F466992

General Info

Members Datasets Scaffolds Average Seq Length
590 325 461 199

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0179333|Ga0453683_0179333_534_1235
Length 233
Sequence MIALDSQEESGNTARRRRFGGVTCQASNNLTRSSTMAVLVGKAAPDFTATAVLGNNEIKNIKLSDYKGKHVVLFFYPLDFTFVCPSELIAFDHRLEDFQKRGVEVIGCSIDSQFTHLAWKNTPVNNGGIGQVKYPLVADINHAICQAYDVEATGGVAFRGSFLIDKAGIVQHQVVNNLPLGRNIDEMLRMVDALQFTEEHGEVCPAGWQKGKAGMQASPDGVAKYLASHAKEL

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
5 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
6 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
7 2547132512 Azospira oryzae 6a3 Isolate Unclassified
8 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
9 2561511199 Enterobacter sp. R4-368 Isolate Nodule
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
13 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
14 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
15 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
16 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
17 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
18 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
19 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
20 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
21 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
22 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
23 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
24 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
25 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
26 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
27 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
28 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
29 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
30 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
31 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
32 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
33 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
34 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
35 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
36 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
37 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
38 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
39 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
40 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
41 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
42 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
43 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
44 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
45 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
46 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
47 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
48 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
49 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
50 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
51 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
52 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
53 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
54 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
55 2636415599 Klebsiella variicola DX120E Isolate Unclassified
56 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
57 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
58 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
59 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
60 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
61 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
62 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
63 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
64 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
65 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
66 2751185917 Enterobacter sp. HK169 Isolate Unclassified
67 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
68 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
69 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
70 2775507074 Klebsiella sp. D5A Isolate Unclassified
71 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
72 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
73 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
74 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
75 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
76 2821118458 Enterobacter asburiae 609 Isolate Unclassified
77 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
78 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
79 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
80 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
81 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
82 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
83 2847085930 Erwinia persicina B64 Isolate Bulb
84 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
85 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
86 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
87 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
88 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
89 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
90 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
91 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
92 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
93 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
94 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
95 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
96 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
97 2904504865 Serratia marcescens 1822 Isolate Unclassified
98 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
99 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
100 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
101 2919150387 Rahnella aceris 1817 Isolate Unclassified
102 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
103 2927143783 Rahnella sp. 2050 Isolate Unclassified
104 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
105 2932406140 Serratia sp. 2723 Isolate Rhizosphere
106 2937539931 Pantoea sp. LS15 Isolate Unclassified
107 2937967321 Serratia sp. YC16 Isolate Unclassified
108 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
109 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
110 2939577877 Serratia sp. 509 Isolate Rhizosphere
111 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
112 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
113 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
114 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
115 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
116 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
117 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
118 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
119 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
120 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
121 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
122 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
123 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
124 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
125 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
126 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
127 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
128 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
129 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
130 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
139 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
140 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
141 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
142 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
143 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
144 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
145 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
164 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
165 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
166 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
212 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
222 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
223 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
224 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
225 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
226 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
227 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
228 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
232 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
235 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
236 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
237 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
287 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
307 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 640753048 Serratia proteamaculans 568 Isolate Endosphere
316 8004592986 Serratia sp. S119 Isolate Unclassified
317 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
318 8018221730 Enterobacter sp. CM29 Isolate Unclassified
319 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
320 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
321 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
322 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
323 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
324 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
325 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.37
Metatranscriptomes 5.76
Isolates 21.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0.17
Endosphere 6.1
Nodule 3.05
Rhizoplane 9.15
Rhizosphere 60.34
Stem 0
Stem Tuber 1.02
Unclassified 19.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000003 3300002737 Bacteria 575218
2 JGI25163J39215_1000062 3300002771 Bacteria 48435
3 JGI25164J39214_1000009 3300002772 Bacteria 303437
4 JGI25165J46597_1017328 3300003214 Bacteria 959
5 rootH2_10015620 3300003320 Bacteria 27832
6 Ga0055538_1000005 3300003751 Bacteria 575218
7 Ga0055539_1000007 3300003752 Bacteria 575218
8 Ga0055533_1000009 3300003756 Bacteria 575218
9 Ga0055525_1000010 3300003759 Bacteria 575218
10 Ga0055541_1000005 3300003841 Bacteria 575218
11 Ga0058692_1001175 3300003856 Bacteria 10057
12 Ga0058692_1031678 3300003856 Bacteria 993
13 Ga0058862_12009584 3300004803 Eukaryota 653
14 Ga0058862_12846961 3300004803 Eukaryota 805
15 Ga0065703_1019868 3300005272 Bacteria 2316
16 Ga0065704_10000444 3300005289 Bacteria 86255
17 Ga0065704_10000805 3300005289 Bacteria 22150
18 Ga0065704_10355730 3300005289 Bacteria 791
19 Ga0070660_100454887 3300005339 Bacteria 1062
20 Ga0070661_100690102 3300005344 Bacteria 831
21 Ga0070659_100605168 3300005366 Bacteria 942
22 Ga0070698_100204857 3300005471 Bacteria 1908
23 Ga0070665_100002124 3300005548 Bacteria 22143
24 Ga0068857_100035370 3300005577 Bacteria 4424
25 Ga0068851_10073993 3300005834 Bacteria 1767
26 Ga0081455_10419118 3300005937 Bacteria 924
27 Ga0075364_10001196 3300006051 Bacteria 13934
28 Ga0075364_10357735 3300006051 Bacteria 995
29 Ga0075364_10528249 3300006051 Bacteria 807
30 Ga0075367_10492900 3300006178 Bacteria 777
31 Ga0075366_10017456 3300006195 Bacteria 4130
32 Ga0075366_10038652 3300006195 Bacteria 2819
33 Ga0075428_100620870 3300006844 Bacteria 1154
34 Ga0075430_100032821 3300006846 Bacteria 4406
35 Ga0079104_1000166 3300006946 Bacteria 94027
36 Ga0079104_1000174 3300006946 Bacteria 91722
37 Ga0079104_1000192 3300006946 Bacteria 85695
38 Ga0079104_1000578 3300006946 Bacteria 36991
39 Ga0079104_1000845 3300006946 Bacteria 25452
40 Ga0079104_1001233 3300006946 Bacteria 17982
41 Ga0105251_10000254 3300009011 Bacteria 53726
42 Ga0105251_10000827 3300009011 Bacteria 27696
43 Ga0105251_10001719 3300009011 Bacteria 18320
44 Ga0105251_10001743 3300009011 Bacteria 18159
45 Ga0105251_10001955 3300009011 Bacteria 16844
46 Ga0105251_10003499 3300009011 Bacteria 11360
47 Ga0105251_10069159 3300009011 Bacteria 1647
48 Ga0105244_10000031 3300009036 Bacteria 177606
49 Ga0105244_10000041 3300009036 Bacteria 155525
50 Ga0105244_10000105 3300009036 Bacteria 86528
51 Ga0105244_10001211 3300009036 Bacteria 21159
52 Ga0105244_10002072 3300009036 Bacteria 15427
53 Ga0105244_10031954 3300009036 Bacteria 2792
54 Ga0105250_10000003 3300009092 Bacteria 547770
55 Ga0105250_10000052 3300009092 Bacteria 116382
56 Ga0105250_10000150 3300009092 Bacteria 61428
57 Ga0105250_10000320 3300009092 Bacteria 36962
58 Ga0105250_10003644 3300009092 Bacteria 7251
59 Ga0105250_10010479 3300009092 Bacteria 3863
60 Ga0105250_10097781 3300009092 Bacteria 1197
61 Ga0105240_10342309 3300009093 Bacteria 1698
62 Ga0105247_10000191 3300009101 Bacteria 60259
63 Ga0105243_10289713 3300009148 Bacteria 1479
64 Ga0105241_10000004 3300009174 Bacteria 803007
65 Ga0105237_10029153 3300009545 Bacteria 5614
66 Ga0105237_10618255 3300009545 Bacteria 1090
67 Ga0105239_10810406 3300010375 Bacteria 1073
68 Ga0105239_11499317 3300010375 Bacteria 779
69 Ga0157373_10030819 3300013100 Bacteria 3859
70 Ga0157373_10087601 3300013100 Bacteria 2194
71 Ga0157373_10116591 3300013100 Bacteria 1877
72 Ga0157371_10000007 3300013102 Bacteria 401847
73 Ga0157370_10000122 3300013104 Bacteria 91538
74 Ga0163162_10175717 3300013306 Bacteria 2267
75 Ga0157372_10006185 3300013307 Bacteria 12728
76 Ga0157372_10046090 3300013307 Bacteria 4839
77 Ga0157372_10347858 3300013307 Bacteria 1727
78 Ga0182008_10004036 3300014497 Bacteria 8665
79 Ga0182006_1000020 3300015261 Bacteria 285318
80 Ga0182006_1132128 3300015261 Bacteria 858
81 Ga0183366_1001 3300015679 Bacteria 2743932
82 Ga0183370_1001 3300015680 Bacteria 2743932
83 Ga0183369_1001 3300015685 Bacteria 2743932
84 Ga0183368_1001 3300015687 Bacteria 2743932
85 Ga0163161_10000004 3300017792 Bacteria 333149
86 Ga0163161_10033976 3300017792 Bacteria 3647
87 Ga0206354_11367514 3300020081 Bacteria 644
88 Ga0213872_10000414 3300021361 Bacteria 35013
89 Ga0213872_10000807 3300021361 Bacteria 22716
90 Ga0213872_10002543 3300021361 Bacteria 10633
91 Ga0213872_10006294 3300021361 Bacteria 5984
92 Ga0213876_10347102 3300021384 Bacteria 789
93 Ga0209760_100069 3300025207 Bacteria 83692
94 Ga0209784_100001 3300025224 Bacteria 3600592
95 Ga0209566_100001 3300025225 Bacteria 3600765
96 Ga0209674_100002 3300025226 Bacteria 3600592
97 Ga0209563_100008 3300025230 Bacteria 1554545
98 Ga0207427_100002 3300025231 Bacteria 1355321
99 Ga0209437_100007 3300025233 Bacteria 938377
100 Ga0209677_100004 3300025253 Bacteria 1554545
101 Ga0209233_1003111 3300025261 Bacteria 5898
102 Ga0207696_1000003 3300025711 Bacteria 860639
103 Ga0207696_1000004 3300025711 Bacteria 671626
104 Ga0207696_1000007 3300025711 Bacteria 578417
105 Ga0207696_1000033 3300025711 Bacteria 360689
106 Ga0207696_1000313 3300025711 Bacteria 54096
107 Ga0207696_1001321 3300025711 Bacteria 13708
108 Ga0207696_1017107 3300025711 Bacteria 2409
109 Ga0207696_1052151 3300025711 Bacteria 1167
110 Ga0207655_1000001 3300025728 Bacteria 1866413
111 Ga0207655_1000011 3300025728 Bacteria 643321
112 Ga0207655_1000029 3300025728 Bacteria 432187
113 Ga0207655_1000087 3300025728 Bacteria 205876
114 Ga0207655_1000121 3300025728 Bacteria 155535
115 Ga0207655_1000226 3300025728 Bacteria 94688
116 Ga0207655_1000404 3300025728 Bacteria 59563
117 Ga0207655_1000559 3300025728 Bacteria 46436
118 Ga0207655_1029382 3300025728 Bacteria 2574
119 Ga0207713_1000005 3300025735 Bacteria 649958
120 Ga0207713_1000038 3300025735 Bacteria 247609
121 Ga0207713_1000065 3300025735 Bacteria 196128
122 Ga0207713_1000108 3300025735 Bacteria 137268
123 Ga0207713_1000155 3300025735 Bacteria 102677
124 Ga0207713_1001769 3300025735 Bacteria 16551
125 Ga0207713_1006287 3300025735 Bacteria 7260
126 Ga0207713_1046152 3300025735 Bacteria 1774
127 Ga0207713_1118598 3300025735 Bacteria 890
128 Ga0207713_1139314 3300025735 Bacteria 794
129 Ga0207710_10000016 3300025900 Bacteria 388568
130 Ga0207654_10000006 3300025911 Bacteria 815027
131 Ga0207695_10218033 3300025913 Bacteria 1816
132 Ga0207657_10332546 3300025919 Bacteria 1200
133 Ga0207690_10533057 3300025932 Bacteria 953
134 Ga0207709_10007879 3300025935 Bacteria 5903
135 Ga0207674_10078122 3300026116 Bacteria 3315
136 Ga0209281_1000001 3300027111 Bacteria 1933496
137 Ga0209281_1000008 3300027111 Bacteria 867470
138 Ga0209281_1000021 3300027111 Bacteria 541033
139 Ga0209281_1000075 3300027111 Bacteria 267114
140 Ga0209281_1000093 3300027111 Bacteria 240724
141 Ga0209281_1000254 3300027111 Bacteria 105570
142 Ga0209281_1000480 3300027111 Bacteria 55767
143 Ga0209281_1000492 3300027111 Bacteria 53875
144 Ga0209281_1001723 3300027111 Bacteria 11282
145 Ga0209281_1002685 3300027111 Bacteria 6726
146 Ga0209281_1004290 3300027111 Bacteria 4314
147 Ga0209371_1000001 3300027312 Bacteria 2771503
148 Ga0209371_1000104 3300027312 Bacteria 148080
149 Ga0209371_1000946 3300027312 Bacteria 22605
150 Ga0209371_1001819 3300027312 Bacteria 13271
151 Ga0209371_1008692 3300027312 Bacteria 3329
152 Ga0268266_10000165 3300028379 Bacteria 122830
153 Ga0265323_10021331 3300028653 Bacteria 2483
154 Ga0265336_10000185 3300028666 Bacteria 43870
155 Ga0265338_10093790 3300028800 Bacteria 2472
156 Ga0265338_10519268 3300028800 Bacteria 837
157 Ga0265324_10000011 3300029957 Bacteria 218521
158 Ga0265324_10002330 3300029957 Bacteria 9829
159 Ga0265324_10008459 3300029957 Bacteria 4088
160 Ga0268256_1000001 3300030500 Bacteria 2771065
161 Ga0268256_1000017 3300030500 Bacteria 600718
162 Ga0268256_1001277 3300030500 Bacteria 15637
163 Ga0268256_1001587 3300030500 Bacteria 13271
164 Ga0265330_10002891 3300031235 Bacteria 9166
165 Ga0265332_10000039 3300031238 Bacteria 128373
166 Ga0265328_10000002 3300031239 Bacteria 275819
167 Ga0265328_10054967 3300031239 Bacteria 1461
168 Ga0265325_10001032 3300031241 Bacteria 20084
169 Ga0265325_10030654 3300031241 Bacteria 2882
170 Ga0265331_10000012 3300031250 Bacteria 297201
171 Ga0265331_10000019 3300031250 Bacteria 258837
172 Ga0265331_10007377 3300031250 Bacteria 6368
173 Ga0265331_10024100 3300031250 Bacteria 3083
174 Ga0265331_10035018 3300031250 Bacteria 2472
175 Ga0265331_10053191 3300031250 Bacteria 1932
176 Ga0265331_10096111 3300031250 Bacteria 1367
177 Ga0265331_10153338 3300031250 Bacteria 1046
178 Ga0265327_10000068 3300031251 Bacteria 219962
179 Ga0265327_10000173 3300031251 Bacteria 138925
180 Ga0265327_10000471 3300031251 Bacteria 71254
181 Ga0265327_10001224 3300031251 Bacteria 34492
182 Ga0265327_10012104 3300031251 Bacteria 5855
183 Ga0265327_10039452 3300031251 Bacteria 2565
184 Ga0265316_10027461 3300031344 Bacteria 4712
185 Ga0265316_10077865 3300031344 Bacteria 2546
186 Ga0265316_10099394 3300031344 Bacteria 2213
187 Ga0265316_10100700 3300031344 Bacteria 2196
188 Ga0265316_10115723 3300031344 Bacteria 2027
189 Ga0307509_10000018 3300031507 Bacteria 258998
190 Ga0307508_10211792 3300031616 Bacteria 1538
191 Ga0307514_10065978 3300031649 Bacteria 2739
192 Ga0316575_10003181 3300031665 Bacteria 5619
193 Ga0265314_10000262 3300031711 Bacteria 77107
194 Ga0265314_10000307 3300031711 Bacteria 70029
195 Ga0316577_10006905 3300031733 Bacteria 6030
196 Ga0316583_10002950 3300032133 Bacteria 5980
197 Ga0316583_10003069 3300032133 Bacteria 5867
198 Ga0316583_10097330 3300032133 Bacteria 1026
199 Ga0316593_10009940 3300032168 Bacteria 2710
200 Ga0316593_10014448 3300032168 Bacteria 2355
201 Ga0316593_10049646 3300032168 Bacteria 1415
202 Ga0316593_10071464 3300032168 Bacteria 1201
203 Ga0316593_10201503 3300032168 Bacteria 736
204 Ga0316593_10216189 3300032168 Bacteria 711
205 Ga0316592_1025299 3300033524 Bacteria 1280
206 Ga0316592_1046926 3300033524 Bacteria 962
207 Ga0316592_1096122 3300033524 Bacteria 680
208 Ga0316592_1104706 3300033524 Bacteria 652
209 Ga0316588_1017969 3300033528 Bacteria 1580
210 Ga0316588_1026857 3300033528 Bacteria 1335
211 Ga0316587_1006039 3300033529 Bacteria 1837
212 Ga0316587_1053472 3300033529 Bacteria 742
213 Ga0316587_1056118 3300033529 Bacteria 726
214 Ga0316587_1058650 3300033529 Bacteria 711
215 Ga0316587_1060212 3300033529 Bacteria 703
216 Ga0316596_1034049 3300033541 Bacteria 1329
217 Ga0316596_1060269 3300033541 Bacteria 1012
218 Ga0316596_1069406 3300033541 Bacteria 943
219 Ga0316596_1070046 3300033541 Bacteria 939
220 Ga0316596_1078928 3300033541 Bacteria 884
221 Ga0316596_1109012 3300033541 Bacteria 751
222 Ga0316596_1117778 3300033541 Bacteria 722
223 Ga0316596_1118563 3300033541 Bacteria 720
224 Ga0316596_1121170 3300033541 Bacteria 712
225 Ga0316596_1126447 3300033541 Bacteria 697
226 Ga0316596_1126516 3300033541 Bacteria 697
227 Ga0316596_1144099 3300033541 Bacteria 653
228 Ga0316596_1145931 3300033541 Bacteria 649
229 Ga0316574_0000014 3300035398 Bacteria 42376
230 Ga0316582_0010254 3300036647 Bacteria 5123
231 Ga0316582_0782235 3300036647 Bacteria 654
232 Ga0316584_0023544 3300036712 Bacteria 4499
233 Ga0316584_0134659 3300036712 Bacteria 1845
234 Ga0373925_0885176 3300037068 Bacteria 736
235 Ga0400484_20914 3300038725 Bacteria 5273
236 Ga0400484_39735 3300038725 Bacteria 4976
237 Ga0400490_05485 3300038726 Bacteria 73498
238 Ga0400490_36510 3300038726 Bacteria 7687
239 Ga0400490_37780 3300038726 Bacteria 37835
240 Ga0400490_47679 3300038726 Bacteria 119204
241 Ga0400491_19719 3300038727 Bacteria 14547
242 Ga0400485_02110 3300038735 Bacteria 20147
243 Ga0400485_08080 3300038735 Bacteria 12733
244 Ga0400488_07068 3300038741 Bacteria 8344
245 Ga0400488_14649 3300038741 Bacteria 2376
246 Ga0400488_19178 3300038741 Bacteria 7374
247 Ga0400488_38786 3300038741 Bacteria 1095
248 Ga0400486_13079 3300038742 Bacteria 32894
249 Ga0400486_26530 3300038742 Bacteria 3310
250 Ga0400486_30938 3300038742 Bacteria 20776
251 Ga0400483_011695 3300039062 Bacteria 16998
252 Ga0400483_059991 3300039062 Bacteria 2905
253 Ga0400483_067420 3300039062 Bacteria 26098
254 Ga0400483_076262 3300039062 Bacteria 3305
255 Ga0400483_089669 3300039062 Bacteria 3262
256 Ga0400483_136165 3300039062 Bacteria 23864
257 Ga0400483_194015 3300039062 Bacteria 1586
258 Ga0400483_199105 3300039062 Bacteria 12845
259 Ga0400483_254574 3300039062 Bacteria 3627
260 Ga0400487_06586 3300039110 Bacteria 1096
261 Ga0400487_13389 3300039110 Unclassified 1068
262 Ga0400487_22173 3300039110 Bacteria 2400
263 Ga0400487_33200 3300039110 Unclassified 1487
264 Ga0400487_47932 3300039110 Bacteria 12738
265 Ga0400487_55141 3300039110 Bacteria 10633
266 Ga0400487_64640 3300039110 Bacteria 31253
267 Ga0436365_1871244 3300039437 Bacteria 1217
268 Ga0436361_0041735 3300039447 Bacteria 40196
269 Ga0436361_0071841 3300039447 Bacteria 1496
270 Ga0436361_0105560 3300039447 Bacteria 44727
271 Ga0436361_0164497 3300039447 Bacteria 699
272 Ga0436361_0432960 3300039447 Bacteria 11072
273 Ga0436361_0718861 3300039447 Bacteria 22975
274 Ga0436361_1190835 3300039447 Bacteria 817
275 Ga0439438_000763 3300041405 Bacteria 14419
276 Ga0439447_002208 3300041407 Bacteria 7139
277 Ga0451837_0353250 3300041494 Bacteria 702
278 Ga0439432_030031 3300042006 Bacteria 1764
279 Ga0439432_077141 3300042006 Bacteria 1011
280 Ga0439452_000003 3300042010 Bacteria 942815
281 Ga0439452_000040 3300042010 Bacteria 143490
282 Ga0439452_000361 3300042010 Bacteria 27829
283 Ga0439456_028189 3300042013 Bacteria 1198
284 Ga0450900_005690 3300042136 Bacteria 1482
285 Ga0439464_0053824 3300042439 Bacteria 1168
286 Ga0451577_0000085 3300042876 Bacteria 211141
287 Ga0451577_0000104 3300042876 Bacteria 186417
288 Ga0451577_0000134 3300042876 Bacteria 165856
289 Ga0451577_0000280 3300042876 Bacteria 98991
290 Ga0451577_0002253 3300042876 Bacteria 23418
291 Ga0451577_0008429 3300042876 Bacteria 10034
292 Ga0451577_0008841 3300042876 Bacteria 9752
293 Ga0451577_0017350 3300042876 Bacteria 6653
294 Ga0451577_0026030 3300042876 Bacteria 5300
295 Ga0451577_0076242 3300042876 Bacteria 2990
296 Ga0451577_0093736 3300042876 Bacteria 2681
297 Ga0451577_0247423 3300042876 Bacteria 1614
298 Ga0451577_0333951 3300042876 Bacteria 1375
299 Ga0466981_0000161 3300044669 Bacteria 18917
300 Ga0453683_0000047 3300044673 Bacteria 207763
301 Ga0453683_0179333 3300044673 Bacteria 1343
302 Ga0453683_0188086 3300044673 Bacteria 1310
303 Ga0453683_0628347 3300044673 Bacteria 701
304 Ga0453683_0748547 3300044673 Unclassified 642
305 Ga0453683_1041375 3300044673 Bacteria 544
306 Ga0466961_0000231 3300044693 Bacteria 37788
307 Ga0453684_0000063 3300044712 Bacteria 486079
308 Ga0453684_0000065 3300044712 Bacteria 468481
309 Ga0453684_0000273 3300044712 Bacteria 222658
310 Ga0453684_0000302 3300044712 Bacteria 207763
311 Ga0453684_0000364 3300044712 Bacteria 186418
312 Ga0453684_0000426 3300044712 Bacteria 172005
313 Ga0453684_0000953 3300044712 Bacteria 95365
314 Ga0453684_0001142 3300044712 Bacteria 82866
315 Ga0453684_0001472 3300044712 Bacteria 66447
316 Ga0453684_0001751 3300044712 Bacteria 58062
317 Ga0453684_0011803 3300044712 Bacteria 14556
318 Ga0453684_0021396 3300044712 Bacteria 9664
319 Ga0453684_0026506 3300044712 Bacteria 8364
320 Ga0453684_0036731 3300044712 Bacteria 6744
321 Ga0453684_0074999 3300044712 Bacteria 4255
322 Ga0453684_0082608 3300044712 Bacteria 4001
323 Ga0453684_0148279 3300044712 Bacteria 2791
324 Ga0453684_0172521 3300044712 Bacteria 2547
325 Ga0453684_0259570 3300044712 Bacteria 1991
326 Ga0453684_0295728 3300044712 Bacteria 1842
327 Ga0453684_0307672 3300044712 Bacteria 1799
328 Ga0466959_0080307 3300045049 Bacteria 2351
329 Ga0451576_0000006 3300045051 Bacteria 949698
330 Ga0451576_0000056 3300045051 Bacteria 303398
331 Ga0451576_0000116 3300045051 Bacteria 207763
332 Ga0451576_0000659 3300045051 Bacteria 71101
333 Ga0451576_0001853 3300045051 Bacteria 34252
334 Ga0451576_0002503 3300045051 Bacteria 27266
335 Ga0451576_0002526 3300045051 Bacteria 27094
336 Ga0451576_0018576 3300045051 Bacteria 7613
337 Ga0451576_0020304 3300045051 Bacteria 7236
338 Ga0451576_0037768 3300045051 Bacteria 5114
339 Ga0451576_0046204 3300045051 Bacteria 4585
340 Ga0451576_0047488 3300045051 Bacteria 4513
341 Ga0451576_0168985 3300045051 Bacteria 2282
342 Ga0495627_000136 3300046453 Bacteria 87662
343 Ga0495591_008507 3300046458 Bacteria 4196
344 Ga0495638_0064293 3300046460 Bacteria 2260
345 Ga0495650_0000016 3300046471 Bacteria 554693
346 Ga0495650_0000033 3300046471 Bacteria 412188
347 Ga0495650_0000205 3300046471 Bacteria 128197
348 Ga0495584_0011843 3300046491 Bacteria 4460
349 Ga0495607_0012669 3300046501 Bacteria 5555
350 Ga0495606_0000296 3300046507 Bacteria 85795
351 Ga0495631_0097091 3300046518 Bacteria 1268
352 Ga0495632_0088603 3300046519 Bacteria 1470
353 Ga0495637_0114393 3300046520 Bacteria 1043
354 Ga0495644_0017406 3300046523 Bacteria 2748
355 Ga0495648_0004602 3300046524 Bacteria 11747
356 Ga0495654_0000020 3300046530 Bacteria 284814
357 Ga0495654_0000386 3300046530 Bacteria 38102
358 Ga0495654_0003433 3300046530 Bacteria 9714
359 Ga0495597_0000053 3300046542 Bacteria 95455
360 Ga0495625_0008589 3300046660 Bacteria 8693
361 Ga0495588_0007814 3300046674 Bacteria 4884
362 Ga0495671_0003554 3300046692 Bacteria 9523
363 Ga0495649_0003696 3300046694 Bacteria 10180
364 Ga0495649_0006030 3300046694 Bacteria 7579
365 Ga0495589_0000006 3300046794 Bacteria 303635
366 Ga0495660_0000007 3300046810 Bacteria 485295
367 Ga0495660_0000011 3300046810 Bacteria 361397
368 Ga0495672_0000004 3300047320 Bacteria 631810
369 Ga0495672_0000027 3300047320 Bacteria 325651
370 Ga0495679_000080 3300047446 Bacteria 90450
371 Ga0495679_002092 3300047446 Bacteria 10523
372 Ga0495673_0000023 3300047469 Bacteria 539904
373 Ga0495673_0000930 3300047469 Bacteria 26532
374 Ga0495681_0081428 3300047470 Bacteria 1444
375 Ga0496100_0264425 3300048903 Bacteria 1277
376 Ga0496103_0107711 3300048906 Bacteria 1768
377 Ga0496104_0000810 3300048907 Bacteria 26903
378 Ga0496104_0005159 3300048907 Bacteria 11412
379 Ga0496116_0000031 3300048919 Bacteria 420043
380 Ga0496116_0000054 3300048919 Bacteria 289010
381 Ga0496116_0000170 3300048919 Bacteria 131308
382 Ga0496116_0005721 3300048919 Bacteria 11437
383 Ga0496116_0026931 3300048919 Bacteria 4192
384 Ga0496117_0001230 3300048920 Bacteria 38361
385 Ga0496117_0007239 3300048920 Bacteria 10915
386 Ga0496117_0032079 3300048920 Bacteria 3998
387 Ga0496118_0006433 3300048921 Bacteria 12911
388 Ga0496118_0017095 3300048921 Bacteria 6621
389 Ga0496118_0021230 3300048921 Bacteria 5724
390 Ga0496118_0238329 3300048921 Bacteria 1043
391 Ga0496119_0000078 3300048922 Bacteria 140556
392 Ga0496119_0001296 3300048922 Bacteria 30892
393 Ga0496119_0008099 3300048922 Bacteria 9315
394 Ga0496119_0008475 3300048922 Bacteria 9022
395 Ga0496119_0010104 3300048922 Bacteria 7975
396 Ga0496119_0017994 3300048922 Bacteria 5284
397 Ga0496120_0000009 3300048923 Bacteria 386727
398 Ga0496120_0000265 3300048923 Bacteria 87441
399 Ga0496120_0004921 3300048923 Bacteria 10868
400 Ga0496120_0004997 3300048923 Bacteria 10775
401 Ga0496120_0016275 3300048923 Bacteria 4865
402 Ga0496121_0011365 3300048924 Bacteria 9896
403 Ga0496121_0011922 3300048924 Bacteria 9568
404 Ga0496121_0025092 3300048924 Bacteria 5673
405 Ga0496121_0522535 3300048924 Bacteria 748
406 Ga0496122_0000013 3300048925 Bacteria 501039
407 Ga0496122_0000145 3300048925 Bacteria 165864
408 Ga0496122_0001097 3300048925 Bacteria 46853
409 Ga0496122_0126830 3300048925 Bacteria 1631
410 Ga0496123_0000010 3300048926 Bacteria 501039
411 Ga0496123_0000281 3300048926 Bacteria 100416
412 Ga0496123_0003720 3300048926 Bacteria 16781
413 Ga0496123_0046502 3300048926 Bacteria 2943
414 Ga0496123_0185967 3300048926 Bacteria 1079
415 Ga0496124_0000010 3300048927 Bacteria 595157
416 Ga0496124_0000122 3300048927 Bacteria 161741
417 Ga0496124_0000217 3300048927 Bacteria 112197
418 Ga0496124_0018174 3300048927 Bacteria 6597
419 Ga0496124_0037018 3300048927 Bacteria 4247
420 Ga0496124_0221738 3300048927 Bacteria 1421
421 Ga0496125_0000019 3300048928 Bacteria 474989
422 Ga0496125_0000413 3300048928 Bacteria 79797
423 Ga0496125_0014092 3300048928 Bacteria 7809
424 Ga0496126_0000975 3300048929 Bacteria 49068
425 Ga0496126_0003612 3300048929 Bacteria 19344
426 Ga0496126_0165180 3300048929 Bacteria 1889
427 Ga0496126_0296497 3300048929 Bacteria 1335
428 Ga0495678_004114 3300049459 Bacteria 8613
429 Ga0495682_0000004 3300049460 Bacteria 378337
430 Ga0501300_004804 3300049523 Bacteria 1998
431 Ga0501335_028091 3300049551 Bacteria 626
432 Ga0501032_0085799 3300049569 Bacteria 2093
433 Ga0501033_0006249 3300049570 Bacteria 9335
434 Ga0501034_0001310 3300049571 Bacteria 33696
435 Ga0501034_0191681 3300049571 Bacteria 2006
436 Ga0501034_0716157 3300049571 Bacteria 898
437 Ga0501036_0074072 3300049572 Bacteria 2879
438 Ga0501037_0023888 3300049573 Bacteria 4521
439 Ga0501038_0040839 3300049574 Bacteria 4048
440 Ga0501043_0005342 3300049579 Bacteria 10380
441 Ga0501047_0371184 3300049581 Bacteria 1266
442 Ga0501073_0095173 3300049589 Bacteria 2069
443 Ga0501225_0102587 3300049705 Bacteria 837
444 Ga0501079_0061051 3300049741 Bacteria 2908
445 Ga0501080_0024799 3300049742 Bacteria 5561
446 Ga0501280_000298 3300049776 Bacteria 12518
447 Ga0501035_0025328 3300049822 Bacteria 5439
448 Ga0501044_0050951 3300049823 Bacteria 4270
449 nmdc:mga00v17_253652_c1 3300050491 Bacteria 1141
450 nmdc:mga00v17_44237_c1 3300050491 Bacteria 2685
451 nmdc:mga0qj67_653187_c1 3300050509 Bacteria 839
452 Ga0500643_000735 3300053087 Bacteria 21414
453 Ga0500607_098537 3300053121 Bacteria 1456
454 Ga0500621_000001 3300053126 Bacteria 1049698
455 Ga0500568_0006902 3300053139 Bacteria 5641
456 Ga0500573_0065946 3300053140 Bacteria 2070
457 Ga0500622_0000001 3300053156 Bacteria 657715
458 Ga0500636_0000369 3300053177 Bacteria 24646
459 Ga0500637_0004567 3300053178 Bacteria 6587
460 Ga0500625_029348 3300053729 Bacteria 2611
461 Ga0501082_0152405 3300060353 Bacteria 2008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_1041375 Ga0453683_1041375_40_534 164
2 3300009545 Ga0105237_10029153 Ga0105237_100291535 192
3 3300010375 Ga0105239_11499317 Ga0105239_114993171 192
4 3300021384 Ga0213876_10347102 Ga0213876_103471021 192
5 3300039437 Ga0436365_1871244 Ga0436365_1871244_131_712 192
6 3300004803 Ga0058862_12009584 Ga0058862_120095841 193
7 3300004803 Ga0058862_12846961 Ga0058862_128469611 193
8 3300042876 Ga0451577_0333951 Ga0451577_0333951_708_1289 193
9 3300049571 Ga0501034_0191681 Ga0501034_0191681_1384_1968 193
10 3300033541 Ga0316596_1070046 Ga0316596_10700461 194
11 3300042876 Ga0451577_0000104 Ga0451577_0000104_151683_152270 194
12 3300044673 Ga0453683_0748547 Ga0453683_0748547_25_624 194
13 3300044712 Ga0453684_0000364 Ga0453684_0000364_34149_34736 194
14 3300033524 Ga0316592_1025299 Ga0316592_10252992 195
15 3300033528 Ga0316588_1017969 Ga0316588_10179693 195
16 3300033528 Ga0316588_1026857 Ga0316588_10268572 195
17 3300033541 Ga0316596_1034049 Ga0316596_10340491 195
18 3300033541 Ga0316596_1109012 Ga0316596_11090121 195
19 iso_pu_bacteria 2526164512 2526211855 195
20 iso_pu_bacteria 2547132512 2548848809 195
21 3300006844 Ga0075428_100620870 Ga0075428_1006208701 196
22 3300031711 Ga0265314_10000307 Ga0265314_1000030718 196
23 iso_pu_bacteria 2506520007 2506577021 196
24 iso_pu_bacteria 2506520008 2506582159 196
25 iso_pu_bacteria 2508501071 2508850997 196
26 iso_pu_bacteria 2537561728 2538428277 196
27 iso_pu_bacteria 2547132103 2547375899 196
28 iso_pu_bacteria 2554235234 2555259487 196
29 iso_pu_bacteria 2561511199 2562466217 196
30 iso_pu_bacteria 2585427591 2585828322 196
31 iso_pu_bacteria 2585427592 2585831379 196
32 iso_pu_bacteria 2599185169 2599412066 196
33 iso_pu_bacteria 2600255254 2601525244 196
34 iso_pu_bacteria 2600255255 2601530431 196
35 iso_pu_bacteria 2600255256 2601531668 196
36 iso_pu_bacteria 2600255257 2601537040 196
37 iso_pu_bacteria 2600255280 2601616965 196
38 iso_pu_bacteria 2600255281 2601621688 196
39 iso_pu_bacteria 2600255287 2601644900 196
40 iso_pu_bacteria 2600255288 2601650588 196
41 iso_pu_bacteria 2600255289 2601655012 196
42 iso_pu_bacteria 2600255290 2601660321 196
43 iso_pu_bacteria 2600255291 2601665130 196
44 iso_pu_bacteria 2600255298 2601697745 196
45 iso_pu_bacteria 2600255299 2601703133 196
46 iso_pu_bacteria 2600255300 2601708168 196
47 iso_pu_bacteria 2600255301 2601713261 196
48 iso_pu_bacteria 2600255302 2601718571 196
49 iso_pu_bacteria 2600255303 2601723294 196
50 iso_pu_bacteria 2600255304 2601728196 196
51 iso_pu_bacteria 2600255305 2601733519 196
52 iso_pu_bacteria 2600255306 2601738180 196
53 iso_pu_bacteria 2600255307 2601742303 196
54 iso_pu_bacteria 2600255309 2601753517 196
55 iso_pu_bacteria 2600255310 2601755386 196
56 iso_pu_bacteria 2600255311 2601760753 196
57 iso_pu_bacteria 2600255392 2602020096 196
58 iso_pu_bacteria 2602042046 2603639203 196
59 iso_pu_bacteria 2602042047 2603643643 196
60 iso_pu_bacteria 2602042052 2603661926 196
61 iso_pu_bacteria 2602042053 2603666824 196
62 iso_pu_bacteria 2602042066 2603700226 196
63 iso_pu_bacteria 2602042067 2603704216 196
64 iso_pu_bacteria 2602042103 2603840632 196
65 iso_pu_bacteria 2602042104 2603845706 196
66 iso_pu_bacteria 2602042105 2603850779 196
67 iso_pu_bacteria 2602042106 2603855849 196
68 iso_pu_bacteria 2602042109 2603866378 196
69 iso_pu_bacteria 2602042110 2603873430 196
70 iso_pu_bacteria 2602042111 2603877520 196
71 iso_pu_bacteria 2603880178 2606050608 196
72 iso_pu_bacteria 2603880184 2606071256 196
73 iso_pu_bacteria 2603880202 2606148292 196
74 iso_pu_bacteria 2603880211 2606178499 196
75 iso_pu_bacteria 2636415599 2637226814 196
76 iso_pu_bacteria 2654587920 2656279390 196
77 iso_pu_bacteria 2667528172 2671102146 196
78 iso_pu_bacteria 2667528173 2671108475 196
79 iso_pu_bacteria 2671180115 2671585291 196
80 iso_pu_bacteria 2675903046 2676407034 196
81 iso_pu_bacteria 2681812866 2681995977 196
82 iso_pu_bacteria 2681812869 2682008995 196
83 iso_pu_bacteria 2687453601 2689443421 196
84 iso_pu_bacteria 2706794495 2707099599 196
85 iso_pu_bacteria 2711768156 2712470604 196
86 iso_pu_bacteria 2751185917 2753854845 196
87 iso_pu_bacteria 2765235842 2765587711 196
88 iso_pu_bacteria 2772190666 2772437547 196
89 iso_pu_bacteria 2775506706 2775541890 196
90 iso_pu_bacteria 2775507074 2777022538 196
91 iso_pu_bacteria 2791355010 2792313637 196
92 iso_pu_bacteria 2791355275 2793406615 196
93 iso_pu_bacteria 2806310673 2807179752 196
94 iso_pu_bacteria 2811995292 2813730246 196
95 iso_pu_bacteria 2814123068 2814697837 196
96 iso_pu_bacteria 2821118458 2821118625 196
97 iso_pu_bacteria 2823373977 2823377173 196
98 iso_pu_bacteria 2843690924 2843691601 196
99 iso_pu_bacteria 2844425489 2844426396 196
100 iso_pu_bacteria 2846033681 2846035444 196
101 iso_pu_bacteria 2846037992 2846040194 196
102 iso_pu_bacteria 2846540461 2846541392 196
103 iso_pu_bacteria 2847085930 2847088796 196
104 iso_pu_bacteria 2852103415 2852103475 196
105 iso_pu_bacteria 2854601825 2854602597 196
106 iso_pu_bacteria 2855195626 2855198910 196
107 iso_pu_bacteria 2858466076 2858469878 196
108 iso_pu_bacteria 2869551831 2869552832 196
109 iso_pu_bacteria 2871272651 2871276781 196
110 iso_pu_bacteria 2871282230 2871283978 196
111 iso_pu_bacteria 2884086401 2884090136 196
112 iso_pu_bacteria 2888366609 2888367566 196
113 iso_pu_bacteria 2888373701 2888374739 196
114 iso_pu_bacteria 2891670763 2891674842 196
115 iso_pu_bacteria 2900051742 2900054322 196
116 iso_pu_bacteria 2904474040 2904474853 196
117 iso_pu_bacteria 2904504865 2904505710 196
118 iso_pu_bacteria 2904513164 2904515080 196
119 iso_pu_bacteria 2908669403 2908671326 196
120 iso_pu_bacteria 2919108558 2919109927 196
121 iso_pu_bacteria 2919150387 2919151199 196
122 iso_pu_bacteria 2923634449 2923638260 196
123 iso_pu_bacteria 2927143783 2927146073 196
124 iso_pu_bacteria 2927833300 2927835303 196
125 iso_pu_bacteria 2932406140 2932407462 196
126 iso_pu_bacteria 2937539931 2937542820 196
127 iso_pu_bacteria 2937967321 2937972082 196
128 iso_pu_bacteria 2939568625 2939570788 196
129 iso_pu_bacteria 2939573065 2939574955 196
130 iso_pu_bacteria 2939577877 2939579372 196
131 iso_pu_bacteria 2939607340 2939610850 196
132 iso_pu_bacteria 2939642701 2939644894 196
133 iso_pu_bacteria 2969079654 2969083797 196
134 iso_pu_bacteria 2971820967 2971825269 196
135 iso_pu_bacteria 2974310843 2974313357 196
136 iso_pu_bacteria 2984559226 2984560899 196
137 iso_pu_bacteria 2984595703 2984598974 196
138 iso_pu_bacteria 2998344455 2998345881 196
139 iso_pu_bacteria 640753048 640936577 196
140 iso_pu_bacteria 8004592986 8004594251 196
141 iso_pu_bacteria 8015394850 8015398845 196
142 iso_pu_bacteria 8018221730 8018222383 196
143 iso_pu_bacteria 8018405270 8018406579 196
144 iso_pu_bacteria 8054844752 8054846366 196
145 iso_pu_bacteria 8054849141 8054849344 196
146 iso_pu_bacteria 8055087960 8055089951 196
147 iso_pu_bacteria 8055092621 8055096417 196
148 iso_pu_bacteria 8055097453 8055101409 196
149 iso_pu_bacteria 8057304971 8057306333 196
150 3300031251 Ga0265327_10039452 Ga0265327_100394523 197
151 3300031649 Ga0307514_10065978 Ga0307514_100659782 197
152 3300032168 Ga0316593_10071464 Ga0316593_100714641 197
153 3300038726 Ga0400490_36510 Ga0400490_36510_325_936 197
154 3300039062 Ga0400483_254574 Ga0400483_254574_2924_3535 197
155 3300042876 Ga0451577_0026030 Ga0451577_0026030_1060_1659 197
156 3300044673 Ga0453683_0179333 Ga0453683_0179333_534_1235 197
157 3300044673 Ga0453683_0188086 Ga0453683_0188086_622_1221 197
158 3300044712 Ga0453684_0000953 Ga0453684_0000953_1076_1714 197
159 3300044712 Ga0453684_0082608 Ga0453684_0082608_1832_2428 197
160 3300044712 Ga0453684_0259570 Ga0453684_0259570_470_1066 197
161 3300044712 Ga0453684_0307672 Ga0453684_0307672_344_943 197
162 3300045051 Ga0451576_0001853 Ga0451576_0001853_32549_33187 197
163 3300045051 Ga0451576_0037768 Ga0451576_0037768_990_1589 197
164 3300045051 Ga0451576_0047488 Ga0451576_0047488_72_671 197
165 3300045051 Ga0451576_0168985 Ga0451576_0168985_747_1343 197
166 3300049523 Ga0501300_004804 Ga0501300_004804_1333_1929 197
167 3300049776 Ga0501280_000298 Ga0501280_000298_6757_7353 197
168 3300053121 Ga0500607_098537 Ga0500607_098537_407_1003 197
169 3300053177 Ga0500636_0000369 Ga0500636_0000369_19019_19615 197
170 3300053178 Ga0500637_0004567 Ga0500637_0004567_1153_1749 197
171 3300053729 Ga0500625_029348 Ga0500625_029348_396_992 197
172 3300005471 Ga0070698_100204857 Ga0070698_1002048572 198
173 3300005937 Ga0081455_10419118 Ga0081455_104191181 198
174 3300006195 Ga0075366_10038652 Ga0075366_100386523 198
175 3300006846 Ga0075430_100032821 Ga0075430_1000328214 198
176 3300025728 Ga0207655_1000404 Ga0207655_10004044 198
177 3300028653 Ga0265323_10021331 Ga0265323_100213313 198
178 3300028666 Ga0265336_10000185 Ga0265336_100001858 198
179 3300028800 Ga0265338_10519268 Ga0265338_105192681 198
180 3300029957 Ga0265324_10000011 Ga0265324_10000011159 198
181 3300031238 Ga0265332_10000039 Ga0265332_1000003947 198
182 3300031241 Ga0265325_10001032 Ga0265325_1000103212 198
183 3300031250 Ga0265331_10024100 Ga0265331_100241003 198
184 3300031250 Ga0265331_10153338 Ga0265331_101533382 198
185 3300031251 Ga0265327_10001224 Ga0265327_1000122415 198
186 3300031344 Ga0265316_10027461 Ga0265316_100274613 198
187 3300031344 Ga0265316_10077865 Ga0265316_100778654 198
188 3300031344 Ga0265316_10099394 Ga0265316_100993942 198
189 3300031344 Ga0265316_10100700 Ga0265316_101007001 198
190 3300031344 Ga0265316_10115723 Ga0265316_101157231 198
191 3300031616 Ga0307508_10211792 Ga0307508_102117922 198
192 3300032133 Ga0316583_10002950 Ga0316583_100029504 198
193 3300042876 Ga0451577_0000280 Ga0451577_0000280_88983_89582 198
194 3300042876 Ga0451577_0008429 Ga0451577_0008429_4037_4636 198
195 3300042876 Ga0451577_0008841 Ga0451577_0008841_8192_8791 198
196 3300042876 Ga0451577_0017350 Ga0451577_0017350_2940_3539 198
197 3300042876 Ga0451577_0076242 Ga0451577_0076242_1914_2513 198
198 3300044712 Ga0453684_0000063 Ga0453684_0000063_37982_38581 198
199 3300044712 Ga0453684_0000065 Ga0453684_0000065_174739_175338 198
200 3300044712 Ga0453684_0001142 Ga0453684_0001142_41965_42564 198
201 3300044712 Ga0453684_0001472 Ga0453684_0001472_37898_38497 198
202 3300044712 Ga0453684_0011803 Ga0453684_0011803_1015_1614 198
203 3300044712 Ga0453684_0021396 Ga0453684_0021396_3003_3602 198
204 3300044712 Ga0453684_0036731 Ga0453684_0036731_2048_2647 198
205 3300044712 Ga0453684_0074999 Ga0453684_0074999_1030_1629 198
206 3300044712 Ga0453684_0172521 Ga0453684_0172521_1614_2213 198
207 3300045051 Ga0451576_0000659 Ga0451576_0000659_20637_21236 198
208 3300045051 Ga0451576_0002503 Ga0451576_0002503_10397_10996 198
209 3300045051 Ga0451576_0002526 Ga0451576_0002526_10445_11044 198
210 3300045051 Ga0451576_0018576 Ga0451576_0018576_3869_4468 198
211 3300045051 Ga0451576_0046204 Ga0451576_0046204_3211_3810 198
212 3300049551 Ga0501335_028091 Ga0501335_028091_15_614 198
213 3300049569 Ga0501032_0085799 Ga0501032_0085799_1238_1837 198
214 3300049570 Ga0501033_0006249 Ga0501033_0006249_1436_2035 198
215 3300049571 Ga0501034_0001310 Ga0501034_0001310_7944_8543 198
216 3300049571 Ga0501034_0716157 Ga0501034_0716157_96_695 198
217 3300049572 Ga0501036_0074072 Ga0501036_0074072_256_855 198
218 3300049573 Ga0501037_0023888 Ga0501037_0023888_883_1482 198
219 3300049574 Ga0501038_0040839 Ga0501038_0040839_607_1206 198
220 3300049579 Ga0501043_0005342 Ga0501043_0005342_1846_2445 198
221 3300049581 Ga0501047_0371184 Ga0501047_0371184_55_654 198
222 3300049589 Ga0501073_0095173 Ga0501073_0095173_1257_1856 198
223 3300049741 Ga0501079_0061051 Ga0501079_0061051_1089_1688 198
224 3300049742 Ga0501080_0024799 Ga0501080_0024799_3369_3968 198
225 3300049822 Ga0501035_0025328 Ga0501035_0025328_331_930 198
226 3300049823 Ga0501044_0050951 Ga0501044_0050951_204_803 198
227 3300050509 nmdc:mga0qj67_653187_c1 nmdc:mga0qj67_653187_c1_217_816 198
228 3300053087 Ga0500643_000735 Ga0500643_000735_9285_9884 198
229 3300053139 Ga0500568_0006902 Ga0500568_0006902_493_1092 198
230 3300060353 Ga0501082_0152405 Ga0501082_0152405_246_845 198
231 3300013307 Ga0157372_10347858 Ga0157372_103478582 199
232 3300021361 Ga0213872_10000414 Ga0213872_1000041412 199
233 3300021361 Ga0213872_10000807 Ga0213872_1000080717 199
234 3300021361 Ga0213872_10002543 Ga0213872_100025433 199
235 3300021361 Ga0213872_10006294 Ga0213872_100062942 199
236 3300028800 Ga0265338_10093790 Ga0265338_100937902 199
237 3300029957 Ga0265324_10002330 Ga0265324_100023305 199
238 3300029957 Ga0265324_10008459 Ga0265324_100084592 199
239 3300031235 Ga0265330_10002891 Ga0265330_100028918 199
240 3300031239 Ga0265328_10000002 Ga0265328_10000002163 199
241 3300031239 Ga0265328_10054967 Ga0265328_100549671 199
242 3300031241 Ga0265325_10030654 Ga0265325_100306541 199
243 3300031250 Ga0265331_10000012 Ga0265331_1000001213 199
244 3300031250 Ga0265331_10000019 Ga0265331_10000019236 199
245 3300031250 Ga0265331_10007377 Ga0265331_100073774 199
246 3300031250 Ga0265331_10035018 Ga0265331_100350182 199
247 3300031250 Ga0265331_10053191 Ga0265331_100531911 199
248 3300031250 Ga0265331_10096111 Ga0265331_100961112 199
249 3300031251 Ga0265327_10000068 Ga0265327_1000006886 199
250 3300031251 Ga0265327_10000173 Ga0265327_10000173121 199
251 3300031251 Ga0265327_10000471 Ga0265327_1000047164 199
252 3300031251 Ga0265327_10012104 Ga0265327_100121043 199
253 3300031507 Ga0307509_10000018 Ga0307509_10000018125 199
254 3300031665 Ga0316575_10003181 Ga0316575_100031814 199
255 3300031711 Ga0265314_10000262 Ga0265314_100002624 199
256 3300032133 Ga0316583_10003069 Ga0316583_100030691 199
257 3300032133 Ga0316583_10097330 Ga0316583_100973301 199
258 3300032168 Ga0316593_10009940 Ga0316593_100099401 199
259 3300032168 Ga0316593_10014448 Ga0316593_100144484 199
260 3300032168 Ga0316593_10049646 Ga0316593_100496462 199
261 3300032168 Ga0316593_10201503 Ga0316593_102015031 199
262 3300033524 Ga0316592_1104706 Ga0316592_11047061 199
263 3300033529 Ga0316587_1006039 Ga0316587_10060392 199
264 3300033541 Ga0316596_1060269 Ga0316596_10602691 199
265 3300033541 Ga0316596_1069406 Ga0316596_10694061 199
266 3300033541 Ga0316596_1078928 Ga0316596_10789282 199
267 3300033541 Ga0316596_1118563 Ga0316596_11185631 199
268 3300033541 Ga0316596_1121170 Ga0316596_11211701 199
269 3300035398 Ga0316574_0000014 Ga0316574_0000014_7914_8516 199
270 3300036712 Ga0316584_0134659 Ga0316584_0134659_108_710 199
271 3300037068 Ga0373925_0885176 Ga0373925_0885176_51_653 199
272 3300039447 Ga0436361_0041735 Ga0436361_0041735_30915_31517 199
273 3300039447 Ga0436361_0071841 Ga0436361_0071841_833_1435 199
274 3300039447 Ga0436361_0105560 Ga0436361_0105560_12603_13223 199
275 3300039447 Ga0436361_0164497 Ga0436361_0164497_33_653 199
276 3300039447 Ga0436361_0432960 Ga0436361_0432960_9161_9775 199
277 3300039447 Ga0436361_0718861 Ga0436361_0718861_5436_6038 199
278 3300039447 Ga0436361_1190835 Ga0436361_1190835_177_791 199
279 3300042876 Ga0451577_0000085 Ga0451577_0000085_20469_21071 199
280 3300042876 Ga0451577_0000134 Ga0451577_0000134_91813_92415 199
281 3300042876 Ga0451577_0002253 Ga0451577_0002253_21145_21747 199
282 3300042876 Ga0451577_0093736 Ga0451577_0093736_45_647 199
283 3300042876 Ga0451577_0247423 Ga0451577_0247423_877_1479 199
284 3300044673 Ga0453683_0000047 Ga0453683_0000047_17091_17693 199
285 3300044673 Ga0453683_0628347 Ga0453683_0628347_83_685 199
286 3300044693 Ga0466961_0000231 Ga0466961_0000231_2009_2626 199
287 3300044712 Ga0453684_0000273 Ga0453684_0000273_200696_201298 199
288 3300044712 Ga0453684_0000302 Ga0453684_0000302_190071_190673 199
289 3300044712 Ga0453684_0000426 Ga0453684_0000426_79568_80170 199
290 3300044712 Ga0453684_0001751 Ga0453684_0001751_21294_21896 199
291 3300044712 Ga0453684_0026506 Ga0453684_0026506_5167_5769 199
292 3300044712 Ga0453684_0148279 Ga0453684_0148279_1550_2152 199
293 3300044712 Ga0453684_0295728 Ga0453684_0295728_727_1347 199
294 3300045049 Ga0466959_0080307 Ga0466959_0080307_1323_1940 199
295 3300045051 Ga0451576_0000006 Ga0451576_0000006_187350_187955 199
296 3300045051 Ga0451576_0000056 Ga0451576_0000056_47370_47990 199
297 3300045051 Ga0451576_0000116 Ga0451576_0000116_17091_17693 199
298 3300045051 Ga0451576_0020304 Ga0451576_0020304_953_1555 199
299 3300049705 Ga0501225_0102587 Ga0501225_0102587_200_802 199
300 3300053140 Ga0500573_0065946 Ga0500573_0065946_402_1004 199
301 3300053156 Ga0500622_0000001 Ga0500622_0000001_543015_543617 199
302 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003195 200
303 3300002771 JGI25163J39215_1000062 JGI25163J39215_100006219 200
304 3300002772 JGI25164J39214_1000009 JGI25164J39214_100000996 200
305 3300003214 JGI25165J46597_1017328 JGI25165J46597_10173281 200
306 3300003320 rootH2_10015620 rootH2_1001562028 200
307 3300003751 Ga0055538_1000005 Ga0055538_1000005195 200
308 3300003752 Ga0055539_1000007 Ga0055539_1000007195 200
309 3300003756 Ga0055533_1000009 Ga0055533_1000009195 200
310 3300003759 Ga0055525_1000010 Ga0055525_1000010195 200
311 3300003841 Ga0055541_1000005 Ga0055541_1000005370 200
312 3300003856 Ga0058692_1001175 Ga0058692_10011756 200
313 3300003856 Ga0058692_1031678 Ga0058692_10316781 200
314 3300005272 Ga0065703_1019868 Ga0065703_10198683 200
315 3300005289 Ga0065704_10000444 Ga0065704_1000044422 200
316 3300005289 Ga0065704_10000805 Ga0065704_100008056 200
317 3300005289 Ga0065704_10355730 Ga0065704_103557301 200
318 3300005339 Ga0070660_100454887 Ga0070660_1004548871 200
319 3300005344 Ga0070661_100690102 Ga0070661_1006901022 200
320 3300005366 Ga0070659_100605168 Ga0070659_1006051682 200
321 3300005548 Ga0070665_100002124 Ga0070665_10000212413 200
322 3300005577 Ga0068857_100035370 Ga0068857_1000353702 200
323 3300005834 Ga0068851_10073993 Ga0068851_100739932 200
324 3300006051 Ga0075364_10001196 Ga0075364_100011966 200
325 3300006051 Ga0075364_10357735 Ga0075364_103577352 200
326 3300006051 Ga0075364_10528249 Ga0075364_105282491 200
327 3300006178 Ga0075367_10492900 Ga0075367_104929001 200
328 3300006195 Ga0075366_10017456 Ga0075366_100174563 200
329 3300006946 Ga0079104_1000166 Ga0079104_100016643 200
330 3300006946 Ga0079104_1000174 Ga0079104_10001743 200
331 3300006946 Ga0079104_1000192 Ga0079104_100019283 200
332 3300006946 Ga0079104_1000578 Ga0079104_10005785 200
333 3300006946 Ga0079104_1000845 Ga0079104_100084515 200
334 3300006946 Ga0079104_1001233 Ga0079104_10012332 200
335 3300009011 Ga0105251_10000254 Ga0105251_1000025447 200
336 3300009011 Ga0105251_10000827 Ga0105251_1000082725 200
337 3300009011 Ga0105251_10001719 Ga0105251_100017195 200
338 3300009011 Ga0105251_10001743 Ga0105251_100017435 200
339 3300009011 Ga0105251_10001955 Ga0105251_100019556 200
340 3300009011 Ga0105251_10003499 Ga0105251_100034998 200
341 3300009011 Ga0105251_10069159 Ga0105251_100691591 200
342 3300009036 Ga0105244_10000031 Ga0105244_1000003137 200
343 3300009036 Ga0105244_10000041 Ga0105244_10000041113 200
344 3300009036 Ga0105244_10000105 Ga0105244_1000010547 200
345 3300009036 Ga0105244_10001211 Ga0105244_1000121113 200
346 3300009036 Ga0105244_10002072 Ga0105244_100020726 200
347 3300009036 Ga0105244_10031954 Ga0105244_100319543 200
348 3300009092 Ga0105250_10000003 Ga0105250_10000003508 200
349 3300009092 Ga0105250_10000052 Ga0105250_1000005280 200
350 3300009092 Ga0105250_10000150 Ga0105250_1000015053 200
351 3300009092 Ga0105250_10000320 Ga0105250_1000032020 200
352 3300009092 Ga0105250_10003644 Ga0105250_100036443 200
353 3300009092 Ga0105250_10010479 Ga0105250_100104792 200
354 3300009092 Ga0105250_10097781 Ga0105250_100977812 200
355 3300009093 Ga0105240_10342309 Ga0105240_103423092 200
356 3300009101 Ga0105247_10000191 Ga0105247_1000019119 200
357 3300009148 Ga0105243_10289713 Ga0105243_102897132 200
358 3300009174 Ga0105241_10000004 Ga0105241_10000004154 200
359 3300009545 Ga0105237_10618255 Ga0105237_106182552 200
360 3300010375 Ga0105239_10810406 Ga0105239_108104062 200
361 3300013100 Ga0157373_10030819 Ga0157373_100308193 200
362 3300013100 Ga0157373_10087601 Ga0157373_100876012 200
363 3300013100 Ga0157373_10116591 Ga0157373_101165912 200
364 3300013102 Ga0157371_10000007 Ga0157371_10000007170 200
365 3300013104 Ga0157370_10000122 Ga0157370_100001228 200
366 3300013306 Ga0163162_10175717 Ga0163162_101757172 200
367 3300013307 Ga0157372_10006185 Ga0157372_1000618511 200
368 3300013307 Ga0157372_10046090 Ga0157372_100460903 200
369 3300014497 Ga0182008_10004036 Ga0182008_100040362 200
370 3300015261 Ga0182006_1000020 Ga0182006_100002096 200
371 3300015261 Ga0182006_1132128 Ga0182006_11321281 200
372 3300015679 Ga0183366_1001 Ga0183366_1001147 200
373 3300015680 Ga0183370_1001 Ga0183370_1001147 200
374 3300015685 Ga0183369_1001 Ga0183369_1001147 200
375 3300015687 Ga0183368_1001 Ga0183368_1001147 200
376 3300017792 Ga0163161_10000004 Ga0163161_10000004237 200
377 3300017792 Ga0163161_10033976 Ga0163161_100339763 200
378 3300020081 Ga0206354_11367514 Ga0206354_113675141 200
379 3300025207 Ga0209760_100069 Ga0209760_10006920 200
380 3300025224 Ga0209784_100001 Ga0209784_100001738 200
381 3300025225 Ga0209566_100001 Ga0209566_100001738 200
382 3300025226 Ga0209674_100002 Ga0209674_100002738 200
383 3300025230 Ga0209563_100008 Ga0209563_100008741 200
384 3300025231 Ga0207427_100002 Ga0207427_100002539 200
385 3300025233 Ga0209437_100007 Ga0209437_100007193 200
386 3300025253 Ga0209677_100004 Ga0209677_100004741 200
387 3300025261 Ga0209233_1003111 Ga0209233_10031114 200
388 3300025711 Ga0207696_1000003 Ga0207696_1000003221 200
389 3300025711 Ga0207696_1000004 Ga0207696_1000004126 200
390 3300025711 Ga0207696_1000007 Ga0207696_1000007416 200
391 3300025711 Ga0207696_1000033 Ga0207696_1000033194 200
392 3300025711 Ga0207696_1000313 Ga0207696_100031323 200
393 3300025711 Ga0207696_1001321 Ga0207696_100132110 200
394 3300025711 Ga0207696_1017107 Ga0207696_10171072 200
395 3300025711 Ga0207696_1052151 Ga0207696_10521511 200
396 3300025728 Ga0207655_1000001 Ga0207655_1000001116 200
397 3300025728 Ga0207655_1000011 Ga0207655_100001168 200
398 3300025728 Ga0207655_1000029 Ga0207655_1000029133 200
399 3300025728 Ga0207655_1000087 Ga0207655_1000087110 200
400 3300025728 Ga0207655_1000121 Ga0207655_1000121112 200
401 3300025728 Ga0207655_1000226 Ga0207655_100022646 200
402 3300025728 Ga0207655_1000559 Ga0207655_100055932 200
403 3300025728 Ga0207655_1029382 Ga0207655_10293823 200
404 3300025735 Ga0207713_1000005 Ga0207713_1000005554 200
405 3300025735 Ga0207713_1000038 Ga0207713_1000038165 200
406 3300025735 Ga0207713_1000065 Ga0207713_1000065169 200
407 3300025735 Ga0207713_1000108 Ga0207713_100010824 200
408 3300025735 Ga0207713_1000155 Ga0207713_10001556 200
409 3300025735 Ga0207713_1001769 Ga0207713_10017696 200
410 3300025735 Ga0207713_1006287 Ga0207713_10062876 200
411 3300025735 Ga0207713_1046152 Ga0207713_10461522 200
412 3300025735 Ga0207713_1118598 Ga0207713_11185982 200
413 3300025735 Ga0207713_1139314 Ga0207713_11393141 200
414 3300025900 Ga0207710_10000016 Ga0207710_10000016176 200
415 3300025911 Ga0207654_10000006 Ga0207654_10000006170 200
416 3300025913 Ga0207695_10218033 Ga0207695_102180332 200
417 3300025919 Ga0207657_10332546 Ga0207657_103325461 200
418 3300025932 Ga0207690_10533057 Ga0207690_105330571 200
419 3300025935 Ga0207709_10007879 Ga0207709_100078795 200
420 3300026116 Ga0207674_10078122 Ga0207674_100781223 200
421 3300027111 Ga0209281_1000001 Ga0209281_10000011739 200
422 3300027111 Ga0209281_1000008 Ga0209281_1000008702 200
423 3300027111 Ga0209281_1000021 Ga0209281_1000021417 200
424 3300027111 Ga0209281_1000075 Ga0209281_1000075174 200
425 3300027111 Ga0209281_1000093 Ga0209281_1000093101 200
426 3300027111 Ga0209281_1000254 Ga0209281_100025481 200
427 3300027111 Ga0209281_1000480 Ga0209281_10004806 200
428 3300027111 Ga0209281_1000492 Ga0209281_100049237 200
429 3300027111 Ga0209281_1001723 Ga0209281_10017235 200
430 3300027111 Ga0209281_1002685 Ga0209281_10026851 200
431 3300027111 Ga0209281_1004290 Ga0209281_10042903 200
432 3300027312 Ga0209371_1000001 Ga0209371_1000001103 200
433 3300027312 Ga0209371_1000104 Ga0209371_100010445 200
434 3300027312 Ga0209371_1000946 Ga0209371_100094610 200
435 3300027312 Ga0209371_1001819 Ga0209371_100181914 200
436 3300027312 Ga0209371_1008692 Ga0209371_10086922 200
437 3300028379 Ga0268266_10000165 Ga0268266_10000165110 200
438 3300030500 Ga0268256_1000001 Ga0268256_10000012538 200
439 3300030500 Ga0268256_1000017 Ga0268256_1000017219 200
440 3300030500 Ga0268256_1001277 Ga0268256_100127710 200
441 3300030500 Ga0268256_1001587 Ga0268256_100158714 200
442 3300031733 Ga0316577_10006905 Ga0316577_100069056 200
443 3300032168 Ga0316593_10216189 Ga0316593_102161891 200
444 3300033524 Ga0316592_1046926 Ga0316592_10469262 200
445 3300033524 Ga0316592_1096122 Ga0316592_10961221 200
446 3300033529 Ga0316587_1053472 Ga0316587_10534721 200
447 3300033529 Ga0316587_1056118 Ga0316587_10561181 200
448 3300033529 Ga0316587_1058650 Ga0316587_10586501 200
449 3300033529 Ga0316587_1060212 Ga0316587_10602121 200
450 3300033541 Ga0316596_1117778 Ga0316596_11177781 200
451 3300033541 Ga0316596_1126447 Ga0316596_11264471 200
452 3300033541 Ga0316596_1126516 Ga0316596_11265161 200
453 3300033541 Ga0316596_1144099 Ga0316596_11440991 200
454 3300033541 Ga0316596_1145931 Ga0316596_11459311 200
455 3300036647 Ga0316582_0010254 Ga0316582_0010254_3093_3698 200
456 3300036647 Ga0316582_0782235 Ga0316582_0782235_33_638 200
457 3300036712 Ga0316584_0023544 Ga0316584_0023544_924_1550 200
458 3300038725 Ga0400484_20914 Ga0400484_20914_3685_4290 200
459 3300038725 Ga0400484_39735 Ga0400484_39735_968_1573 200
460 3300038726 Ga0400490_05485 Ga0400490_05485_3016_3621 200
461 3300038726 Ga0400490_37780 Ga0400490_37780_2949_3554 200
462 3300038726 Ga0400490_47679 Ga0400490_47679_24289_24894 200
463 3300038727 Ga0400491_19719 Ga0400491_19719_9813_10418 200
464 3300038735 Ga0400485_02110 Ga0400485_02110_8363_8968 200
465 3300038735 Ga0400485_08080 Ga0400485_08080_8984_9589 200
466 3300038741 Ga0400488_07068 Ga0400488_07068_148_753 200
467 3300038741 Ga0400488_14649 Ga0400488_14649_843_1448 200
468 3300038741 Ga0400488_19178 Ga0400488_19178_3035_3640 200
469 3300038741 Ga0400488_38786 Ga0400488_38786_144_749 200
470 3300038742 Ga0400486_13079 Ga0400486_13079_29223_29828 200
471 3300038742 Ga0400486_26530 Ga0400486_26530_2557_3177 200
472 3300038742 Ga0400486_30938 Ga0400486_30938_8992_9597 200
473 3300039062 Ga0400483_011695 Ga0400483_011695_9543_10148 200
474 3300039062 Ga0400483_059991 Ga0400483_059991_118_723 200
475 3300039062 Ga0400483_067420 Ga0400483_067420_8986_9591 200
476 3300039062 Ga0400483_076262 Ga0400483_076262_1694_2299 200
477 3300039062 Ga0400483_089669 Ga0400483_089669_2306_2911 200
478 3300039062 Ga0400483_136165 Ga0400483_136165_7582_8187 200
479 3300039062 Ga0400483_194015 Ga0400483_194015_516_1121 200
480 3300039062 Ga0400483_199105 Ga0400483_199105_9434_10039 200
481 3300039110 Ga0400487_06586 Ga0400487_06586_309_914 200
482 3300039110 Ga0400487_13389 Ga0400487_13389_361_966 200
483 3300039110 Ga0400487_22173 Ga0400487_22173_1155_1760 200
484 3300039110 Ga0400487_33200 Ga0400487_33200_18_623 200
485 3300039110 Ga0400487_47932 Ga0400487_47932_8984_9589 200
486 3300039110 Ga0400487_55141 Ga0400487_55141_7303_7908 200
487 3300039110 Ga0400487_64640 Ga0400487_64640_3309_3914 200
488 3300041405 Ga0439438_000763 Ga0439438_000763_4625_5227 200
489 3300041407 Ga0439447_002208 Ga0439447_002208_4177_4779 200
490 3300041494 Ga0451837_0353250 Ga0451837_0353250_26_631 200
491 3300042006 Ga0439432_030031 Ga0439432_030031_1055_1657 200
492 3300042006 Ga0439432_077141 Ga0439432_077141_393_995 200
493 3300042010 Ga0439452_000003 Ga0439452_000003_852166_852768 200
494 3300042010 Ga0439452_000040 Ga0439452_000040_3039_3641 200
495 3300042010 Ga0439452_000361 Ga0439452_000361_16191_16793 200
496 3300042013 Ga0439456_028189 Ga0439456_028189_376_978 200
497 3300042136 Ga0450900_005690 Ga0450900_005690_845_1447 200
498 3300042439 Ga0439464_0053824 Ga0439464_0053824_63_665 200
499 3300044669 Ga0466981_0000161 Ga0466981_0000161_15978_16580 200
500 3300046453 Ga0495627_000136 Ga0495627_000136_60681_61283 200
501 3300046458 Ga0495591_008507 Ga0495591_008507_2747_3349 200
502 3300046460 Ga0495638_0064293 Ga0495638_0064293_1146_1748 200
503 3300046471 Ga0495650_0000016 Ga0495650_0000016_488465_489067 200
504 3300046471 Ga0495650_0000033 Ga0495650_0000033_331796_332398 200
505 3300046471 Ga0495650_0000205 Ga0495650_0000205_100396_100998 200
506 3300046491 Ga0495584_0011843 Ga0495584_0011843_3520_4122 200
507 3300046501 Ga0495607_0012669 Ga0495607_0012669_2567_3169 200
508 3300046507 Ga0495606_0000296 Ga0495606_0000296_2820_3422 200
509 3300046518 Ga0495631_0097091 Ga0495631_0097091_293_895 200
510 3300046519 Ga0495632_0088603 Ga0495632_0088603_719_1321 200
511 3300046520 Ga0495637_0114393 Ga0495637_0114393_131_733 200
512 3300046523 Ga0495644_0017406 Ga0495644_0017406_1673_2275 200
513 3300046524 Ga0495648_0004602 Ga0495648_0004602_5530_6132 200
514 3300046530 Ga0495654_0000020 Ga0495654_0000020_74499_75101 200
515 3300046530 Ga0495654_0000386 Ga0495654_0000386_30212_30814 200
516 3300046530 Ga0495654_0003433 Ga0495654_0003433_2125_2727 200
517 3300046542 Ga0495597_0000053 Ga0495597_0000053_26765_27367 200
518 3300046660 Ga0495625_0008589 Ga0495625_0008589_2359_2961 200
519 3300046674 Ga0495588_0007814 Ga0495588_0007814_3003_3605 200
520 3300046692 Ga0495671_0003554 Ga0495671_0003554_8276_8878 200
521 3300046694 Ga0495649_0003696 Ga0495649_0003696_6889_7491 200
522 3300046694 Ga0495649_0006030 Ga0495649_0006030_4838_5440 200
523 3300046794 Ga0495589_0000006 Ga0495589_0000006_182234_182836 200
524 3300046810 Ga0495660_0000007 Ga0495660_0000007_419065_419667 200
525 3300046810 Ga0495660_0000011 Ga0495660_0000011_43733_44335 200
526 3300047320 Ga0495672_0000004 Ga0495672_0000004_492412_493014 200
527 3300047320 Ga0495672_0000027 Ga0495672_0000027_241924_242526 200
528 3300047446 Ga0495679_000080 Ga0495679_000080_81778_82380 200
529 3300047446 Ga0495679_002092 Ga0495679_002092_8724_9326 200
530 3300047469 Ga0495673_0000023 Ga0495673_0000023_445510_446112 200
531 3300047469 Ga0495673_0000930 Ga0495673_0000930_177_779 200
532 3300047470 Ga0495681_0081428 Ga0495681_0081428_352_954 200
533 3300048903 Ga0496100_0264425 Ga0496100_0264425_129_731 200
534 3300048906 Ga0496103_0107711 Ga0496103_0107711_395_997 200
535 3300048907 Ga0496104_0000810 Ga0496104_0000810_10494_11096 200
536 3300048907 Ga0496104_0005159 Ga0496104_0005159_6681_7283 200
537 3300048919 Ga0496116_0000031 Ga0496116_0000031_172000_172602 200
538 3300048919 Ga0496116_0000054 Ga0496116_0000054_28546_29148 200
539 3300048919 Ga0496116_0000170 Ga0496116_0000170_120864_121466 200
540 3300048919 Ga0496116_0005721 Ga0496116_0005721_6978_7580 200
541 3300048919 Ga0496116_0026931 Ga0496116_0026931_3487_4089 200
542 3300048920 Ga0496117_0001230 Ga0496117_0001230_11365_11967 200
543 3300048920 Ga0496117_0007239 Ga0496117_0007239_9349_9951 200
544 3300048920 Ga0496117_0032079 Ga0496117_0032079_771_1373 200
545 3300048921 Ga0496118_0006433 Ga0496118_0006433_3415_4017 200
546 3300048921 Ga0496118_0017095 Ga0496118_0017095_3121_3723 200
547 3300048921 Ga0496118_0021230 Ga0496118_0021230_3950_4552 200
548 3300048921 Ga0496118_0238329 Ga0496118_0238329_360_962 200
549 3300048922 Ga0496119_0000078 Ga0496119_0000078_31964_32566 200
550 3300048922 Ga0496119_0001296 Ga0496119_0001296_21656_22258 200
551 3300048922 Ga0496119_0008099 Ga0496119_0008099_4356_4958 200
552 3300048922 Ga0496119_0008475 Ga0496119_0008475_799_1401 200
553 3300048922 Ga0496119_0010104 Ga0496119_0010104_2769_3371 200
554 3300048922 Ga0496119_0017994 Ga0496119_0017994_4394_4996 200
555 3300048923 Ga0496120_0000009 Ga0496120_0000009_107603_108205 200
556 3300048923 Ga0496120_0000265 Ga0496120_0000265_32661_33263 200
557 3300048923 Ga0496120_0004921 Ga0496120_0004921_730_1332 200
558 3300048923 Ga0496120_0004997 Ga0496120_0004997_9885_10487 200
559 3300048923 Ga0496120_0016275 Ga0496120_0016275_304_906 200
560 3300048924 Ga0496121_0011365 Ga0496121_0011365_194_796 200
561 3300048924 Ga0496121_0011922 Ga0496121_0011922_8115_8717 200
562 3300048924 Ga0496121_0025092 Ga0496121_0025092_1655_2257 200
563 3300048924 Ga0496121_0522535 Ga0496121_0522535_119_721 200
564 3300048925 Ga0496122_0000013 Ga0496122_0000013_466865_467467 200
565 3300048925 Ga0496122_0000145 Ga0496122_0000145_37128_37730 200
566 3300048925 Ga0496122_0001097 Ga0496122_0001097_38943_39545 200
567 3300048925 Ga0496122_0126830 Ga0496122_0126830_65_667 200
568 3300048926 Ga0496123_0000010 Ga0496123_0000010_33573_34175 200
569 3300048926 Ga0496123_0000281 Ga0496123_0000281_40060_40662 200
570 3300048926 Ga0496123_0003720 Ga0496123_0003720_5143_5745 200
571 3300048926 Ga0496123_0046502 Ga0496123_0046502_1484_2086 200
572 3300048926 Ga0496123_0185967 Ga0496123_0185967_359_961 200
573 3300048927 Ga0496124_0000010 Ga0496124_0000010_250341_250943 200
574 3300048927 Ga0496124_0000122 Ga0496124_0000122_33916_34518 200
575 3300048927 Ga0496124_0000217 Ga0496124_0000217_109215_109817 200
576 3300048927 Ga0496124_0018174 Ga0496124_0018174_4521_5123 200
577 3300048927 Ga0496124_0037018 Ga0496124_0037018_2596_3198 200
578 3300048927 Ga0496124_0221738 Ga0496124_0221738_498_1100 200
579 3300048928 Ga0496125_0000019 Ga0496125_0000019_408684_409286 200
580 3300048928 Ga0496125_0000413 Ga0496125_0000413_26593_27195 200
581 3300048928 Ga0496125_0014092 Ga0496125_0014092_541_1143 200
582 3300048929 Ga0496126_0000975 Ga0496126_0000975_20046_20648 200
583 3300048929 Ga0496126_0003612 Ga0496126_0003612_9470_10072 200
584 3300048929 Ga0496126_0165180 Ga0496126_0165180_1015_1617 200
585 3300048929 Ga0496126_0296497 Ga0496126_0296497_398_1000 200
586 3300049459 Ga0495678_004114 Ga0495678_004114_2766_3368 200
587 3300049460 Ga0495682_0000004 Ga0495682_0000004_80814_81416 200
588 3300050491 nmdc:mga00v17_253652_c1 nmdc:mga00v17_253652_c1_483_1085 200
589 3300050491 nmdc:mga00v17_44237_c1 nmdc:mga00v17_44237_c1_923_1525 200
590 3300053126 Ga0500621_000001 Ga0500621_000001_138809_139411 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

40

173

0.98

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

193

228

0.96

PF08534

Redoxin

Redoxin

39

188

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6khx-assembly1.cif.gz_H crystal structure of prx from akkermansia muciniphila 0.966 1 195
2z9s-assembly1.cif.gz_G crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant 0.9645 4 195
3tkr-assembly1.cif.gz_A crystal structure of full-length human peroxiredoxin 4 with t118e mutation 0.9632 4 195
4llr-assembly1.cif.gz_E tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in the reduced state 0.9616 4 194
3tkq-assembly1.cif.gz_B-2 crystal structure of full-length human peroxiredoxin 4 with mixed conformation 0.9611 4 186
ID Description Score Start End Superfamily
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9535 1 194 3.40.30.10
af_Q8I5Q6_15_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9507 1 200 3.40.30.10
5dvbA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9486 4 195 3.40.30.10
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9467 3 172 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9432 4 163 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N6X8E0-F1-model_v4 deleted 0.9921 1 168
AF-A0A7H4NPY3-F1-model_v4 deleted 0.992 1 181
AF-H8NW63-F1-model_v4 deleted 0.9917 1 200
AF-A0A3S4DK11-F1-model_v4 deleted 0.9911 74 200
AF-A0A3N2E2E5-F1-model_v4 deleted 0.991 1 200

Feature Viewer

pLDDT pTM Quality
93.72 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map