F466946

General Info

Members Datasets Scaffolds Average Seq Length
590 249 1180 141

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100862608|Ga0070706_1008626082
Length 146
Sequence MAAMAILTASDEAAVRKEFERLGPHPVKLTVFSQELIAGDLCRENEQLVREVAGLSDRISVEVLNPAIDRERAAGYGVDLVPAIAVEGARDYGIRFFGIPSGYEFTNLIDSIIIASTGEPALAEETKTALAGLETSVHIQVFSTPT

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
164 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
180 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 13.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100862608 3300005467 Unclassified 837
2 Ga0065712_10480670 3300005290 Unclassified 663
3 Ga0065715_10195835 3300005293 Bacteria 1388
4 Ga0065715_11049010 3300005293 Unclassified 532
5 Ga0065707_10295068 3300005295 Bacteria 1016
6 Ga0065707_10298217 3300005295 Bacteria 1010
7 Ga0065707_10583805 3300005295 Bacteria 700
8 Ga0070676_10001222 3300005328 Bacteria 12904
9 Ga0070676_10019287 3300005328 Bacteria 3793
10 Ga0070670_100106789 3300005331 Bacteria 2413
11 Ga0068869_100000743 3300005334 Bacteria 18528
12 Ga0068869_100001033 3300005334 Bacteria 16193
13 Ga0068869_100498002 3300005334 Bacteria 1017
14 Ga0070666_10195868 3300005335 Unclassified 1421
15 Ga0070680_100000352 3300005336 Bacteria 30948
16 Ga0070680_100057186 3300005336 Bacteria 3188
17 Ga0070680_100181092 3300005336 Bacteria 1775
18 Ga0070680_101521195 3300005336 Bacteria 580
19 Ga0070682_100000619 3300005337 Bacteria 21611
20 Ga0070660_100000444 3300005339 Bacteria 27523
21 Ga0070689_100025981 3300005340 Bacteria 4404
22 Ga0070689_100266466 3300005340 Bacteria 1417
23 Ga0070689_101240421 3300005340 Bacteria 670
24 Ga0070691_10011432 3300005341 Bacteria 4054
25 Ga0070691_10061474 3300005341 Bacteria 1807
26 Ga0070691_10137707 3300005341 Bacteria 1242
27 Ga0070691_10151614 3300005341 Bacteria 1189
28 Ga0070687_100068295 3300005343 Bacteria 1900
29 Ga0070661_100000260 3300005344 Bacteria 43164
30 Ga0070692_10000079 3300005345 Bacteria 20085
31 Ga0070692_10017473 3300005345 Bacteria 3430
32 Ga0070692_10381088 3300005345 Bacteria 885
33 Ga0070692_10513414 3300005345 Unclassified 779
34 Ga0070669_100011657 3300005353 Bacteria 6237
35 Ga0070669_100011774 3300005353 Bacteria 6206
36 Ga0070671_100221183 3300005355 Bacteria 1606
37 Ga0070671_100607921 3300005355 Unclassified 945
38 Ga0070673_100083743 3300005364 Bacteria 2592
39 Ga0070659_100004975 3300005366 Bacteria 9512
40 Ga0070659_100761627 3300005366 Bacteria 840
41 Ga0070703_10001904 3300005406 Bacteria 6137
42 Ga0070701_10005077 3300005438 Bacteria 5404
43 Ga0070705_100000373 3300005440 Bacteria 26173
44 Ga0070705_100057695 3300005440 Bacteria 2291
45 Ga0070705_100434835 3300005440 Bacteria 980
46 Ga0070700_100148664 3300005441 Bacteria 1600
47 Ga0070700_100427776 3300005441 Bacteria 1002
48 Ga0070700_100620648 3300005441 Unclassified 850
49 Ga0070694_100000235 3300005444 Bacteria 29099
50 Ga0070694_100004664 3300005444 Bacteria 8246
51 Ga0070694_100024085 3300005444 Bacteria 3926
52 Ga0070694_100046928 3300005444 Unclassified 2902
53 Ga0070694_100245177 3300005444 Bacteria 1353
54 Ga0070694_100533565 3300005444 Bacteria 938
55 Ga0070708_100005842 3300005445 Bacteria 9772
56 Ga0070708_100032332 3300005445 Bacteria 4537
57 Ga0070708_100032714 3300005445 Bacteria 4513
58 Ga0070708_100053878 3300005445 Bacteria 3571
59 Ga0070708_100055455 3300005445 Bacteria 3525
60 Ga0070708_100074930 3300005445 Unclassified 3054
61 Ga0070708_100221930 3300005445 Bacteria 1773
62 Ga0070708_100252056 3300005445 Unclassified 1658
63 Ga0070708_100389142 3300005445 Bacteria 1315
64 Ga0070663_100007049 3300005455 Bacteria 6813
65 Ga0070662_100003431 3300005457 Bacteria 9881
66 Ga0070662_100311454 3300005457 Bacteria 1281
67 Ga0070662_100845614 3300005457 Bacteria 779
68 Ga0070681_10016585 3300005458 Bacteria 7355
69 Ga0070681_10214305 3300005458 Bacteria 1842
70 Ga0068867_100022294 3300005459 Bacteria 4527
71 Ga0068867_100248832 3300005459 Bacteria 1444
72 Ga0068867_101646471 3300005459 Bacteria 601
73 Ga0070706_100010951 3300005467 Bacteria 8420
74 Ga0070706_100015410 3300005467 Bacteria 7061
75 Ga0070706_100038010 3300005467 Bacteria 4444
76 Ga0070706_100043964 3300005467 Bacteria 4127
77 Ga0070706_100048396 3300005467 Bacteria 3923
78 Ga0070706_100052346 3300005467 Bacteria 3768
79 Ga0070706_100209503 3300005467 Bacteria 1820
80 Ga0070706_100676315 3300005467 Bacteria 958
81 Ga0070706_100688307 3300005467 Bacteria 948
82 Ga0070706_101748706 3300005467 Bacteria 566
83 Ga0070707_100002181 3300005468 Bacteria 18718
84 Ga0070707_100004865 3300005468 Bacteria 12590
85 Ga0070707_100005646 3300005468 Bacteria 11682
86 Ga0070707_100062680 3300005468 Bacteria 3567
87 Ga0070707_100078896 3300005468 Bacteria 3177
88 Ga0070707_100083275 3300005468 Unclassified 3091
89 Ga0070707_100089730 3300005468 Bacteria 2975
90 Ga0070707_100300577 3300005468 Bacteria 1560
91 Ga0070707_100356216 3300005468 Bacteria 1421
92 Ga0070707_100410596 3300005468 Bacteria 1314
93 Ga0070698_100001277 3300005471 Bacteria 28097
94 Ga0070698_100004602 3300005471 Bacteria 15152
95 Ga0070698_100050713 3300005471 Bacteria 4229
96 Ga0070698_100110024 3300005471 Unclassified 2721
97 Ga0070698_100260726 3300005471 Bacteria 1665
98 Ga0070698_100363894 3300005471 Bacteria 1378
99 Ga0070698_100370887 3300005471 Bacteria 1363
100 Ga0070698_100460648 3300005471 Bacteria 1207
101 Ga0070699_100000451 3300005518 Bacteria 39379
102 Ga0070699_100023120 3300005518 Bacteria 5356
103 Ga0070699_100033736 3300005518 Bacteria 4423
104 Ga0070699_100048515 3300005518 Bacteria 3675
105 Ga0070699_100089509 3300005518 Bacteria 2689
106 Ga0070699_100123993 3300005518 Bacteria 2273
107 Ga0070699_100257958 3300005518 Bacteria 1559
108 Ga0070699_100316573 3300005518 Bacteria 1402
109 Ga0070699_100316601 3300005518 Unclassified 1402
110 Ga0070699_100636757 3300005518 Unclassified 973
111 Ga0070699_101053964 3300005518 Unclassified 746
112 Ga0070699_101233429 3300005518 Bacteria 686
113 Ga0070679_100000791 3300005530 Bacteria 27446
114 Ga0070679_100707997 3300005530 Bacteria 950
115 Ga0070684_100217051 3300005535 Bacteria 1744
116 Ga0070697_100003429 3300005536 Bacteria 12191
117 Ga0070697_100007182 3300005536 Bacteria 8658
118 Ga0070697_100116014 3300005536 Bacteria 2236
119 Ga0070697_100151139 3300005536 Bacteria 1957
120 Ga0070697_100157686 3300005536 Bacteria 1916
121 Ga0070697_100193153 3300005536 Bacteria 1728
122 Ga0070697_100212469 3300005536 Bacteria 1647
123 Ga0070697_100214984 3300005536 Bacteria 1637
124 Ga0070697_100264685 3300005536 Bacteria 1473
125 Ga0070697_100448685 3300005536 Bacteria 1123
126 Ga0070697_100487777 3300005536 Bacteria 1076
127 Ga0068853_100003465 3300005539 Bacteria 12068
128 Ga0070672_100007644 3300005543 Bacteria 7354
129 Ga0070672_100093342 3300005543 Bacteria 2431
130 Ga0070686_100982354 3300005544 Bacteria 691
131 Ga0070695_100002825 3300005545 Bacteria 10087
132 Ga0070695_100004303 3300005545 Bacteria 8339
133 Ga0070695_100043426 3300005545 Bacteria 2858
134 Ga0070695_100098338 3300005545 Bacteria 1966
135 Ga0070695_100436341 3300005545 Bacteria 1000
136 Ga0070696_100001608 3300005546 Bacteria 14822
137 Ga0070696_100050682 3300005546 Bacteria 2885
138 Ga0070696_100099390 3300005546 Unclassified 2082
139 Ga0070696_100505545 3300005546 Bacteria 962
140 Ga0070696_100532857 3300005546 Bacteria 938
141 Ga0070696_100807036 3300005546 Bacteria 773
142 Ga0070693_100000077 3300005547 Bacteria 40469
143 Ga0070693_100112656 3300005547 Unclassified 1676
144 Ga0070704_100001443 3300005549 Bacteria 12713
145 Ga0070704_100031096 3300005549 Bacteria 3586
146 Ga0070704_100067282 3300005549 Bacteria 2586
147 Ga0070704_100266999 3300005549 Bacteria 1412
148 Ga0070704_100269394 3300005549 Bacteria 1406
149 Ga0070704_101227936 3300005549 Unclassified 684
150 Ga0068855_100001296 3300005563 Bacteria 30991
151 Ga0070664_100004438 3300005564 Bacteria 11267
152 Ga0068857_100002233 3300005577 Bacteria 15763
153 Ga0068857_100033781 3300005577 Bacteria 4523
154 Ga0068856_100019836 3300005614 Bacteria 6527
155 Ga0070702_100002924 3300005615 Bacteria 7522
156 Ga0070702_100228194 3300005615 Bacteria 1249
157 Ga0068859_100001883 3300005617 Bacteria 21376
158 Ga0068859_100257728 3300005617 Bacteria 1835
159 Ga0068864_100013015 3300005618 Bacteria 6887
160 Ga0068866_10275634 3300005718 Bacteria 1040
161 Ga0068861_100006082 3300005719 Bacteria 8211
162 Ga0068861_100348254 3300005719 Bacteria 1299
163 Ga0068870_10000478 3300005840 Bacteria 15170
164 Ga0068870_10488953 3300005840 Bacteria 818
165 Ga0068863_100012828 3300005841 Bacteria 8083
166 Ga0068863_100461935 3300005841 Bacteria 1247
167 Ga0068860_100010294 3300005843 Bacteria 9251
168 Ga0068860_100015776 3300005843 Bacteria 7376
169 Ga0068860_100080475 3300005843 Bacteria 3098
170 Ga0068860_100164790 3300005843 Bacteria 2139
171 Ga0068860_100395843 3300005843 Unclassified 1366
172 Ga0068860_101463560 3300005843 Archaea 704
173 Ga0068862_100007125 3300005844 Bacteria 9286
174 Ga0068862_100020345 3300005844 Bacteria 5544
175 Ga0068862_100111404 3300005844 Unclassified 2402
176 Ga0081455_10001046 3300005937 Bacteria 34887
177 Ga0081455_10282905 3300005937 Unclassified 1197
178 Ga0081455_10591367 3300005937 Bacteria 725
179 Ga0081540_1016482 3300005983 Bacteria 4621
180 Ga0081539_10000009 3300005985 Bacteria 509286
181 Ga0070715_10655085 3300006163 Bacteria 622
182 Ga0070712_100001466 3300006175 Bacteria 14382
183 Ga0075427_10083033 3300006194 Bacteria 581
184 Ga0075428_100000487 3300006844 Bacteria 40054
185 Ga0075428_101208035 3300006844 Bacteria 797
186 Ga0075430_100143041 3300006846 Unclassified 1992
187 Ga0075430_100270427 3300006846 Bacteria 1406
188 Ga0075430_100437820 3300006846 Bacteria 1079
189 Ga0075431_100022257 3300006847 Bacteria 6480
190 Ga0075431_100027493 3300006847 Bacteria 5837
191 Ga0075431_100081364 3300006847 Bacteria 3344
192 Ga0075431_100241923 3300006847 Bacteria 1836
193 Ga0075431_100265078 3300006847 Bacteria 1743
194 Ga0075431_100687065 3300006847 Bacteria 1002
195 Ga0075431_100841591 3300006847 Unclassified 889
196 Ga0075431_101805210 3300006847 Bacteria 568
197 Ga0075433_10000395 3300006852 Bacteria 27737
198 Ga0075433_10023012 3300006852 Bacteria 5240
199 Ga0075433_10298718 3300006852 Bacteria 1426
200 Ga0075433_10558949 3300006852 Bacteria 1005
201 Ga0075434_100004096 3300006871 Bacteria 13073
202 Ga0075434_100010356 3300006871 Bacteria 8739
203 Ga0075434_100038867 3300006871 Bacteria 4715
204 Ga0075434_100090483 3300006871 Bacteria 3061
205 Ga0075434_100104075 3300006871 Bacteria 2848
206 Ga0075434_100308887 3300006871 Bacteria 1602
207 Ga0075434_100605400 3300006871 Unclassified 1115
208 Ga0075434_100688678 3300006871 Bacteria 1040
209 Ga0075434_101134153 3300006871 Bacteria 795
210 Ga0075429_100050534 3300006880 Bacteria 3617
211 Ga0075429_100172254 3300006880 Bacteria 1896
212 Ga0068865_100512420 3300006881 Unclassified 1002
213 Ga0068865_100950586 3300006881 Unclassified 750
214 Ga0075436_100018707 3300006914 Bacteria 4743
215 Ga0075436_100055119 3300006914 Bacteria 2745
216 Ga0097620_100001883 3300006931 Bacteria 21376
217 Ga0097620_100257698 3300006931 Bacteria 1835
218 Ga0075435_100002818 3300007076 Bacteria 11628
219 Ga0075435_100061340 3300007076 Bacteria 3050
220 Ga0075435_100062558 3300007076 Bacteria 3020
221 Ga0075435_100390657 3300007076 Bacteria 1196
222 Ga0099794_10015671 3300007265 Bacteria 3351
223 Ga0099794_10048527 3300007265 Bacteria 2038
224 Ga0099794_10249644 3300007265 Bacteria 915
225 Ga0105240_11145527 3300009093 Bacteria 826
226 Ga0111539_10872795 3300009094 Unclassified 1046
227 Ga0111539_11052998 3300009094 Bacteria 946
228 Ga0105245_10137209 3300009098 Unclassified 2300
229 Ga0105245_10538915 3300009098 Bacteria 1188
230 Ga0105245_13133025 3300009098 Unclassified 512
231 Ga0114129_10009610 3300009147 Bacteria 13795
232 Ga0114129_10027657 3300009147 Bacteria 8030
233 Ga0114129_10035906 3300009147 Bacteria 6999
234 Ga0114129_10172259 3300009147 Bacteria 2950
235 Ga0114129_10204102 3300009147 Bacteria 2675
236 Ga0114129_10334351 3300009147 Unclassified 2010
237 Ga0114129_10508284 3300009147 Bacteria 1573
238 Ga0114129_10551257 3300009147 Unclassified 1499
239 Ga0114129_10917654 3300009147 Bacteria 1109
240 Ga0114129_12446327 3300009147 Unclassified 625
241 Ga0105243_10020580 3300009148 Bacteria 5003
242 Ga0105243_10139326 3300009148 Bacteria 2067
243 Ga0105243_10399837 3300009148 Bacteria 1276
244 Ga0105241_10000054 3300009174 Bacteria 93205
245 Ga0105241_10023901 3300009174 Bacteria 4536
246 Ga0105242_10020287 3300009176 Bacteria 5211
247 Ga0105242_10105601 3300009176 Bacteria 2392
248 Ga0105242_10123490 3300009176 Bacteria 2226
249 Ga0105242_10316475 3300009176 Bacteria 1430
250 Ga0105248_10433277 3300009177 Bacteria 1481
251 Ga0105237_10067884 3300009545 Bacteria 3559
252 Ga0105249_10062429 3300009553 Bacteria 3422
253 Ga0105249_10237211 3300009553 Bacteria 1801
254 Ga0105249_10449990 3300009553 Bacteria 1326
255 Ga0105249_12486646 3300009553 Bacteria 590
256 Ga0105249_12774236 3300009553 Unclassified 562
257 Ga0105246_10028286 3300011119 Bacteria 3681
258 Ga0105246_10155108 3300011119 Bacteria 1738
259 Ga0157373_10000475 3300013100 Bacteria 31828
260 Ga0157371_10198859 3300013102 Bacteria 1436
261 Ga0157371_10278481 3300013102 Bacteria 1208
262 Ga0157370_10223937 3300013104 Bacteria 1742
263 Ga0157369_10038687 3300013105 Bacteria 5216
264 Ga0163162_10054789 3300013306 Bacteria 4012
265 Ga0163162_10236303 3300013306 Bacteria 1958
266 Ga0157372_10000420 3300013307 Bacteria 46608
267 Ga0157372_10053067 3300013307 Bacteria 4517
268 Ga0157375_10137199 3300013308 Bacteria 2571
269 Ga0157375_12906465 3300013308 Bacteria 572
270 Ga0163163_10096625 3300014325 Bacteria 2975
271 Ga0157380_10119686 3300014326 Bacteria 2228
272 Ga0157380_12269689 3300014326 Bacteria 607
273 Ga0157379_10670213 3300014968 Unclassified 972
274 Ga0163161_10134875 3300017792 Bacteria 1865
275 Ga0197907_10208289 3300020069 Unclassified 698
276 Ga0207653_10005973 3300025885 Bacteria 3799
277 Ga0207653_10010578 3300025885 Bacteria 2879
278 Ga0207653_10068935 3300025885 Unclassified 1206
279 Ga0207688_10051432 3300025901 Bacteria 2308
280 Ga0207688_10159107 3300025901 Unclassified 1338
281 Ga0207680_10237175 3300025903 Unclassified 1255
282 Ga0207647_10070708 3300025904 Bacteria 2107
283 Ga0207645_10008456 3300025907 Bacteria 7179
284 Ga0207645_10025986 3300025907 Bacteria 3787
285 Ga0207645_10298414 3300025907 Bacteria 1072
286 Ga0207645_11071963 3300025907 Bacteria 544
287 Ga0207643_10000014 3300025908 Bacteria 128891
288 Ga0207643_10179705 3300025908 Bacteria 1280
289 Ga0207684_10001241 3300025910 Bacteria 28340
290 Ga0207684_10003973 3300025910 Bacteria 14161
291 Ga0207684_10013528 3300025910 Bacteria 7055
292 Ga0207684_10037905 3300025910 Bacteria 4090
293 Ga0207684_10046938 3300025910 Bacteria 3664
294 Ga0207684_10123910 3300025910 Bacteria 2217
295 Ga0207684_10248101 3300025910 Unclassified 1536
296 Ga0207684_10533807 3300025910 Unclassified 1004
297 Ga0207684_11368595 3300025910 Bacteria 580
298 Ga0207654_10001471 3300025911 Bacteria 12452
299 Ga0207707_10000138 3300025912 Bacteria 74881
300 Ga0207693_10003375 3300025915 Bacteria 13638
301 Ga0207663_10018982 3300025916 Bacteria 3864
302 Ga0207660_10000469 3300025917 Bacteria 26763
303 Ga0207660_10037629 3300025917 Bacteria 3373
304 Ga0207662_10205813 3300025918 Unclassified 1275
305 Ga0207657_10000135 3300025919 Bacteria 75248
306 Ga0207652_10001153 3300025921 Bacteria 23785
307 Ga0207646_10001834 3300025922 Bacteria 25670
308 Ga0207646_10005939 3300025922 Bacteria 12736
309 Ga0207646_10006827 3300025922 Bacteria 11735
310 Ga0207646_10049296 3300025922 Bacteria 3772
311 Ga0207646_10072697 3300025922 Bacteria 3072
312 Ga0207646_10084579 3300025922 Bacteria 2839
313 Ga0207646_10088865 3300025922 Bacteria 2765
314 Ga0207646_10185621 3300025922 Bacteria 1878
315 Ga0207681_10010611 3300025923 Bacteria 5649
316 Ga0207681_10037784 3300025923 Bacteria 3194
317 Ga0207681_10646900 3300025923 Unclassified 876
318 Ga0207650_10001522 3300025925 Bacteria 16584
319 Ga0207687_10085594 3300025927 Unclassified 2287
320 Ga0207687_10271672 3300025927 Bacteria 1355
321 Ga0207644_10777028 3300025931 Bacteria 801
322 Ga0207690_10007118 3300025932 Bacteria 6647
323 Ga0207706_10007935 3300025933 Bacteria 9799
324 Ga0207706_10023456 3300025933 Bacteria 5540
325 Ga0207706_10736596 3300025933 Bacteria 840
326 Ga0207686_10970394 3300025934 Bacteria 688
327 Ga0207686_11083394 3300025934 Bacteria 653
328 Ga0207709_10118908 3300025935 Bacteria 1780
329 Ga0207709_10283881 3300025935 Archaea 1224
330 Ga0207709_10662889 3300025935 Bacteria 832
331 Ga0207670_10005070 3300025936 Bacteria 7185
332 Ga0207704_10548422 3300025938 Bacteria 939
333 Ga0207665_10684479 3300025939 Bacteria 806
334 Ga0207691_10103954 3300025940 Bacteria 2532
335 Ga0207691_10155049 3300025940 Bacteria 2012
336 Ga0207689_10005236 3300025942 Bacteria 11631
337 Ga0207689_10005737 3300025942 Bacteria 11032
338 Ga0207689_10724193 3300025942 Bacteria 839
339 Ga0207679_10004686 3300025945 Bacteria 8517
340 Ga0207667_10004118 3300025949 Bacteria 17866
341 Ga0207651_10008588 3300025960 Bacteria 5528
342 Ga0207712_10172723 3300025961 Unclassified 1691
343 Ga0207712_10316264 3300025961 Bacteria 1286
344 Ga0207712_10361311 3300025961 Bacteria 1210
345 Ga0207712_11327516 3300025961 Bacteria 643
346 Ga0207712_11366697 3300025961 Unclassified 633
347 Ga0207668_11917362 3300025972 Unclassified 534
348 Ga0207703_11128511 3300026035 Unclassified 753
349 Ga0207639_10026669 3300026041 Bacteria 4199
350 Ga0207678_10003392 3300026067 Bacteria 14354
351 Ga0207708_10288509 3300026075 Bacteria 1331
352 Ga0207708_10778153 3300026075 Bacteria 823
353 Ga0207708_11164903 3300026075 Unclassified 673
354 Ga0207702_10002425 3300026078 Bacteria 17731
355 Ga0207641_10291031 3300026088 Unclassified 1539
356 Ga0207648_10000374 3300026089 Bacteria 49152
357 Ga0207648_10105444 3300026089 Bacteria 2473
358 Ga0207648_10362818 3300026089 Unclassified 1307
359 Ga0207648_10378923 3300026089 Bacteria 1279
360 Ga0207648_11080437 3300026089 Bacteria 752
361 Ga0207676_10007292 3300026095 Bacteria 7839
362 Ga0207674_10001425 3300026116 Bacteria 30871
363 Ga0207675_100011016 3300026118 Bacteria 8466
364 Ga0207675_100087302 3300026118 Bacteria 2929
365 Ga0207675_100834168 3300026118 Bacteria 936
366 Ga0207675_100944546 3300026118 Bacteria 879
367 Ga0207698_10062913 3300026142 Bacteria 2901
368 Ga0209969_1001708 3300027360 Bacteria 3029
369 Ga0209967_1020961 3300027364 Bacteria 954
370 Ga0209981_1011617 3300027378 Unclassified 1215
371 Ga0209996_1009663 3300027395 Bacteria 1273
372 Ga0209995_1010559 3300027471 Unclassified 1498
373 Ga0209968_1009672 3300027526 Unclassified 1477
374 Ga0209999_1031800 3300027543 Bacteria 980
375 Ga0209982_1011228 3300027552 Bacteria 1336
376 Ga0209970_1005316 3300027614 Bacteria 2127
377 Ga0210002_1005192 3300027617 Bacteria 1953
378 Ga0209983_1002420 3300027665 Bacteria 4088
379 Ga0209588_1160774 3300027671 Bacteria 709
380 Ga0209971_1000010 3300027682 Bacteria 84272
381 Ga0209966_1000110 3300027695 Bacteria 36054
382 Ga0209998_10000451 3300027717 Bacteria 11418
383 Ga0209974_10081824 3300027876 Bacteria 1112
384 Ga0268265_10001957 3300028380 Bacteria 16351
385 Ga0268265_10097228 3300028380 Unclassified 2368
386 Ga0268265_10139799 3300028380 Unclassified 2026
387 Ga0268265_10185086 3300028380 Unclassified 1793
388 Ga0268264_10022884 3300028381 Bacteria 5099
389 Ga0268264_10034799 3300028381 Bacteria 4145
390 Ga0268264_10097931 3300028381 Bacteria 2543
391 Ga0268264_10111713 3300028381 Bacteria 2395
392 Ga0268264_10401869 3300028381 Unclassified 1317
393 Ga0268264_10984903 3300028381 Archaea 849
394 Ga0307408_100065956 3300031548 Bacteria 2657
395 Ga0307408_100355583 3300031548 Bacteria 1244
396 Ga0307410_10246570 3300031852 Bacteria 1387
397 Ga0307416_100827948 3300032002 Bacteria 1023
398 Ga0307416_102525303 3300032002 Bacteria 612
399 Ga0373930_0141515 3300034816 Bacteria 598
400 Ga0373948_0004683 3300034817 Bacteria 2178
401 Ga0373958_0010874 3300034819 Bacteria 1527
402 Ga0373929_0022567 3300035085 Bacteria 1286
403 Ga0373940_0202246 3300035088 Bacteria 653
404 Ga0373949_0017955 3300035090 Bacteria 1599
405 Ga0373932_0224269 3300035112 Unclassified 677
406 Ga0373941_0060359 3300035115 Bacteria 1232
407 Ga0373942_0211862 3300035207 Bacteria 646
408 Ga0373961_0127292 3300035241 Bacteria 850
409 Ga0373931_0300181 3300035691 Bacteria 992
410 Ga0242420_009797 3300038996 Unclassified 1580
411 Ga0439441_003065 3300042001 Bacteria 2422
412 Ga0439448_0000426 3300042005 Bacteria 9707
413 Ga0439450_057705 3300042008 Bacteria 933
414 Ga0439463_017601 3300042016 Bacteria 1773
415 Ga0450890_056102 3300042127 Bacteria 609
416 Ga0450889_034735 3300042144 Unclassified 597
417 Ga0439458_0019187 3300042157 Unclassified 1572
418 Ga0439435_0167115 3300042436 Bacteria 713
419 Ga0439444_0018546 3300042437 Bacteria 1206
420 Ga0439459_0042438 3300042438 Bacteria 971
421 Ga0439464_0001358 3300042439 Bacteria 5731
422 Ga0439460_0004940 3300042461 Bacteria 3257
423 Ga0451577_0004483 3300042876 Bacteria 14730
424 Ga0451577_0085502 3300042876 Unclassified 2814
425 Ga0451577_0097308 3300042876 Bacteria 2628
426 Ga0451577_0516861 3300042876 Unclassified 1084
427 Ga0439440_0279682 3300042993 Bacteria 515
428 Ga0453683_0003828 3300044673 Bacteria 10922
429 Ga0453683_0169477 3300044673 Bacteria 1383
430 Ga0453683_0370577 3300044673 Bacteria 921
431 Ga0453684_0031131 3300044712 Bacteria 7509
432 Ga0453684_0516559 3300044712 Bacteria 1320
433 Ga0453684_0587709 3300044712 Bacteria 1222
434 Ga0451576_0011794 3300045051 Bacteria 9897
435 Ga0451576_0058335 3300045051 Bacteria 4034
436 Ga0451576_0377169 3300045051 Unclassified 1486
437 Ga0451576_0740120 3300045051 Bacteria 1033
438 Ga0451576_1999157 3300045051 Unclassified 597
439 Ga0495580_0167606 3300046472 Bacteria 1519
440 Ga0495580_0239583 3300046472 Bacteria 1244
441 Ga0495584_0236400 3300046491 Bacteria 929
442 Ga0495584_0270429 3300046491 Unclassified 864
443 Ga0495644_0163504 3300046523 Bacteria 854
444 Ga0495609_0311861 3300046538 Bacteria 639
445 Ga0495588_0139927 3300046674 Bacteria 1278
446 Ga0495669_0022728 3300046684 Bacteria 2725
447 Ga0495670_0049731 3300046691 Bacteria 2098
448 Ga0496102_0090045 3300048905 Bacteria 2839
449 Ga0496106_0864508 3300048909 Bacteria 715
450 Ga0496107_0921988 3300048910 Bacteria 636
451 Ga0496109_0273827 3300048912 Bacteria 1591
452 Ga0496110_0524100 3300048913 Bacteria 1078
453 Ga0496110_1647365 3300048913 Bacteria 552
454 Ga0496111_0916274 3300048914 Bacteria 631
455 Ga0496112_0312225 3300048915 Unclassified 1517
456 Ga0501296_037135 3300049519 Bacteria 675
457 Ga0501031_0365729 3300049568 Bacteria 933
458 Ga0501032_0277181 3300049569 Unclassified 1086
459 Ga0501033_0041479 3300049570 Bacteria 3434
460 Ga0501033_0452585 3300049570 Bacteria 892
461 Ga0501036_0099113 3300049572 Bacteria 2464
462 Ga0501036_0459896 3300049572 Bacteria 1060
463 Ga0501036_0464606 3300049572 Bacteria 1054
464 Ga0501037_0070735 3300049573 Bacteria 2539
465 Ga0501038_0036117 3300049574 Bacteria 4337
466 Ga0501039_0024183 3300049575 Bacteria 4665
467 Ga0501039_0328874 3300049575 Bacteria 1201
468 Ga0501040_0003757 3300049576 Bacteria 9839
469 Ga0501040_0032530 3300049576 Bacteria 3529
470 Ga0501040_0032917 3300049576 Bacteria 3509
471 Ga0501040_0084167 3300049576 Bacteria 2206
472 Ga0501040_0438570 3300049576 Bacteria 940
473 Ga0501040_1184220 3300049576 Bacteria 554
474 Ga0501041_0009062 3300049577 Bacteria 5855
475 Ga0501041_0091297 3300049577 Bacteria 1880
476 Ga0501041_0122279 3300049577 Bacteria 1618
477 Ga0501041_0631255 3300049577 Unclassified 684
478 Ga0501042_0003510 3300049578 Bacteria 9854
479 Ga0501042_0250434 3300049578 Bacteria 1278
480 Ga0501043_0026359 3300049579 Bacteria 4561
481 Ga0501046_0000340 3300049580 Bacteria 47112
482 Ga0501046_0273344 3300049580 Bacteria 1239
483 Ga0501047_0009161 3300049581 Bacteria 9346
484 Ga0501048_0002818 3300049582 Bacteria 13274
485 Ga0501048_1265787 3300049582 Bacteria 530
486 Ga0501067_0407361 3300049583 Bacteria 758
487 Ga0501067_0490154 3300049583 Bacteria 687
488 Ga0501068_0049334 3300049584 Bacteria 2542
489 Ga0501068_0296182 3300049584 Bacteria 1035
490 Ga0501069_0996207 3300049585 Bacteria 512
491 Ga0501070_0592638 3300049586 Bacteria 884
492 Ga0501070_0640368 3300049586 Bacteria 845
493 Ga0501071_1273142 3300049587 Bacteria 568
494 Ga0501071_1477540 3300049587 Bacteria 525
495 Ga0501072_0045143 3300049588 Bacteria 3464
496 Ga0501072_0060372 3300049588 Bacteria 2990
497 Ga0501072_0098592 3300049588 Bacteria 2323
498 Ga0501072_0165074 3300049588 Bacteria 1767
499 Ga0501072_0207326 3300049588 Bacteria 1562
500 Ga0501073_0162172 3300049589 Bacteria 1549
501 Ga0501074_0127573 3300049590 Bacteria 1820
502 Ga0501075_0003639 3300049591 Bacteria 10332
503 Ga0501075_0214945 3300049591 Bacteria 1466
504 Ga0501075_0270753 3300049591 Bacteria 1294
505 Ga0501075_0340801 3300049591 Bacteria 1142
506 Ga0501076_0033648 3300049592 Bacteria 4002
507 Ga0501076_0098406 3300049592 Bacteria 2357
508 Ga0501076_0302057 3300049592 Bacteria 1312
509 Ga0501076_0313678 3300049592 Bacteria 1286
510 Ga0501076_0442190 3300049592 Bacteria 1070
511 Ga0501077_0018239 3300049593 Bacteria 4441
512 Ga0501077_0152126 3300049593 Bacteria 1468
513 Ga0501077_0203505 3300049593 Bacteria 1258
514 Ga0501077_0604823 3300049593 Bacteria 704
515 Ga0501077_0687598 3300049593 Bacteria 657
516 Ga0501235_200741 3300049669 Bacteria 540
517 Ga0501079_0004004 3300049741 Bacteria 10894
518 Ga0501079_0029635 3300049741 Bacteria 4203
519 Ga0501080_0751146 3300049742 Bacteria 858
520 Ga0501080_0912118 3300049742 Bacteria 765
521 Ga0501080_0945891 3300049742 Bacteria 749
522 Ga0501081_0001906 3300049743 Bacteria 12939
523 Ga0501081_0070562 3300049743 Bacteria 2435
524 Ga0501081_0142758 3300049743 Bacteria 1716
525 Ga0501081_0196773 3300049743 Bacteria 1461
526 Ga0501081_0414443 3300049743 Bacteria 998
527 Ga0501081_0816863 3300049743 Bacteria 702
528 Ga0501081_1049036 3300049743 Unclassified 616
529 Ga0501083_0292130 3300049744 Bacteria 1060
530 Ga0501035_0464708 3300049822 Bacteria 1045
531 Ga0501045_0000854 3300049824 Bacteria 19769
532 Ga0501045_0209488 3300049824 Bacteria 1452
533 Ga0501045_0236923 3300049824 Bacteria 1359
534 Ga0501045_0431063 3300049824 Bacteria 980
535 Ga0501045_0591301 3300049824 Bacteria 822
536 nmdc:mga05p37_11193_c1 3300050507 Bacteria 10664
537 nmdc:mga05p37_13707_c1 3300050507 Bacteria 9717
538 nmdc:mga05p37_15266_c1 3300050507 Bacteria 9226
539 nmdc:mga05p37_194005_c1 3300050507 Bacteria 2464
540 nmdc:mga05p37_225470_c1 3300050507 Bacteria 2260
541 nmdc:mga05p37_253857_c1 3300050507 Bacteria 2108
542 nmdc:mga05p37_258272_c1 3300050507 Bacteria 2087
543 nmdc:mga05p37_333477_c1 3300050507 Bacteria 1791
544 nmdc:mga05p37_50625_c1 3300050507 Bacteria 5109
545 nmdc:mga05p37_72314_c1 3300050507 Bacteria 4243
546 nmdc:mga05p37_819951_c1 3300050507 Unclassified 1015
547 nmdc:mga09592_131976_c1 3300050508 Bacteria 2150
548 nmdc:mga09592_50255_c1 3300050508 Bacteria 3517
549 nmdc:mga09592_560349_c1 3300050508 Bacteria 981
550 nmdc:mga09592_98541_c1 3300050508 Bacteria 2502
551 nmdc:mga0qj67_122449_c1 3300050509 Unclassified 2104
552 nmdc:mga0qj67_162338_c1 3300050509 Unclassified 1814
553 nmdc:mga0qj67_32896_c1 3300050509 Bacteria 4044
554 nmdc:mga06r32_150213_c1 3300050510 Bacteria 2308
555 nmdc:mga06r32_212825_c1 3300050510 Bacteria 1921
556 nmdc:mga06r32_2401_c1 3300050510 Bacteria 16760
557 nmdc:mga06r32_392187_c1 3300050510 Unclassified 1371
558 nmdc:mga06r32_44625_c1 3300050510 Bacteria 4221
559 nmdc:mga06r32_736866_c1 3300050510 Bacteria 949
560 nmdc:mga06r32_972336_c1 3300050510 Bacteria 803
561 nmdc:mga0n895_154074_c1 3300050512 Unclassified 2329
562 nmdc:mga0n895_2815_c1 3300050512 Bacteria 13759
563 nmdc:mga0n895_371887_c1 3300050512 Bacteria 1447
564 nmdc:mga0n895_4331_c1 3300050512 Bacteria 11632
565 nmdc:mga0n895_465530_c1 3300050512 Bacteria 1276
566 nmdc:mga0n895_574629_c1 3300050512 Unclassified 1131
567 nmdc:mga0n895_727019_c1 3300050512 Bacteria 987
568 nmdc:mga0rr50_1555_c1 3300050513 Bacteria 12648
569 nmdc:mga0rr50_232756_c1 3300050513 Unclassified 1525
570 nmdc:mga0rr50_78697_c1 3300050513 Bacteria 2538
571 nmdc:mga08x19_30569_c1 3300050514 Bacteria 3384
572 nmdc:mga08x19_32272_c1 3300050514 Bacteria 3299
573 nmdc:mga08x19_44167_c1 3300050514 Bacteria 2153
574 nmdc:mga0a205_118421_c1 3300050515 Bacteria 2547
575 nmdc:mga0a205_16215_c1 3300050515 Bacteria 6977
576 nmdc:mga0a205_1664_c1 3300050515 Bacteria 19143
577 nmdc:mga0a205_800334_c1 3300050515 Bacteria 790
578 nmdc:mga0a205_90333_c1 3300050515 Bacteria 2960
579 Ga0501084_0007523 3300054114 Bacteria 8980
580 Ga0501084_0088597 3300054114 Bacteria 2598
581 Ga0501084_0978189 3300054114 Bacteria 711
582 Ga0501082_0000462 3300060353 Bacteria 35910
583 Ga0501082_0076608 3300060353 Bacteria 2883
584 Ga0501082_0131429 3300060353 Bacteria 2172
585 Ga0501082_0227571 3300060353 Bacteria 1623
586 Ga0501082_0522057 3300060353 Bacteria 1038
587 Ga0530510_0083168 3300061734 Bacteria 2331
588 Ga0530510_0333780 3300061734 Bacteria 1137
589 Ga0530510_0439796 3300061734 Bacteria 985
590 Ga0530510_1329010 3300061734 Bacteria 551
591 Ga0070706_100862608
592 Ga0065712_10480670
593 Ga0065715_10195835
594 Ga0065715_11049010
595 Ga0065707_10295068
596 Ga0065707_10298217
597 Ga0065707_10583805
598 Ga0070676_10001222
599 Ga0070676_10019287
600 Ga0070670_100106789
601 Ga0068869_100000743
602 Ga0068869_100001033
603 Ga0068869_100498002
604 Ga0070666_10195868
605 Ga0070680_100000352
606 Ga0070680_100057186
607 Ga0070680_100181092
608 Ga0070680_101521195
609 Ga0070682_100000619
610 Ga0070660_100000444
611 Ga0070689_100025981
612 Ga0070689_100266466
613 Ga0070689_101240421
614 Ga0070691_10011432
615 Ga0070691_10061474
616 Ga0070691_10137707
617 Ga0070691_10151614
618 Ga0070687_100068295
619 Ga0070661_100000260
620 Ga0070692_10000079
621 Ga0070692_10017473
622 Ga0070692_10381088
623 Ga0070692_10513414
624 Ga0070669_100011657
625 Ga0070669_100011774
626 Ga0070671_100221183
627 Ga0070671_100607921
628 Ga0070673_100083743
629 Ga0070659_100004975
630 Ga0070659_100761627
631 Ga0070703_10001904
632 Ga0070701_10005077
633 Ga0070705_100000373
634 Ga0070705_100057695
635 Ga0070705_100434835
636 Ga0070700_100148664
637 Ga0070700_100427776
638 Ga0070700_100620648
639 Ga0070694_100000235
640 Ga0070694_100004664
641 Ga0070694_100024085
642 Ga0070694_100046928
643 Ga0070694_100245177
644 Ga0070694_100533565
645 Ga0070708_100005842
646 Ga0070708_100032332
647 Ga0070708_100032714
648 Ga0070708_100053878
649 Ga0070708_100055455
650 Ga0070708_100074930
651 Ga0070708_100221930
652 Ga0070708_100252056
653 Ga0070708_100389142
654 Ga0070663_100007049
655 Ga0070662_100003431
656 Ga0070662_100311454
657 Ga0070662_100845614
658 Ga0070681_10016585
659 Ga0070681_10214305
660 Ga0068867_100022294
661 Ga0068867_100248832
662 Ga0068867_101646471
663 Ga0070706_100010951
664 Ga0070706_100015410
665 Ga0070706_100038010
666 Ga0070706_100043964
667 Ga0070706_100048396
668 Ga0070706_100052346
669 Ga0070706_100209503
670 Ga0070706_100676315
671 Ga0070706_100688307
672 Ga0070706_101748706
673 Ga0070707_100002181
674 Ga0070707_100004865
675 Ga0070707_100005646
676 Ga0070707_100062680
677 Ga0070707_100078896
678 Ga0070707_100083275
679 Ga0070707_100089730
680 Ga0070707_100300577
681 Ga0070707_100356216
682 Ga0070707_100410596
683 Ga0070698_100001277
684 Ga0070698_100004602
685 Ga0070698_100050713
686 Ga0070698_100110024
687 Ga0070698_100260726
688 Ga0070698_100363894
689 Ga0070698_100370887
690 Ga0070698_100460648
691 Ga0070699_100000451
692 Ga0070699_100023120
693 Ga0070699_100033736
694 Ga0070699_100048515
695 Ga0070699_100089509
696 Ga0070699_100123993
697 Ga0070699_100257958
698 Ga0070699_100316573
699 Ga0070699_100316601
700 Ga0070699_100636757
701 Ga0070699_101053964
702 Ga0070699_101233429
703 Ga0070679_100000791
704 Ga0070679_100707997
705 Ga0070684_100217051
706 Ga0070697_100003429
707 Ga0070697_100007182
708 Ga0070697_100116014
709 Ga0070697_100151139
710 Ga0070697_100157686
711 Ga0070697_100193153
712 Ga0070697_100212469
713 Ga0070697_100214984
714 Ga0070697_100264685
715 Ga0070697_100448685
716 Ga0070697_100487777
717 Ga0068853_100003465
718 Ga0070672_100007644
719 Ga0070672_100093342
720 Ga0070686_100982354
721 Ga0070695_100002825
722 Ga0070695_100004303
723 Ga0070695_100043426
724 Ga0070695_100098338
725 Ga0070695_100436341
726 Ga0070696_100001608
727 Ga0070696_100050682
728 Ga0070696_100099390
729 Ga0070696_100505545
730 Ga0070696_100532857
731 Ga0070696_100807036
732 Ga0070693_100000077
733 Ga0070693_100112656
734 Ga0070704_100001443
735 Ga0070704_100031096
736 Ga0070704_100067282
737 Ga0070704_100266999
738 Ga0070704_100269394
739 Ga0070704_101227936
740 Ga0068855_100001296
741 Ga0070664_100004438
742 Ga0068857_100002233
743 Ga0068857_100033781
744 Ga0068856_100019836
745 Ga0070702_100002924
746 Ga0070702_100228194
747 Ga0068859_100001883
748 Ga0068859_100257728
749 Ga0068864_100013015
750 Ga0068866_10275634
751 Ga0068861_100006082
752 Ga0068861_100348254
753 Ga0068870_10000478
754 Ga0068870_10488953
755 Ga0068863_100012828
756 Ga0068863_100461935
757 Ga0068860_100010294
758 Ga0068860_100015776
759 Ga0068860_100080475
760 Ga0068860_100164790
761 Ga0068860_100395843
762 Ga0068860_101463560
763 Ga0068862_100007125
764 Ga0068862_100020345
765 Ga0068862_100111404
766 Ga0081455_10001046
767 Ga0081455_10282905
768 Ga0081455_10591367
769 Ga0081540_1016482
770 Ga0081539_10000009
771 Ga0070715_10655085
772 Ga0070712_100001466
773 Ga0075427_10083033
774 Ga0075428_100000487
775 Ga0075428_101208035
776 Ga0075430_100143041
777 Ga0075430_100270427
778 Ga0075430_100437820
779 Ga0075431_100022257
780 Ga0075431_100027493
781 Ga0075431_100081364
782 Ga0075431_100241923
783 Ga0075431_100265078
784 Ga0075431_100687065
785 Ga0075431_100841591
786 Ga0075431_101805210
787 Ga0075433_10000395
788 Ga0075433_10023012
789 Ga0075433_10298718
790 Ga0075433_10558949
791 Ga0075434_100004096
792 Ga0075434_100010356
793 Ga0075434_100038867
794 Ga0075434_100090483
795 Ga0075434_100104075
796 Ga0075434_100308887
797 Ga0075434_100605400
798 Ga0075434_100688678
799 Ga0075434_101134153
800 Ga0075429_100050534
801 Ga0075429_100172254
802 Ga0068865_100512420
803 Ga0068865_100950586
804 Ga0075436_100018707
805 Ga0075436_100055119
806 Ga0097620_100001883
807 Ga0097620_100257698
808 Ga0075435_100002818
809 Ga0075435_100061340
810 Ga0075435_100062558
811 Ga0075435_100390657
812 Ga0099794_10015671
813 Ga0099794_10048527
814 Ga0099794_10249644
815 Ga0105240_11145527
816 Ga0111539_10872795
817 Ga0111539_11052998
818 Ga0105245_10137209
819 Ga0105245_10538915
820 Ga0105245_13133025
821 Ga0114129_10009610
822 Ga0114129_10027657
823 Ga0114129_10035906
824 Ga0114129_10172259
825 Ga0114129_10204102
826 Ga0114129_10334351
827 Ga0114129_10508284
828 Ga0114129_10551257
829 Ga0114129_10917654
830 Ga0114129_12446327
831 Ga0105243_10020580
832 Ga0105243_10139326
833 Ga0105243_10399837
834 Ga0105241_10000054
835 Ga0105241_10023901
836 Ga0105242_10020287
837 Ga0105242_10105601
838 Ga0105242_10123490
839 Ga0105242_10316475
840 Ga0105248_10433277
841 Ga0105237_10067884
842 Ga0105249_10062429
843 Ga0105249_10237211
844 Ga0105249_10449990
845 Ga0105249_12486646
846 Ga0105249_12774236
847 Ga0105246_10028286
848 Ga0105246_10155108
849 Ga0157373_10000475
850 Ga0157371_10198859
851 Ga0157371_10278481
852 Ga0157370_10223937
853 Ga0157369_10038687
854 Ga0163162_10054789
855 Ga0163162_10236303
856 Ga0157372_10000420
857 Ga0157372_10053067
858 Ga0157375_10137199
859 Ga0157375_12906465
860 Ga0163163_10096625
861 Ga0157380_10119686
862 Ga0157380_12269689
863 Ga0157379_10670213
864 Ga0163161_10134875
865 Ga0197907_10208289
866 Ga0207653_10005973
867 Ga0207653_10010578
868 Ga0207653_10068935
869 Ga0207688_10051432
870 Ga0207688_10159107
871 Ga0207680_10237175
872 Ga0207647_10070708
873 Ga0207645_10008456
874 Ga0207645_10025986
875 Ga0207645_10298414
876 Ga0207645_11071963
877 Ga0207643_10000014
878 Ga0207643_10179705
879 Ga0207684_10001241
880 Ga0207684_10003973
881 Ga0207684_10013528
882 Ga0207684_10037905
883 Ga0207684_10046938
884 Ga0207684_10123910
885 Ga0207684_10248101
886 Ga0207684_10533807
887 Ga0207684_11368595
888 Ga0207654_10001471
889 Ga0207707_10000138
890 Ga0207693_10003375
891 Ga0207663_10018982
892 Ga0207660_10000469
893 Ga0207660_10037629
894 Ga0207662_10205813
895 Ga0207657_10000135
896 Ga0207652_10001153
897 Ga0207646_10001834
898 Ga0207646_10005939
899 Ga0207646_10006827
900 Ga0207646_10049296
901 Ga0207646_10072697
902 Ga0207646_10084579
903 Ga0207646_10088865
904 Ga0207646_10185621
905 Ga0207681_10010611
906 Ga0207681_10037784
907 Ga0207681_10646900
908 Ga0207650_10001522
909 Ga0207687_10085594
910 Ga0207687_10271672
911 Ga0207644_10777028
912 Ga0207690_10007118
913 Ga0207706_10007935
914 Ga0207706_10023456
915 Ga0207706_10736596
916 Ga0207686_10970394
917 Ga0207686_11083394
918 Ga0207709_10118908
919 Ga0207709_10283881
920 Ga0207709_10662889
921 Ga0207670_10005070
922 Ga0207704_10548422
923 Ga0207665_10684479
924 Ga0207691_10103954
925 Ga0207691_10155049
926 Ga0207689_10005236
927 Ga0207689_10005737
928 Ga0207689_10724193
929 Ga0207679_10004686
930 Ga0207667_10004118
931 Ga0207651_10008588
932 Ga0207712_10172723
933 Ga0207712_10316264
934 Ga0207712_10361311
935 Ga0207712_11327516
936 Ga0207712_11366697
937 Ga0207668_11917362
938 Ga0207703_11128511
939 Ga0207639_10026669
940 Ga0207678_10003392
941 Ga0207708_10288509
942 Ga0207708_10778153
943 Ga0207708_11164903
944 Ga0207702_10002425
945 Ga0207641_10291031
946 Ga0207648_10000374
947 Ga0207648_10105444
948 Ga0207648_10362818
949 Ga0207648_10378923
950 Ga0207648_11080437
951 Ga0207676_10007292
952 Ga0207674_10001425
953 Ga0207675_100011016
954 Ga0207675_100087302
955 Ga0207675_100834168
956 Ga0207675_100944546
957 Ga0207698_10062913
958 Ga0209969_1001708
959 Ga0209967_1020961
960 Ga0209981_1011617
961 Ga0209996_1009663
962 Ga0209995_1010559
963 Ga0209968_1009672
964 Ga0209999_1031800
965 Ga0209982_1011228
966 Ga0209970_1005316
967 Ga0210002_1005192
968 Ga0209983_1002420
969 Ga0209588_1160774
970 Ga0209971_1000010
971 Ga0209966_1000110
972 Ga0209998_10000451
973 Ga0209974_10081824
974 Ga0268265_10001957
975 Ga0268265_10097228
976 Ga0268265_10139799
977 Ga0268265_10185086
978 Ga0268264_10022884
979 Ga0268264_10034799
980 Ga0268264_10097931
981 Ga0268264_10111713
982 Ga0268264_10401869
983 Ga0268264_10984903
984 Ga0307408_100065956
985 Ga0307408_100355583
986 Ga0307410_10246570
987 Ga0307416_100827948
988 Ga0307416_102525303
989 Ga0373930_0141515
990 Ga0373948_0004683
991 Ga0373958_0010874
992 Ga0373929_0022567
993 Ga0373940_0202246
994 Ga0373949_0017955
995 Ga0373932_0224269
996 Ga0373941_0060359
997 Ga0373942_0211862
998 Ga0373961_0127292
999 Ga0373931_0300181
1000 Ga0242420_009797
1001 Ga0439441_003065
1002 Ga0439448_0000426
1003 Ga0439450_057705
1004 Ga0439463_017601
1005 Ga0450890_056102
1006 Ga0450889_034735
1007 Ga0439458_0019187
1008 Ga0439435_0167115
1009 Ga0439444_0018546
1010 Ga0439459_0042438
1011 Ga0439464_0001358
1012 Ga0439460_0004940
1013 Ga0451577_0004483
1014 Ga0451577_0085502
1015 Ga0451577_0097308
1016 Ga0451577_0516861
1017 Ga0439440_0279682
1018 Ga0453683_0003828
1019 Ga0453683_0169477
1020 Ga0453683_0370577
1021 Ga0453684_0031131
1022 Ga0453684_0516559
1023 Ga0453684_0587709
1024 Ga0451576_0011794
1025 Ga0451576_0058335
1026 Ga0451576_0377169
1027 Ga0451576_0740120
1028 Ga0451576_1999157
1029 Ga0495580_0167606
1030 Ga0495580_0239583
1031 Ga0495584_0236400
1032 Ga0495584_0270429
1033 Ga0495644_0163504
1034 Ga0495609_0311861
1035 Ga0495588_0139927
1036 Ga0495669_0022728
1037 Ga0495670_0049731
1038 Ga0496102_0090045
1039 Ga0496106_0864508
1040 Ga0496107_0921988
1041 Ga0496109_0273827
1042 Ga0496110_0524100
1043 Ga0496110_1647365
1044 Ga0496111_0916274
1045 Ga0496112_0312225
1046 Ga0501296_037135
1047 Ga0501031_0365729
1048 Ga0501032_0277181
1049 Ga0501033_0041479
1050 Ga0501033_0452585
1051 Ga0501036_0099113
1052 Ga0501036_0459896
1053 Ga0501036_0464606
1054 Ga0501037_0070735
1055 Ga0501038_0036117
1056 Ga0501039_0024183
1057 Ga0501039_0328874
1058 Ga0501040_0003757
1059 Ga0501040_0032530
1060 Ga0501040_0032917
1061 Ga0501040_0084167
1062 Ga0501040_0438570
1063 Ga0501040_1184220
1064 Ga0501041_0009062
1065 Ga0501041_0091297
1066 Ga0501041_0122279
1067 Ga0501041_0631255
1068 Ga0501042_0003510
1069 Ga0501042_0250434
1070 Ga0501043_0026359
1071 Ga0501046_0000340
1072 Ga0501046_0273344
1073 Ga0501047_0009161
1074 Ga0501048_0002818
1075 Ga0501048_1265787
1076 Ga0501067_0407361
1077 Ga0501067_0490154
1078 Ga0501068_0049334
1079 Ga0501068_0296182
1080 Ga0501069_0996207
1081 Ga0501070_0592638
1082 Ga0501070_0640368
1083 Ga0501071_1273142
1084 Ga0501071_1477540
1085 Ga0501072_0045143
1086 Ga0501072_0060372
1087 Ga0501072_0098592
1088 Ga0501072_0165074
1089 Ga0501072_0207326
1090 Ga0501073_0162172
1091 Ga0501074_0127573
1092 Ga0501075_0003639
1093 Ga0501075_0214945
1094 Ga0501075_0270753
1095 Ga0501075_0340801
1096 Ga0501076_0033648
1097 Ga0501076_0098406
1098 Ga0501076_0302057
1099 Ga0501076_0313678
1100 Ga0501076_0442190
1101 Ga0501077_0018239
1102 Ga0501077_0152126
1103 Ga0501077_0203505
1104 Ga0501077_0604823
1105 Ga0501077_0687598
1106 Ga0501235_200741
1107 Ga0501079_0004004
1108 Ga0501079_0029635
1109 Ga0501080_0751146
1110 Ga0501080_0912118
1111 Ga0501080_0945891
1112 Ga0501081_0001906
1113 Ga0501081_0070562
1114 Ga0501081_0142758
1115 Ga0501081_0196773
1116 Ga0501081_0414443
1117 Ga0501081_0816863
1118 Ga0501081_1049036
1119 Ga0501083_0292130
1120 Ga0501035_0464708
1121 Ga0501045_0000854
1122 Ga0501045_0209488
1123 Ga0501045_0236923
1124 Ga0501045_0431063
1125 Ga0501045_0591301
1126 nmdc:mga05p37_11193_c1
1127 nmdc:mga05p37_13707_c1
1128 nmdc:mga05p37_15266_c1
1129 nmdc:mga05p37_194005_c1
1130 nmdc:mga05p37_225470_c1
1131 nmdc:mga05p37_253857_c1
1132 nmdc:mga05p37_258272_c1
1133 nmdc:mga05p37_333477_c1
1134 nmdc:mga05p37_50625_c1
1135 nmdc:mga05p37_72314_c1
1136 nmdc:mga05p37_819951_c1
1137 nmdc:mga09592_131976_c1
1138 nmdc:mga09592_50255_c1
1139 nmdc:mga09592_560349_c1
1140 nmdc:mga09592_98541_c1
1141 nmdc:mga0qj67_122449_c1
1142 nmdc:mga0qj67_162338_c1
1143 nmdc:mga0qj67_32896_c1
1144 nmdc:mga06r32_150213_c1
1145 nmdc:mga06r32_212825_c1
1146 nmdc:mga06r32_2401_c1
1147 nmdc:mga06r32_392187_c1
1148 nmdc:mga06r32_44625_c1
1149 nmdc:mga06r32_736866_c1
1150 nmdc:mga06r32_972336_c1
1151 nmdc:mga0n895_154074_c1
1152 nmdc:mga0n895_2815_c1
1153 nmdc:mga0n895_371887_c1
1154 nmdc:mga0n895_4331_c1
1155 nmdc:mga0n895_465530_c1
1156 nmdc:mga0n895_574629_c1
1157 nmdc:mga0n895_727019_c1
1158 nmdc:mga0rr50_1555_c1
1159 nmdc:mga0rr50_232756_c1
1160 nmdc:mga0rr50_78697_c1
1161 nmdc:mga08x19_30569_c1
1162 nmdc:mga08x19_32272_c1
1163 nmdc:mga08x19_44167_c1
1164 nmdc:mga0a205_118421_c1
1165 nmdc:mga0a205_16215_c1
1166 nmdc:mga0a205_1664_c1
1167 nmdc:mga0a205_800334_c1
1168 nmdc:mga0a205_90333_c1
1169 Ga0501084_0007523
1170 Ga0501084_0088597
1171 Ga0501084_0978189
1172 Ga0501082_0000462
1173 Ga0501082_0076608
1174 Ga0501082_0131429
1175 Ga0501082_0227571
1176 Ga0501082_0522057
1177 Ga0530510_0083168
1178 Ga0530510_0333780
1179 Ga0530510_0439796
1180 Ga0530510_1329010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ayt-assembly1.cif.gz_A the crystal structure of a protein disulfide oxidoreductase from aquifex aeolicus 0.9152 4 125
1a8l-assembly1.cif.gz_A protein disulfide oxidoreductase from archaeon pyrococcus furiosus 0.9149 1 128
1j08-assembly4.cif.gz_D crystal structure of glutaredoxin-like protein from pyrococcus horikoshii 0.9068 3 128
2hls-assembly1.cif.gz_A the crystal structure of a protein disulfide oxidoreductase from aeropyrum pernix k1 0.8833 5 128
5h29-assembly1.cif.gz_A crystal structure of the ntd_n/c domain of alkylhydroperoxide reductase ahpf from enterococcus faecalis (v583) 0.8818 3 125
ID Description Score Start End Superfamily
1j08E01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9312 4 113 3.40.30.10
2ywmD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9061 3 110 3.40.30.10
1j08E01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8781 4 113 3.40.30.10
1hyuA04 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8748 3 106 3.40.30.10
af_O05204_1_196_3.40.30.80 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin; 0.8742 3 130 3.40.30.80
ID Description Score Start End GO Terms
AF-X1JTB0-F1-model_v4 Thioredoxin-like fold domain-containing protein 0.978 1 112
AF-A0A7C1I332-F1-model_v4 Glutaredoxin 0.9727 1 130
AF-A0A7C4GHL8-F1-model_v4 Glutaredoxin 0.9705 1 129
AF-A0A7C5PAK6-F1-model_v4 Glutaredoxin 0.9669 21 100
AF-A0A6N7ACV2-F1-model_v4 Glutaredoxin-like protein 0.9634 1 141

Map