
| 33 | 3300025938 | Ga0207704_11049825 | Ga0207704_110498252 | 150 |
| 34 | 3300025939 | Ga0207665_10336404 | Ga0207665_103364042 | 150 |
| 35 | 3300026078 | Ga0207702_10027808 | Ga0207702_100278082 | 150 |
| 36 | 3300039438 | Ga0436360_0419016 | Ga0436360_0419016_870_1340 | 150 |
| 37 | 3300039447 | Ga0436361_0544715 | Ga0436361_0544715_233_703 | 150 |
| 38 | 3300041459 | Ga0451800_1574258 | Ga0451800_1574258_50_520 | 150 |
| 39 | 3300044712 | Ga0453684_1049421 | Ga0453684_1049421_11_481 | 150 |
| 40 | 3300045051 | Ga0451576_0356502 | Ga0451576_0356502_512_982 | 150 |
| 41 | 3300046457 | Ga0495590_0208898 | Ga0495590_0208898_239_709 | 150 |
| 42 | 3300046507 | Ga0495606_0494508 | Ga0495606_0494508_86_553 | 150 |
| 43 | 3300048904 | Ga0496101_0123071 | Ga0496101_0123071_1074_1544 | 150 |
| 44 | 3300048905 | Ga0496102_0248973 | Ga0496102_0248973_1104_1574 | 150 |
| 45 | 3300048907 | Ga0496104_0075089 | Ga0496104_0075089_2259_2729 | 150 |
| 46 | 3300048909 | Ga0496106_0055434 | Ga0496106_0055434_1958_2428 | 150 |
| 47 | 3300048911 | Ga0496108_0067997 | Ga0496108_0067997_1186_1656 | 150 |
| 48 | 3300048912 | Ga0496109_0353058 | Ga0496109_0353058_166_636 | 150 |
| 49 | 3300048915 | Ga0496112_0055308 | Ga0496112_0055308_2935_3405 | 150 |
| 50 | 3300048921 | Ga0496118_0134680 | Ga0496118_0134680_504_974 | 150 |
| 51 | 3300048924 | Ga0496121_0001977 | Ga0496121_0001977_11944_12414 | 150 |
| 52 | 3300048928 | Ga0496125_0001162 | Ga0496125_0001162_29022_29492 | 150 |
| 53 | 3300048928 | Ga0496125_0006098 | Ga0496125_0006098_12110_12580 | 150 |
| 54 | 3300048929 | Ga0496126_0112064 | Ga0496126_0112064_1533_2003 | 150 |
| 55 | 3300048929 | Ga0496126_0486570 | Ga0496126_0486570_383_853 | 150 |
| 56 | 3300049568 | Ga0501031_0102608 | Ga0501031_0102608_1195_1659 | 150 |
| 57 | 3300049569 | Ga0501032_0158037 | Ga0501032_0158037_49_513 | 150 |
| 58 | 3300049570 | Ga0501033_0223856 | Ga0501033_0223856_814_1278 | 150 |
| 59 | 3300049572 | Ga0501036_0014258 | Ga0501036_0014258_4524_4988 | 150 |
| 60 | 3300049574 | Ga0501038_0006611 | Ga0501038_0006611_7754_8218 | 150 |
| 61 | 3300049575 | Ga0501039_0009656 | Ga0501039_0009656_692_1156 | 150 |
| 62 | 3300049576 | Ga0501040_0000602 | Ga0501040_0000602_20808_21272 | 150 |
| 63 | 3300049577 | Ga0501041_0199985 | Ga0501041_0199985_729_1193 | 150 |
| 64 | 3300049578 | Ga0501042_0032301 | Ga0501042_0032301_3221_3685 | 150 |
| 65 | 3300049580 | Ga0501046_0026264 | Ga0501046_0026264_464_928 | 150 |
| 66 | 3300049582 | Ga0501048_0040418 | Ga0501048_0040418_1410_1874 | 150 |
| 67 | 3300049584 | Ga0501068_0208195 | Ga0501068_0208195_766_1230 | 150 |
| 68 | 3300049586 | Ga0501070_0889599 | Ga0501070_0889599_150_614 | 150 |
| 69 | 3300049587 | Ga0501071_0004207 | Ga0501071_0004207_1720_2184 | 150 |
| 70 | 3300049588 | Ga0501072_0002188 | Ga0501072_0002188_10304_10768 | 150 |
| 71 | 3300049589 | Ga0501073_0064965 | Ga0501073_0064965_557_1021 | 150 |
| 72 | 3300049590 | Ga0501074_0016923 | Ga0501074_0016923_1031_1495 | 150 |
| 73 | 3300049591 | Ga0501075_0060771 | Ga0501075_0060771_795_1259 | 150 |
| 74 | 3300049592 | Ga0501076_0338525 | Ga0501076_0338525_749_1213 | 150 |
| 75 | 3300049593 | Ga0501077_0000947 | Ga0501077_0000947_3753_4217 | 150 |
| 76 | 3300049741 | Ga0501079_0000487 | Ga0501079_0000487_310_774 | 150 |
| 77 | 3300049743 | Ga0501081_0000652 | Ga0501081_0000652_2519_2983 | 150 |
| 78 | 3300049744 | Ga0501083_0043399 | Ga0501083_0043399_902_1366 | 150 |
| 79 | 3300049822 | Ga0501035_0060634 | Ga0501035_0060634_381_845 | 150 |
| 80 | 3300049824 | Ga0501045_0015814 | Ga0501045_0015814_1129_1593 | 150 |
| 81 | 3300050514 | nmdc:mga08x19_798372_c1 | nmdc:mga08x19_798372_c1_136_606 | 150 |
| 82 | 3300053163 | Ga0500639_266695 | Ga0500639_266695_112_582 | 150 |
| 83 | 3300053178 | Ga0500637_0005730 | Ga0500637_0005730_1879_2349 | 150 |
| 84 | 3300053735 | Ga0500596_027380 | Ga0500596_027380_390_860 | 150 |
| 85 | 3300054114 | Ga0501084_0008006 | Ga0501084_0008006_4533_4997 | 150 |
| 86 | 3300060353 | Ga0501082_0004570 | Ga0501082_0004570_10049_10513 | 150 |
| 87 | 3300061734 | Ga0530510_0032835 | Ga0530510_0032835_796_1260 | 150 |
| 88 | 3300005437 | Ga0070710_10419495 | Ga0070710_104194952 | 151 |
| 89 | 3300014325 | Ga0163163_10236959 | Ga0163163_102369593 | 151 |
| 90 | 3300021384 | Ga0213876_10197013 | Ga0213876_101970132 | 151 |
| 91 | 3300039437 | Ga0436365_1796110 | Ga0436365_1796110_2779_3249 | 151 |
| 92 | 3300039438 | Ga0436360_0346195 | Ga0436360_0346195_227_697 | 151 |
| 93 | 3300039453 | Ga0436362_0826555 | Ga0436362_0826555_674_1147 | 151 |
| 94 | 3300039453 | Ga0436362_0933727 | Ga0436362_0933727_523_996 | 151 |
| 95 | 3300039453 | Ga0436362_1184014 | Ga0436362_1184014_880_1350 | 151 |
| 96 | 3300046526 | Ga0495666_0239774 | Ga0495666_0239774_96_566 | 151 |
| 97 | 3300049568 | Ga0501031_0259487 | Ga0501031_0259487_112_588 | 151 |
| 98 | 3300049570 | Ga0501033_0047574 | Ga0501033_0047574_532_1008 | 151 |
| 99 | 3300049573 | Ga0501037_0100608 | Ga0501037_0100608_1012_1488 | 151 |
| 100 | 3300049574 | Ga0501038_0148756 | Ga0501038_0148756_168_644 | 151 |
| 101 | 3300049575 | Ga0501039_0089946 | Ga0501039_0089946_1275_1751 | 151 |
| 102 | 3300049576 | Ga0501040_0020838 | Ga0501040_0020838_14_490 | 151 |
| 103 | 3300049577 | Ga0501041_0031439 | Ga0501041_0031439_1360_1836 | 151 |
| 104 | 3300049578 | Ga0501042_0006737 | Ga0501042_0006737_2666_3142 | 151 |
| 105 | 3300049579 | Ga0501043_0125209 | Ga0501043_0125209_293_769 | 151 |
| 106 | 3300049579 | Ga0501043_0918610 | Ga0501043_0918610_72_548 | 151 |
| 107 | 3300049580 | Ga0501046_0028966 | Ga0501046_0028966_2665_3141 | 151 |
| 108 | 3300049582 | Ga0501048_0020464 | Ga0501048_0020464_3131_3607 | 151 |
| 109 | 3300049584 | Ga0501068_0016459 | Ga0501068_0016459_1839_2315 | 151 |
| 110 | 3300049587 | Ga0501071_0018289 | Ga0501071_0018289_3882_4358 | 151 |
| 111 | 3300049588 | Ga0501072_0005867 | Ga0501072_0005867_5710_6186 | 151 |
| 112 | 3300049590 | Ga0501074_0041022 | Ga0501074_0041022_374_850 | 151 |
| 113 | 3300049591 | Ga0501075_0008811 | Ga0501075_0008811_4952_5428 | 151 |
| 114 | 3300049592 | Ga0501076_0001300 | Ga0501076_0001300_15446_15922 | 151 |
| 115 | 3300049741 | Ga0501079_0006973 | Ga0501079_0006973_6838_7314 | 151 |
| 116 | 3300049741 | Ga0501079_0935787 | Ga0501079_0935787_34_510 | 151 |
| 117 | 3300049742 | Ga0501080_0002859 | Ga0501080_0002859_9207_9683 | 151 |
| 118 | 3300049743 | Ga0501081_0062061 | Ga0501081_0062061_227_703 | 151 |
| 119 | 3300049744 | Ga0501083_0187986 | Ga0501083_0187986_691_1167 | 151 |
| 120 | 3300049822 | Ga0501035_0007719 | Ga0501035_0007719_227_703 | 151 |
| 121 | 3300049823 | Ga0501044_0656943 | Ga0501044_0656943_188_664 | 151 |
| 122 | 3300049824 | Ga0501045_0001321 | Ga0501045_0001321_9450_9926 | 151 |
| 123 | 3300054114 | Ga0501084_0075563 | Ga0501084_0075563_2102_2578 | 151 |
| 124 | 3300060353 | Ga0501082_0059231 | Ga0501082_0059231_1026_1502 | 151 |
| 125 | 3300060353 | Ga0501082_0646681 | Ga0501082_0646681_160_636 | 151 |
| 126 | 3300005330 | Ga0070690_100045342 | Ga0070690_1000453422 | 152 |
| 127 | 3300005334 | Ga0068869_100717076 | Ga0068869_1007170762 | 152 |
| 128 | 3300005335 | Ga0070666_10003267 | Ga0070666_100032677 | 152 |
| 129 | 3300005338 | Ga0068868_100505227 | Ga0068868_1005052271 | 152 |
| 130 | 3300005355 | Ga0070671_100022423 | Ga0070671_1000224234 | 152 |
| 131 | 3300005356 | Ga0070674_100265904 | Ga0070674_1002659042 | 152 |
| 132 | 3300005364 | Ga0070673_100076382 | Ga0070673_1000763822 | 152 |
| 133 | 3300005367 | Ga0070667_100058291 | Ga0070667_1000582912 | 152 |
| 134 | 3300005434 | Ga0070709_10212867 | Ga0070709_102128672 | 152 |
| 135 | 3300005435 | Ga0070714_100309261 | Ga0070714_1003092613 | 152 |
| 136 | 3300005436 | Ga0070713_100002285 | Ga0070713_1000022857 | 152 |
| 137 | 3300005437 | Ga0070710_10012175 | Ga0070710_100121754 | 152 |
| 138 | 3300005439 | Ga0070711_100033398 | Ga0070711_1000333985 | 152 |
| 139 | 3300005439 | Ga0070711_100057685 | Ga0070711_1000576852 | 152 |
| 140 | 3300005456 | Ga0070678_100010462 | Ga0070678_1000104623 | 152 |
| 141 | 3300005458 | Ga0070681_10000863 | Ga0070681_1000086312 | 152 |
| 142 | 3300005518 | Ga0070699_100851211 | Ga0070699_1008512111 | 152 |
| 143 | 3300005530 | Ga0070679_100110487 | Ga0070679_1001104873 | 152 |
| 144 | 3300005544 | Ga0070686_100841140 | Ga0070686_1008411402 | 152 |
| 145 | 3300005545 | Ga0070695_100466886 | Ga0070695_1004668861 | 152 |
| 146 | 3300005548 | Ga0070665_100017428 | Ga0070665_1000174286 | 152 |
| 147 | 3300005549 | Ga0070704_100708688 | Ga0070704_1007086882 | 152 |
| 148 | 3300005614 | Ga0068856_100044167 | Ga0068856_1000441674 | 152 |
| 149 | 3300005615 | Ga0070702_100508285 | Ga0070702_1005082852 | 152 |
| 150 | 3300005718 | Ga0068866_10007786 | Ga0068866_100077863 | 152 |
| 151 | 3300005841 | Ga0068863_100052991 | Ga0068863_1000529916 | 152 |
| 152 | 3300005841 | Ga0068863_101051510 | Ga0068863_1010515102 | 152 |
| 153 | 3300005842 | Ga0068858_100272080 | Ga0068858_1002720803 | 152 |
| 154 | 3300005842 | Ga0068858_100909719 | Ga0068858_1009097191 | 152 |
| 155 | 3300005843 | Ga0068860_100020608 | Ga0068860_1000206081 | 152 |
| 156 | 3300006163 | Ga0070715_10000363 | Ga0070715_100003635 | 152 |
| 157 | 3300006173 | Ga0070716_100016141 | Ga0070716_1000161413 | 152 |
| 158 | 3300006175 | Ga0070712_100893926 | Ga0070712_1008939262 | 152 |
| 159 | 3300006237 | Ga0097621_100005189 | Ga0097621_1000051896 | 152 |
| 160 | 3300006358 | Ga0068871_100090361 | Ga0068871_1000903614 | 152 |
| 161 | 3300006881 | Ga0068865_100005789 | Ga0068865_1000057896 | 152 |
| 162 | 3300006881 | Ga0068865_100355428 | Ga0068865_1003554282 | 152 |
| 163 | 3300006914 | Ga0075436_100064201 | Ga0075436_1000642014 | 152 |
| 164 | 3300009098 | Ga0105245_10079403 | Ga0105245_100794033 | 152 |
| 165 | 3300009101 | Ga0105247_10046620 | Ga0105247_100466204 | 152 |
| 166 | 3300009174 | Ga0105241_10004061 | Ga0105241_100040618 | 152 |
| 167 | 3300009176 | Ga0105242_10050722 | Ga0105242_100507222 | 152 |
| 168 | 3300009177 | Ga0105248_10007074 | Ga0105248_100070743 | 152 |
| 169 | 3300009545 | Ga0105237_10017179 | Ga0105237_100171795 | 152 |
| 170 | 3300010375 | Ga0105239_10049357 | Ga0105239_100493573 | 152 |
| 171 | 3300013296 | Ga0157374_10040089 | Ga0157374_100400894 | 152 |
| 172 | 3300013297 | Ga0157378_10005124 | Ga0157378_100051246 | 152 |
| 173 | 3300013306 | Ga0163162_10013023 | Ga0163162_100130239 | 152 |
| 174 | 3300013308 | Ga0157375_10116984 | Ga0157375_101169844 | 152 |
| 175 | 3300014325 | Ga0163163_10142415 | Ga0163163_101424154 | 152 |
| 176 | 3300014325 | Ga0163163_10173106 | Ga0163163_101731064 | 152 |
| 177 | 3300014968 | Ga0157379_10068194 | Ga0157379_100681945 | 152 |
| 178 | 3300021377 | Ga0213874_10006886 | Ga0213874_100068865 | 152 |
| 179 | 3300025898 | Ga0207692_10009583 | Ga0207692_100095836 | 152 |
| 180 | 3300025899 | Ga0207642_10005903 | Ga0207642_100059033 | 152 |
| 181 | 3300025903 | Ga0207680_10348345 | Ga0207680_103483453 | 152 |
| 182 | 3300025905 | Ga0207685_10369804 | Ga0207685_103698042 | 152 |
| 183 | 3300025906 | Ga0207699_10008992 | Ga0207699_100089924 | 152 |
| 184 | 3300025912 | Ga0207707_10006819 | Ga0207707_100068197 | 152 |
| 185 | 3300025914 | Ga0207671_10043684 | Ga0207671_100436844 | 152 |
| 186 | 3300025915 | Ga0207693_10002400 | Ga0207693_1000240027 | 152 |
| 187 | 3300025916 | Ga0207663_10048884 | Ga0207663_100488842 | 152 |
| 188 | 3300025916 | Ga0207663_10082779 | Ga0207663_100827793 | 152 |
| 189 | 3300025917 | Ga0207660_10237952 | Ga0207660_102379524 | 152 |
| 190 | 3300025928 | Ga0207700_10148296 | Ga0207700_101482964 | 152 |
| 191 | 3300025929 | Ga0207664_10281246 | Ga0207664_102812462 | 152 |
| 192 | 3300025931 | Ga0207644_10382807 | Ga0207644_103828072 | 152 |
| 193 | 3300025934 | Ga0207686_10143391 | Ga0207686_101433912 | 152 |
| 194 | 3300025937 | Ga0207669_10273562 | Ga0207669_102735621 | 152 |
| 195 | 3300025938 | Ga0207704_10239663 | Ga0207704_102396632 | 152 |
| 196 | 3300025939 | Ga0207665_10003249 | Ga0207665_100032495 | 152 |
| 197 | 3300025941 | Ga0207711_10059125 | Ga0207711_100591255 | 152 |
| 198 | 3300025960 | Ga0207651_10083362 | Ga0207651_100833621 | 152 |
| 199 | 3300026023 | Ga0207677_11879485 | Ga0207677_118794851 | 152 |
| 200 | 3300026035 | Ga0207703_10075043 | Ga0207703_100750434 | 152 |
| 201 | 3300026035 | Ga0207703_10404235 | Ga0207703_104042352 | 152 |
| 202 | 3300026078 | Ga0207702_10052499 | Ga0207702_100524994 | 152 |
| 203 | 3300026088 | Ga0207641_10246015 | Ga0207641_102460152 | 152 |
| 204 | 3300026121 | Ga0207683_10001886 | Ga0207683_1000188615 | 152 |
| 205 | 3300028379 | Ga0268266_10170621 | Ga0268266_101706212 | 152 |
| 206 | 3300028794 | Ga0307515_10049570 | Ga0307515_100495706 | 152 |
| 207 | 3300031456 | Ga0307513_10161627 | Ga0307513_101616273 | 152 |
| 208 | 3300035083 | Ga0373926_0354080 | Ga0373926_0354080_23_496 | 152 |
| 209 | 3300035120 | Ga0373957_0039504 | Ga0373957_0039504_255_728 | 152 |
| 210 | 3300035170 | Ga0373943_0020088 | Ga0373943_0020088_1073_1546 | 152 |
| 211 | 3300035172 | Ga0373955_0111296 | Ga0373955_0111296_385_858 | 152 |
| 212 | 3300035692 | Ga0373935_0117191 | Ga0373935_0117191_650_1123 | 152 |
| 213 | 3300035725 | Ga0373947_0015434 | Ga0373947_0015434_2661_3134 | 152 |
| 214 | 3300036401 | Ga0373937_0859630 | Ga0373937_0859630_239_712 | 152 |
| 215 | 3300037068 | Ga0373925_0128033 | Ga0373925_0128033_825_1298 | 152 |
| 216 | 3300039437 | Ga0436365_1342030 | Ga0436365_1342030_132_605 | 152 |
| 217 | 3300039447 | Ga0436361_0169415 | Ga0436361_0169415_74_550 | 152 |
| 218 | 3300039450 | Ga0436363_0475575 | Ga0436363_0475575_2407_2880 | 152 |
| 219 | 3300039453 | Ga0436362_0778749 | Ga0436362_0778749_668_1144 | 152 |
| 220 | 3300046459 | Ga0495629_0382110 | Ga0495629_0382110_164_637 | 152 |
| 221 | 3300046473 | Ga0495582_0118594 | Ga0495582_0118594_458_931 | 152 |
| 222 | 3300046517 | Ga0495630_0183445 | Ga0495630_0183445_844_1317 | 152 |
| 223 | 3300046519 | Ga0495632_0162963 | Ga0495632_0162963_145_627 | 152 |
| 224 | 3300046535 | Ga0495586_0160474 | Ga0495586_0160474_664_1137 | 152 |
| 225 | 3300046543 | Ga0495645_0388157 | Ga0495645_0388157_200_673 | 152 |
| 226 | 3300046681 | Ga0495647_0091182 | Ga0495647_0091182_720_1193 | 152 |
| 227 | 3300046683 | Ga0495658_0118811 | Ga0495658_0118811_383_856 | 152 |
| 228 | 3300047319 | Ga0495674_0138144 | Ga0495674_0138144_1348_1821 | 152 |
| 229 | 3300048903 | Ga0496100_0059578 | Ga0496100_0059578_1187_1660 | 152 |
| 230 | 3300048904 | Ga0496101_0229814 | Ga0496101_0229814_122_595 | 152 |
| 231 | 3300048905 | Ga0496102_0148863 | Ga0496102_0148863_30_503 | 152 |
| 232 | 3300048906 | Ga0496103_0063295 | Ga0496103_0063295_293_766 | 152 |
| 233 | 3300048907 | Ga0496104_0242029 | Ga0496104_0242029_1203_1676 | 152 |
| 234 | 3300048908 | Ga0496105_0191388 | Ga0496105_0191388_1042_1515 | 152 |
| 235 | 3300048909 | Ga0496106_0217635 | Ga0496106_0217635_309_782 | 152 |
| 236 | 3300048910 | Ga0496107_0038151 | Ga0496107_0038151_2061_2534 | 152 |
| 237 | 3300048911 | Ga0496108_0004541 | Ga0496108_0004541_3717_4190 | 152 |
| 238 | 3300048912 | Ga0496109_0036912 | Ga0496109_0036912_843_1316 | 152 |
| 239 | 3300048913 | Ga0496110_0013721 | Ga0496110_0013721_1365_1838 | 152 |
| 240 | 3300048914 | Ga0496111_0022901 | Ga0496111_0022901_1127_1600 | 152 |
| 241 | 3300048915 | Ga0496112_0318261 | Ga0496112_0318261_74_547 | 152 |
| 242 | 3300048916 | Ga0496113_0107284 | Ga0496113_0107284_850_1323 | 152 |
| 243 | 3300048918 | Ga0496115_0050011 | Ga0496115_0050011_2112_2585 | 152 |
| 244 | 3300053077 | Ga0495601_0188253 | Ga0495601_0188253_33_506 | 152 |
| 245 | 3300053088 | Ga0500644_0116172 | Ga0500644_0116172_14_496 | 152 |
| 246 | 3300053096 | Ga0500641_0159913 | Ga0500641_0159913_124_606 | 152 |
| 247 | 3300053134 | Ga0500658_0361366 | Ga0500658_0361366_94_576 | 152 |
| 248 | 3300005329 | Ga0070683_101484541 | Ga0070683_1014845411 | 153 |
| 249 | 3300005336 | Ga0070680_100221000 | Ga0070680_1002210002 | 153 |
| 250 | 3300005336 | Ga0070680_101433492 | Ga0070680_1014334921 | 153 |
| 251 | 3300005367 | Ga0070667_100332338 | Ga0070667_1003323381 | 153 |
| 252 | 3300005458 | Ga0070681_10069030 | Ga0070681_100690304 | 153 |
| 253 | 3300009093 | Ga0105240_10051789 | Ga0105240_100517892 | 153 |
| 254 | 3300009093 | Ga0105240_10090514 | Ga0105240_100905144 | 153 |
| 255 | 3300021384 | Ga0213876_10086919 | Ga0213876_100869192 | 153 |
| 256 | 3300025912 | Ga0207707_10200402 | Ga0207707_102004022 | 153 |
| 257 | 3300025913 | Ga0207695_10075075 | Ga0207695_100750751 | 153 |
| 258 | 3300025917 | Ga0207660_10087119 | Ga0207660_100871193 | 153 |
| 259 | 3300025921 | Ga0207652_10006797 | Ga0207652_100067974 | 153 |
| 260 | 3300025981 | Ga0207640_11499474 | Ga0207640_114994742 | 153 |
| 261 | 3300025986 | Ga0207658_10908864 | Ga0207658_109088641 | 153 |
| 262 | 3300031731 | Ga0307405_10817946 | Ga0307405_108179461 | 153 |
| 263 | 3300031903 | Ga0307407_10783032 | Ga0307407_107830322 | 153 |
| 264 | 3300036401 | Ga0373937_0279663 | Ga0373937_0279663_470_955 | 153 |
| 265 | 3300037418 | Ga0395900_0475763 | Ga0395900_0475763_593_1066 | 153 |
| 266 | 3300037466 | Ga0395898_0004801 | Ga0395898_0004801_5265_5738 | 153 |
| 267 | 3300037466 | Ga0395898_0413210 | Ga0395898_0413210_493_966 | 153 |
| 268 | 3300039437 | Ga0436365_0375377 | Ga0436365_0375377_4394_4876 | 153 |
| 269 | 3300039450 | Ga0436363_1137318 | Ga0436363_1137318_469_951 | 153 |
| 270 | 3300039453 | Ga0436362_0605076 | Ga0436362_0605076_155_637 | 153 |
| 271 | 3300041486 | Ga0451807_1232526 | Ga0451807_1232526_182_658 | 153 |
| 272 | 3300044656 | Ga0466969_0039150 | Ga0466969_0039150_1120_1599 | 153 |
| 273 | 3300044656 | Ga0466969_0061163 | Ga0466969_0061163_119_601 | 153 |
| 274 | 3300044684 | Ga0466966_0002009 | Ga0466966_0002009_2172_2651 | 153 |
| 275 | 3300044684 | Ga0466966_0125007 | Ga0466966_0125007_553_1026 | 153 |
| 276 | 3300044684 | Ga0466966_0352001 | Ga0466966_0352001_71_544 | 153 |
| 277 | 3300044693 | Ga0466961_0001203 | Ga0466961_0001203_2172_2651 | 153 |
| 278 | 3300044706 | Ga0466964_0000188 | Ga0466964_0000188_15739_16218 | 153 |
| 279 | 3300044719 | Ga0466971_0000534 | Ga0466971_0000534_13332_13811 | 153 |
| 280 | 3300044735 | Ga0466968_0284202 | Ga0466968_0284202_297_776 | 153 |
| 281 | 3300044765 | Ga0466970_0002030 | Ga0466970_0002030_1120_1599 | 153 |
| 282 | 3300044842 | Ga0466957_0003911 | Ga0466957_0003911_4902_5381 | 153 |
| 283 | 3300045049 | Ga0466959_0000706 | Ga0466959_0000706_10215_10694 | 153 |
| 284 | 3300045049 | Ga0466959_0811169 | Ga0466959_0811169_85_558 | 153 |
| 285 | 3300045836 | Ga0466958_0088068 | Ga0466958_0088068_722_1201 | 153 |
| 286 | 3300046455 | Ga0495603_0195677 | Ga0495603_0195677_58_543 | 153 |
| 287 | 3300046458 | Ga0495591_029904 | Ga0495591_029904_37_522 | 153 |
| 288 | 3300046459 | Ga0495629_0294120 | Ga0495629_0294120_156_641 | 153 |
| 289 | 3300046460 | Ga0495638_0300446 | Ga0495638_0300446_156_641 | 153 |
| 290 | 3300046472 | Ga0495580_0021479 | Ga0495580_0021479_1715_2200 | 153 |
| 291 | 3300046475 | Ga0495639_0174106 | Ga0495639_0174106_515_1000 | 153 |
| 292 | 3300046523 | Ga0495644_0014518 | Ga0495644_0014518_749_1234 | 153 |
| 293 | 3300046528 | Ga0495642_0156200 | Ga0495642_0156200_50_535 | 153 |
| 294 | 3300046535 | Ga0495586_0294992 | Ga0495586_0294992_143_628 | 153 |
| 295 | 3300046539 | Ga0495621_0000091 | Ga0495621_0000091_13545_14030 | 153 |
| 296 | 3300046557 | Ga0495622_0178568 | Ga0495622_0178568_192_677 | 153 |
| 297 | 3300046681 | Ga0495647_0005576 | Ga0495647_0005576_3256_3741 | 153 |
| 298 | 3300046683 | Ga0495658_0184425 | Ga0495658_0184425_598_1083 | 153 |
| 299 | 3300047323 | Ga0495683_0294930 | Ga0495683_0294930_110_595 | 153 |
| 300 | 3300047470 | Ga0495681_0016395 | Ga0495681_0016395_1779_2264 | 153 |
| 301 | 3300049585 | Ga0501069_0248358 | Ga0501069_0248358_68_550 | 153 |
| 302 | 3300061719 | Ga0466962_0000370 | Ga0466962_0000370_2699_3178 | 153 |
| 303 | 3300005330 | Ga0070690_100323543 | Ga0070690_1003235432 | 154 |
| 304 | 3300005335 | Ga0070666_10053482 | Ga0070666_100534822 | 154 |
| 305 | 3300005335 | Ga0070666_10160004 | Ga0070666_101600043 | 154 |
| 306 | 3300005338 | Ga0068868_101166395 | Ga0068868_1011663952 | 154 |
| 307 | 3300005341 | Ga0070691_10414016 | Ga0070691_104140162 | 154 |
| 308 | 3300005343 | Ga0070687_100299167 | Ga0070687_1002991672 | 154 |
| 309 | 3300005347 | Ga0070668_100758711 | Ga0070668_1007587111 | 154 |
| 310 | 3300005355 | Ga0070671_100023210 | Ga0070671_1000232104 | 154 |
| 311 | 3300005355 | Ga0070671_100096811 | Ga0070671_1000968114 | 154 |
| 312 | 3300005367 | Ga0070667_100041662 | Ga0070667_1000416624 | 154 |
| 313 | 3300005367 | Ga0070667_100055355 | Ga0070667_1000553551 | 154 |
| 314 | 3300005436 | Ga0070713_100296672 | Ga0070713_1002966722 | 154 |
| 315 | 3300005455 | Ga0070663_100050669 | Ga0070663_1000506694 | 154 |
| 316 | 3300005458 | Ga0070681_10005684 | Ga0070681_1000568413 | 154 |
| 317 | 3300005458 | Ga0070681_10454665 | Ga0070681_104546652 | 154 |
| 318 | 3300005535 | Ga0070684_100810187 | Ga0070684_1008101871 | 154 |
| 319 | 3300005539 | Ga0068853_100108267 | Ga0068853_1001082674 | 154 |
| 320 | 3300005544 | Ga0070686_100018554 | Ga0070686_1000185546 | 154 |
| 321 | 3300005547 | Ga0070693_100096556 | Ga0070693_1000965562 | 154 |
| 322 | 3300005548 | Ga0070665_100008413 | Ga0070665_1000084132 | 154 |
| 323 | 3300005548 | Ga0070665_100010853 | Ga0070665_1000108538 | 154 |
| 324 | 3300005548 | Ga0070665_100056861 | Ga0070665_1000568615 | 154 |
| 325 | 3300005564 | Ga0070664_100125155 | Ga0070664_1001251553 | 154 |
| 326 | 3300005616 | Ga0068852_102269672 | Ga0068852_1022696721 | 154 |
| 327 | 3300005617 | Ga0068859_100000376 | Ga0068859_10000037626 | 154 |
| 328 | 3300005618 | Ga0068864_100195910 | Ga0068864_1001959102 | 154 |
| 329 | 3300005719 | Ga0068861_101173753 | Ga0068861_1011737531 | 154 |
| 330 | 3300005834 | Ga0068851_10066014 | Ga0068851_100660143 | 154 |
| 331 | 3300005841 | Ga0068863_100003148 | Ga0068863_10000314815 | 154 |
| 332 | 3300005841 | Ga0068863_100006529 | Ga0068863_1000065296 | 154 |
| 333 | 3300005842 | Ga0068858_100002387 | Ga0068858_1000023877 | 154 |
| 334 | 3300005842 | Ga0068858_100050576 | Ga0068858_1000505763 | 154 |
| 335 | 3300005843 | Ga0068860_100003079 | Ga0068860_1000030795 | 154 |
| 336 | 3300005843 | Ga0068860_100030656 | Ga0068860_1000306564 | 154 |
| 337 | 3300005844 | Ga0068862_100008883 | Ga0068862_1000088835 | 154 |
| 338 | 3300005937 | Ga0081455_10289442 | Ga0081455_102894421 | 154 |
| 339 | 3300006237 | Ga0097621_100160611 | Ga0097621_1001606112 | 154 |
| 340 | 3300006358 | Ga0068871_100290077 | Ga0068871_1002900774 | 154 |
| 341 | 3300006931 | Ga0097620_100000376 | Ga0097620_10000037626 | 154 |
| 342 | 3300009551 | Ga0105238_10156924 | Ga0105238_101569243 | 154 |
| 343 | 3300013296 | Ga0157374_10266580 | Ga0157374_102665802 | 154 |
| 344 | 3300014325 | Ga0163163_10114622 | Ga0163163_101146224 | 154 |
| 345 | 3300025900 | Ga0207710_10000584 | Ga0207710_1000058418 | 154 |
| 346 | 3300025903 | Ga0207680_10037800 | Ga0207680_100378004 | 154 |
| 347 | 3300025903 | Ga0207680_10050083 | Ga0207680_100500833 | 154 |
| 348 | 3300025911 | Ga0207654_10454413 | Ga0207654_104544132 | 154 |
| 349 | 3300025912 | Ga0207707_10004427 | Ga0207707_100044276 | 154 |
| 350 | 3300025913 | Ga0207695_10268109 | Ga0207695_102681093 | 154 |
| 351 | 3300025924 | Ga0207694_10640594 | Ga0207694_106405942 | 154 |
| 352 | 3300025928 | Ga0207700_10515559 | Ga0207700_105155592 | 154 |
| 353 | 3300025931 | Ga0207644_10012392 | Ga0207644_100123925 | 154 |
| 354 | 3300025931 | Ga0207644_10267570 | Ga0207644_102675703 | 154 |
| 355 | 3300025934 | Ga0207686_10342104 | Ga0207686_103421042 | 154 |
| 356 | 3300025940 | Ga0207691_10282536 | Ga0207691_102825362 | 154 |
| 357 | 3300025941 | Ga0207711_10237575 | Ga0207711_102375752 | 154 |
| 358 | 3300025945 | Ga0207679_11102387 | Ga0207679_111023872 | 154 |
| 359 | 3300025961 | Ga0207712_10045757 | Ga0207712_100457574 | 154 |
| 360 | 3300025961 | Ga0207712_10079635 | Ga0207712_100796353 | 154 |
| 361 | 3300025961 | Ga0207712_10106949 | Ga0207712_101069494 | 154 |
| 362 | 3300025986 | Ga0207658_10009211 | Ga0207658_100092116 | 154 |
| 363 | 3300025986 | Ga0207658_10023297 | Ga0207658_100232973 | 154 |
| 364 | 3300026035 | Ga0207703_10001857 | Ga0207703_1000185714 | 154 |
| 365 | 3300026035 | Ga0207703_10013445 | Ga0207703_100134452 | 154 |
| 366 | 3300026067 | Ga0207678_10010959 | Ga0207678_100109595 | 154 |
| 367 | 3300026088 | Ga0207641_10002848 | Ga0207641_1000284815 | 154 |
| 368 | 3300026088 | Ga0207641_10025361 | Ga0207641_100253616 | 154 |
| 369 | 3300026095 | Ga0207676_10835823 | Ga0207676_108358232 | 154 |
| 370 | 3300026118 | Ga0207675_100567168 | Ga0207675_1005671683 | 154 |
| 371 | 3300026118 | Ga0207675_101056992 | Ga0207675_1010569921 | 154 |
| 372 | 3300028379 | Ga0268266_10017254 | Ga0268266_100172542 | 154 |
| 373 | 3300028379 | Ga0268266_10063145 | Ga0268266_100631453 | 154 |
| 374 | 3300028380 | Ga0268265_10724782 | Ga0268265_107247822 | 154 |
| 375 | 3300028381 | Ga0268264_10000308 | Ga0268264_1000030815 | 154 |
| 376 | 3300028381 | Ga0268264_10018548 | Ga0268264_100185486 | 154 |
| 377 | 3300030521 | Ga0307511_10000793 | Ga0307511_1000079318 | 154 |
| 378 | 3300031456 | Ga0307513_10605137 | Ga0307513_106051372 | 154 |
| 379 | 3300031507 | Ga0307509_10000008 | Ga0307509_1000000842 | 154 |
| 380 | 3300031548 | Ga0307408_100150990 | Ga0307408_1001509902 | 154 |
| 381 | 3300031901 | Ga0307406_10294092 | Ga0307406_102940923 | 154 |
| 382 | 3300031911 | Ga0307412_10065605 | Ga0307412_100656053 | 154 |
| 383 | 3300033180 | Ga0307510_10000004 | Ga0307510_10000004389 | 154 |
| 384 | 3300041408 | Ga0439453_0031784 | Ga0439453_0031784_174_656 | 154 |
| 385 | 3300042436 | Ga0439435_0021281 | Ga0439435_0021281_792_1274 | 154 |
| 386 | 3300044656 | Ga0466969_0100870 | Ga0466969_0100870_193_669 | 154 |
| 387 | 3300045049 | Ga0466959_0030139 | Ga0466959_0030139_1970_2446 | 154 |
| 388 | 3300045836 | Ga0466958_0277212 | Ga0466958_0277212_480_956 | 154 |
| 389 | 3300046519 | Ga0495632_0099969 | Ga0495632_0099969_401_883 | 154 |
| 390 | 3300046616 | Ga0495668_0735085 | Ga0495668_0735085_46_528 | 154 |
| 391 | 3300053096 | Ga0500641_0034442 | Ga0500641_0034442_1364_1828 | 154 |
| 392 | 3300053111 | Ga0500572_159242 | Ga0500572_159242_213_692 | 154 |
| 393 | 3300053143 | Ga0500579_183962 | Ga0500579_183962_293_757 | 154 |
| 394 | 3300053153 | Ga0500616_0000074 | Ga0500616_0000074_66200_66664 | 154 |
| 395 | 3300053178 | Ga0500637_0121594 | Ga0500637_0121594_287_766 | 154 |
| 396 | 3300004800 | Ga0058861_11703000 | Ga0058861_117030002 | 155 |
| 397 | 3300004803 | Ga0058862_12292822 | Ga0058862_122928222 | 155 |
| 398 | 3300005329 | Ga0070683_100025169 | Ga0070683_1000251692 | 155 |
| 399 | 3300005329 | Ga0070683_102021182 | Ga0070683_1020211821 | 155 |
| 400 | 3300005334 | Ga0068869_100560527 | Ga0068869_1005605272 | 155 |
| 401 | 3300005336 | Ga0070680_100020097 | Ga0070680_1000200974 | 155 |
| 402 | 3300005336 | Ga0070680_100037741 | Ga0070680_1000377414 | 155 |
| 403 | 3300005341 | Ga0070691_10365462 | Ga0070691_103654621 | 155 |
| 404 | 3300005435 | Ga0070714_101189174 | Ga0070714_1011891742 | 155 |
| 405 | 3300005436 | Ga0070713_100025923 | Ga0070713_1000259234 | 155 |
| 406 | 3300005458 | Ga0070681_10005285 | Ga0070681_100052858 | 155 |
| 407 | 3300005458 | Ga0070681_10006459 | Ga0070681_1000645910 | 155 |
| 408 | 3300005458 | Ga0070681_10028021 | Ga0070681_100280212 | 155 |
| 409 | 3300005458 | Ga0070681_10089609 | Ga0070681_100896094 | 155 |
| 410 | 3300005530 | Ga0070679_100006602 | Ga0070679_10000660210 | 155 |
| 411 | 3300005530 | Ga0070679_100080444 | Ga0070679_1000804446 | 155 |
| 412 | 3300005530 | Ga0070679_100164013 | Ga0070679_1001640133 | 155 |
| 413 | 3300005530 | Ga0070679_100316992 | Ga0070679_1003169923 | 155 |
| 414 | 3300005535 | Ga0070684_100112949 | Ga0070684_1001129494 | 155 |
| 415 | 3300005539 | Ga0068853_101177083 | Ga0068853_1011770831 | 155 |
| 416 | 3300005548 | Ga0070665_100134506 | Ga0070665_1001345061 | 155 |
| 417 | 3300005563 | Ga0068855_100004720 | Ga0068855_10000472010 | 155 |
| 418 | 3300005563 | Ga0068855_100013913 | Ga0068855_1000139136 | 155 |
| 419 | 3300005563 | Ga0068855_101675569 | Ga0068855_1016755691 | 155 |
| 420 | 3300005564 | Ga0070664_100828109 | Ga0070664_1008281092 | 155 |
| 421 | 3300005578 | Ga0068854_100100256 | Ga0068854_1001002564 | 155 |
| 422 | 3300005578 | Ga0068854_100272104 | Ga0068854_1002721042 | 155 |
| 423 | 3300005614 | Ga0068856_100784847 | Ga0068856_1007848472 | 155 |
| 424 | 3300005614 | Ga0068856_101560933 | Ga0068856_1015609332 | 155 |
| 425 | 3300005719 | Ga0068861_101426739 | Ga0068861_1014267391 | 155 |
| 426 | 3300005842 | Ga0068858_100994246 | Ga0068858_1009942461 | 155 |
| 427 | 3300005844 | Ga0068862_100315755 | Ga0068862_1003157552 | 155 |
| 428 | 3300006237 | Ga0097621_100038041 | Ga0097621_1000380415 | 155 |
| 429 | 3300006358 | Ga0068871_100158496 | Ga0068871_1001584962 | 155 |
| 430 | 3300009093 | Ga0105240_10005493 | Ga0105240_1000549312 | 155 |
| 431 | 3300009093 | Ga0105240_10005499 | Ga0105240_100054997 | 155 |
| 432 | 3300009093 | Ga0105240_10005908 | Ga0105240_1000590811 | 155 |
| 433 | 3300009093 | Ga0105240_10014001 | Ga0105240_100140012 | 155 |
| 434 | 3300009093 | Ga0105240_10159918 | Ga0105240_101599184 | 155 |
| 435 | 3300009093 | Ga0105240_10238500 | Ga0105240_102385001 | 155 |
| 436 | 3300009093 | Ga0105240_10550225 | Ga0105240_105502251 | 155 |
| 437 | 3300009093 | Ga0105240_10950564 | Ga0105240_109505642 | 155 |
| 438 | 3300009098 | Ga0105245_10909409 | Ga0105245_109094092 | 155 |
| 439 | 3300009174 | Ga0105241_10123009 | Ga0105241_101230092 | 155 |
| 440 | 3300009545 | Ga0105237_10017590 | Ga0105237_100175902 | 155 |
| 441 | 3300009545 | Ga0105237_10151235 | Ga0105237_101512353 | 155 |
| 442 | 3300009545 | Ga0105237_10190530 | Ga0105237_101905302 | 155 |
| 443 | 3300009545 | Ga0105237_10565707 | Ga0105237_105657073 | 155 |
| 444 | 3300009551 | Ga0105238_10011533 | Ga0105238_100115334 | 155 |
| 445 | 3300009551 | Ga0105238_10202708 | Ga0105238_102027083 | 155 |
| 446 | 3300009551 | Ga0105238_10277311 | Ga0105238_102773111 | 155 |
| 447 | 3300010375 | Ga0105239_10014313 | Ga0105239_100143134 | 155 |
| 448 | 3300011119 | Ga0105246_10227695 | Ga0105246_102276953 | 155 |
| 449 | 3300013104 | Ga0157370_10002010 | Ga0157370_1000201010 | 155 |
| 450 | 3300013104 | Ga0157370_10346606 | Ga0157370_103466062 | 155 |
| 451 | 3300013104 | Ga0157370_10669945 | Ga0157370_106699452 | 155 |
| 452 | 3300013105 | Ga0157369_10018790 | Ga0157369_100187905 | 155 |
| 453 | 3300013105 | Ga0157369_10041796 | Ga0157369_100417964 | 155 |
| 454 | 3300013105 | Ga0157369_10591166 | Ga0157369_105911662 | 155 |
| 455 | 3300013296 | Ga0157374_10465856 | Ga0157374_104658563 | 155 |
| 456 | 3300013296 | Ga0157374_10814677 | Ga0157374_108146772 | 155 |
| 457 | 3300013307 | Ga0157372_10064040 | Ga0157372_100640405 | 155 |
| 458 | 3300013307 | Ga0157372_10721281 | Ga0157372_107212811 | 155 |
| 459 | 3300013307 | Ga0157372_11370992 | Ga0157372_113709921 | 155 |
| 460 | 3300013307 | Ga0157372_12461970 | Ga0157372_124619701 | 155 |
| 461 | 3300014325 | Ga0163163_11161468 | Ga0163163_111614682 | 155 |
| 462 | 3300014325 | Ga0163163_11214019 | Ga0163163_112140192 | 155 |
| 463 | 3300014968 | Ga0157379_10035519 | Ga0157379_100355195 | 155 |
| 464 | 3300020081 | Ga0206354_11374159 | Ga0206354_113741591 | 155 |
| 465 | 3300021377 | Ga0213874_10309042 | Ga0213874_103090421 | 155 |
| 466 | 3300025912 | Ga0207707_10000213 | Ga0207707_1000021310 | 155 |
| 467 | 3300025912 | Ga0207707_10007539 | Ga0207707_100075392 | 155 |
| 468 | 3300025912 | Ga0207707_10193275 | Ga0207707_101932751 | 155 |
| 469 | 3300025913 | Ga0207695_10007808 | Ga0207695_100078086 | 155 |
| 470 | 3300025913 | Ga0207695_10066718 | Ga0207695_100667182 | 155 |
| 471 | 3300025913 | Ga0207695_10117921 | Ga0207695_101179212 | 155 |
| 472 | 3300025913 | Ga0207695_10289529 | Ga0207695_102895292 | 155 |
| 473 | 3300025913 | Ga0207695_10306800 | Ga0207695_103068002 | 155 |
| 474 | 3300025913 | Ga0207695_10322465 | Ga0207695_103224652 | 155 |
| 475 | 3300025913 | Ga0207695_10672730 | Ga0207695_106727302 | 155 |
| 476 | 3300025914 | Ga0207671_10058800 | Ga0207671_100588004 | 155 |
| 477 | 3300025917 | Ga0207660_10058589 | Ga0207660_100585894 | 155 |
| 478 | 3300025917 | Ga0207660_10148542 | Ga0207660_101485422 | 155 |
| 479 | 3300025917 | Ga0207660_10152080 | Ga0207660_101520803 | 155 |
| 480 | 3300025917 | Ga0207660_10219827 | Ga0207660_102198273 | 155 |
| 481 | 3300025921 | Ga0207652_10001434 | Ga0207652_1000143417 | 155 |
| 482 | 3300025921 | Ga0207652_10076517 | Ga0207652_100765171 | 155 |
| 483 | 3300025921 | Ga0207652_10100506 | Ga0207652_101005064 | 155 |
| 484 | 3300025921 | Ga0207652_10767439 | Ga0207652_107674392 | 155 |
| 485 | 3300025924 | Ga0207694_10006364 | Ga0207694_100063645 | 155 |
| 486 | 3300025924 | Ga0207694_10013501 | Ga0207694_100135015 | 155 |
| 487 | 3300025924 | Ga0207694_10392284 | Ga0207694_103922842 | 155 |
| 488 | 3300025924 | Ga0207694_10502721 | Ga0207694_105027211 | 155 |
| 489 | 3300025925 | Ga0207650_10548314 | Ga0207650_105483142 | 155 |
| 490 | 3300025928 | Ga0207700_10049869 | Ga0207700_100498695 | 155 |
| 491 | 3300025944 | Ga0207661_10235066 | Ga0207661_102350661 | 155 |
| 492 | 3300025949 | Ga0207667_10003935 | Ga0207667_100039355 | 155 |
| 493 | 3300025949 | Ga0207667_10046714 | Ga0207667_100467143 | 155 |
| 494 | 3300025949 | Ga0207667_10080827 | Ga0207667_100808274 | 155 |
| 495 | 3300025981 | Ga0207640_10084686 | Ga0207640_100846862 | 155 |
| 496 | 3300026035 | Ga0207703_10704980 | Ga0207703_107049802 | 155 |
| 497 | 3300026041 | Ga0207639_11196655 | Ga0207639_111966552 | 155 |
| 498 | 3300026078 | Ga0207702_10217347 | Ga0207702_102173471 | 155 |
| 499 | 3300026078 | Ga0207702_10714155 | Ga0207702_107141551 | 155 |
| 500 | 3300026118 | Ga0207675_102389458 | Ga0207675_1023894581 | 155 |
| 501 | 3300026142 | Ga0207698_10230176 | Ga0207698_102301764 | 155 |
| 502 | 3300026142 | Ga0207698_11508036 | Ga0207698_115080362 | 155 |
| 503 | 3300028379 | Ga0268266_10000926 | Ga0268266_1000092627 | 155 |
| 504 | 3300028379 | Ga0268266_10076380 | Ga0268266_100763804 | 155 |
| 505 | 3300028380 | Ga0268265_10346400 | Ga0268265_103464002 | 155 |
| 506 | 3300028573 | Ga0265334_10015305 | Ga0265334_100153055 | 155 |
| 507 | 3300037853 | Ga0436364_0530634 | Ga0436364_0530634_497_982 | 155 |
| 508 | 3300039437 | Ga0436365_0885394 | Ga0436365_0885394_78_563 | 155 |
| 509 | 3300039450 | Ga0436363_0122190 | Ga0436363_0122190_503_991 | 155 |
| 510 | 3300041453 | Ga0451797_1164725 | Ga0451797_1164725_144_632 | 155 |
| 511 | 3300041494 | Ga0451837_1645436 | Ga0451837_1645436_42_530 | 155 |
| 512 | 3300044656 | Ga0466969_0000245 | Ga0466969_0000245_20684_21172 | 155 |
| 513 | 3300044658 | Ga0466972_0027888 | Ga0466972_0027888_2092_2580 | 155 |
| 514 | 3300044684 | Ga0466966_0155606 | Ga0466966_0155606_537_1025 | 155 |
| 515 | 3300045049 | Ga0466959_0003041 | Ga0466959_0003041_4980_5468 | 155 |
| 516 | 3300045049 | Ga0466959_0010227 | Ga0466959_0010227_5958_6446 | 155 |
| 517 | 3300045976 | Ga0466967_1319199 | Ga0466967_1319199_179_667 | 155 |
| 518 | 3300046692 | Ga0495671_0009176 | Ga0495671_0009176_352_837 | 155 |
| 519 | 3300047443 | Ga0495687_017826 | Ga0495687_017826_1160_1645 | 155 |
| 520 | 3300048929 | Ga0496126_0000545 | Ga0496126_0000545_6297_6782 | 155 |
| 521 | 3300048929 | Ga0496126_0098554 | Ga0496126_0098554_425_913 | 155 |
| 522 | 3300053119 | Ga0500595_010853 | Ga0500595_010853_382_870 | 155 |
| 523 | 3300059493 | Ga0587077_081383 | Ga0587077_081383_222_710 | 155 |
| 524 | 3300059508 | Ga0587088_077463 | Ga0587088_077463_182_670 | 155 |
| 525 | 3300059643 | Ga0587072_063418 | Ga0587072_063418_55_543 | 155 |
| 526 | 3300005530 | Ga0070679_100010385 | Ga0070679_1000103854 | 156 |
| 527 | 3300005719 | Ga0068861_100045156 | Ga0068861_1000451563 | 156 |
| 528 | 3300005844 | Ga0068862_100211468 | Ga0068862_1002114682 | 156 |
| 529 | 3300005844 | Ga0068862_100455869 | Ga0068862_1004558692 | 156 |
| 530 | 3300005985 | Ga0081539_10255625 | Ga0081539_102556251 | 156 |
| 531 | 3300009101 | Ga0105247_10582949 | Ga0105247_105829492 | 156 |
| 532 | 3300009553 | Ga0105249_10829723 | Ga0105249_108297232 | 156 |
| 533 | 3300014968 | Ga0157379_10277414 | Ga0157379_102774144 | 156 |
| 534 | 3300025912 | Ga0207707_10097836 | Ga0207707_100978363 | 156 |
| 535 | 3300025921 | Ga0207652_10315327 | Ga0207652_103153273 | 156 |
| 536 | 3300025961 | Ga0207712_10709712 | Ga0207712_107097122 | 156 |
| 537 | 3300026118 | Ga0207675_100079258 | Ga0207675_1000792584 | 156 |
| 538 | 3300028380 | Ga0268265_10439022 | Ga0268265_104390223 | 156 |
| 539 | 3300053104 | Ga0500556_0000260 | Ga0500556_0000260_22980_23465 | 156 |
| 540 | 3300053130 | Ga0500642_0439715 | Ga0500642_0439715_69_539 | 156 |
| 541 | 3300003320 | rootH2_10119640 | rootH2_101196404 | 157 |
| 542 | 3300005367 | Ga0070667_100369988 | Ga0070667_1003699882 | 157 |
| 543 | 3300009093 | Ga0105240_10036965 | Ga0105240_100369654 | 157 |
| 544 | 3300009545 | Ga0105237_10405733 | Ga0105237_104057332 | 157 |
| 545 | 3300009551 | Ga0105238_10085369 | Ga0105238_100853692 | 157 |
| 546 | 3300014325 | Ga0163163_10050681 | Ga0163163_100506815 | 157 |
| 547 | 3300014968 | Ga0157379_10151189 | Ga0157379_101511893 | 157 |
| 548 | 3300014969 | Ga0157376_10530034 | Ga0157376_105300342 | 157 |
| 549 | 3300025913 | Ga0207695_10067744 | Ga0207695_100677442 | 157 |
| 550 | 3300028379 | Ga0268266_10034382 | Ga0268266_100343825 | 157 |
| 551 | 3300028380 | Ga0268265_10012800 | Ga0268265_100128004 | 157 |
| 552 | 3300046507 | Ga0495606_0061073 | Ga0495606_0061073_690_1250 | 157 |
| 553 | 3300046660 | Ga0495625_0076177 | Ga0495625_0076177_499_1026 | 157 |
| 554 | 3300048903 | Ga0496100_0166261 | Ga0496100_0166261_388_948 | 157 |
| 555 | 3300048905 | Ga0496102_0008566 | Ga0496102_0008566_3523_4083 | 157 |
| 556 | 3300048906 | Ga0496103_0049426 | Ga0496103_0049426_1521_2081 | 157 |
| 557 | 3300048919 | Ga0496116_0022031 | Ga0496116_0022031_1103_1663 | 157 |
| 558 | 3300048920 | Ga0496117_0000189 | Ga0496117_0000189_115944_116504 | 157 |
| 559 | 3300048921 | Ga0496118_0000111 | Ga0496118_0000111_35889_36449 | 157 |
| 560 | 3300048922 | Ga0496119_0001233 | Ga0496119_0001233_6539_7066 | 157 |
| 561 | 3300048922 | Ga0496119_0010407 | Ga0496119_0010407_7120_7680 | 157 |
| 562 | 3300048922 | Ga0496119_0020667 | Ga0496119_0020667_884_1444 | 157 |
| 563 | 3300048923 | Ga0496120_0000025 | Ga0496120_0000025_235247_235774 | 157 |
| 564 | 3300048923 | Ga0496120_0025102 | Ga0496120_0025102_3061_3621 | 157 |
| 565 | 3300048923 | Ga0496120_0050239 | Ga0496120_0050239_12_572 | 157 |
| 566 | 3300048928 | Ga0496125_0062432 | Ga0496125_0062432_410_970 | 157 |
| 567 | 3300048929 | Ga0496126_0012241 | Ga0496126_0012241_1421_1981 | 157 |
| 568 | 3300053092 | Ga0500583_0013741 | Ga0500583_0013741_1064_1546 | 157 |
| 569 | 3300053115 | Ga0500591_024205 | Ga0500591_024205_2160_2687 | 157 |
| 570 | 3300053124 | Ga0500617_053167 | Ga0500617_053167_612_1094 | 157 |
| 571 | 3300053130 | Ga0500642_0183027 | Ga0500642_0183027_10_492 | 157 |
| 572 | 3300053131 | Ga0500652_060627 | Ga0500652_060627_94_576 | 157 |
| 573 | 3300053134 | Ga0500658_0067067 | Ga0500658_0067067_280_762 | 157 |
| 574 | 3300053136 | Ga0500559_0432771 | Ga0500559_0432771_17_544 | 157 |
| 575 | 3300053146 | Ga0500588_0002216 | Ga0500588_0002216_1133_1615 | 157 |
| 576 | 3300053158 | Ga0500627_0217696 | Ga0500627_0217696_56_529 | 157 |
| 577 | 3300003203 | JGI25406J46586_10002943 | JGI25406J46586_100029438 | 158 |
| 578 | 3300003911 | JGI25405J52794_10034364 | JGI25405J52794_100343642 | 158 |
| 579 | 3300005719 | Ga0068861_100718347 | Ga0068861_1007183472 | 158 |
| 580 | 3300005937 | Ga0081455_10002817 | Ga0081455_1000281713 | 158 |
| 581 | 3300005985 | Ga0081539_10000007 | Ga0081539_10000007144 | 158 |
| 582 | 3300028786 | Ga0307517_10447696 | Ga0307517_104476962 | 158 |
| 583 | 3300031507 | Ga0307509_10269132 | Ga0307509_102691322 | 158 |
| 584 | 3300031507 | Ga0307509_10315944 | Ga0307509_103159442 | 158 |
| 585 | 3300044658 | Ga0466972_0049994 | Ga0466972_0049994_1233_1712 | 158 |
| 586 | 3300045051 | Ga0451576_1135409 | Ga0451576_1135409_48_530 | 158 |
| 587 | 3300046542 | Ga0495597_0080012 | Ga0495597_0080012_721_1254 | 158 |
| 588 | 3300048918 | Ga0496115_1056487 | Ga0496115_1056487_27_593 | 158 |
| 589 | 3300053104 | Ga0500556_0071245 | Ga0500556_0071245_53_538 | 158 |
| 590 | 3300053104 | Ga0500556_0116080 | Ga0500556_0116080_418_903 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qyn-assembly1.cif.gz_C | crystal structure of secb from escherichia coli | 0.8244 | 19 | 147 |
| 1fx3-assembly1.cif.gz_D | crystal structure of h. influenzae secb | 0.8206 | 19 | 147 |
| 1ozb-assembly1.cif.gz_A | crystal structure of secb complexed with seca c-terminus | 0.8125 | 18 | 148 |
| 5mtw-assembly1.cif.gz_D | mycobacterium tuberculosis rv1957 secb-like chaperone in complex with a chad peptide from rv1956 higa1 antitoxin | 0.8082 | 20 | 132 |
| 1qyn-assembly1.cif.gz_C | crystal structure of secb from escherichia coli | 0.8004 | 19 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qynD00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7917 | 19 | 152 | 3.10.420.10 |
| af_P95257_21_163_3.10.420.10 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7866 | 20 | 132 | 3.10.420.10 |
| 1qynD00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7749 | 19 | 152 | 3.10.420.10 |
| af_B0G139_402_524_2.60.40.1470 | Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain | 0.7072 | 48 | 79 | 2.60.40.1470 |
| af_P9WK27_1_201_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.703 | 46 | 108 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351DN78-F1-model_v4 | Protein-export chaperone SecB | 0.9406 | 13 | 125 |
GO:0015031
GO:0051082 GO:0051262 |
| AF-A0A2G6CJZ6-F1-model_v4 | Protein-export chaperone SecB | 0.9314 | 14 | 108 |
GO:0015031
GO:0051082 GO:0051262 |
| AF-A0A659XY36-F1-model_v4 | Protein-export chaperone SecB | 0.9158 | 21 | 116 |
GO:0015031
GO:0051082 GO:0051262 |
| AF-A0A3D3ARW2-F1-model_v4 | deleted | 0.9108 | 13 | 116 |
|
| AF-A0A351DN78-F1-model_v4 | Protein-export chaperone SecB | 0.9094 | 13 | 125 |
GO:0015031
GO:0051082 GO:0051262 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar