F466848

General Info

Members Datasets Scaffolds Average Seq Length
589 369 540 394

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100117063|Ga0075434_1001170632
Length 449
Sequence VNLNELQKSSPDPDDRRDELVLVGVLPSAVLDYNVAVISASQGGVPGSRVRGLRAIPKSIWALGLVSMFMDLSSEMIHSLLPVFLVSVLGATALSVGLIEGVAEATASITKIFSGALSDYFGRRKFLTGLGYGLAAVTKPLFPLATSVSWVFVARFVDRVGKGIRGAPRDALVGDIAPPSLRGACYGLRQSLDTVGAFAGPLVASALMAMTLEDFRLVFWVAVVPAFLAVGILVFGVEEPAAMPPARETRLPIRIADVRALQPAYWSIVVVGTIFTFARFSEAFLLLRAQDRGVSIPLVPMVLVVMNVVYSASAYPAGRLSDRMNRRVVLAAGSLVLIVADIALALGASRLEVFIGVVLWGLHMGLTQGSLAAMVTDTAPARLRGTAFGLFNLASGIATLIASVLAGWLWTEYGPAATFSAGAGFAAAAFVGLLAIRPQHQPSPPTATC

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2516143018 Ensifer sp. BR816 Isolate Nodule
13 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
14 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
15 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
19 2643221651 Afipia sp. Root123D2 Isolate Unclassified
20 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
21 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
22 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
23 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
24 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
25 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
26 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
27 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
28 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
29 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
30 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
31 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
32 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
33 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
34 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
35 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
36 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
37 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
38 2909042592 Labrys sp. LIt4 Isolate Nodule
39 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
40 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
41 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
42 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
43 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
44 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
45 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
53 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
237 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
367 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
368 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
369 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.51
Metatranscriptomes 0.17
Isolates 8.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 5.94
Nodule 2.04
Rhizoplane 3.57
Rhizosphere 80.81
Stem 0
Stem Tuber 0.17
Unclassified 7.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016383 3300001990 Bacteria 2393
2 JGI25158J39367_1001623 3300002739 Bacteria 3880
3 JGI25151J46595_10000180 3300003187 Bacteria 79747
4 rootH1_10028768 3300003316 Bacteria 10344
5 rootH1_10221365 3300003323 Bacteria 4844
6 JGI25160J50197_1005372 3300003354 Bacteria 5345
7 JGI25161J50226_1000762 3300003374 Bacteria 12357
8 JGI25161J50226_1002283 3300003374 Bacteria 5016
9 Ga0055525_1000105 3300003759 Bacteria 134026
10 Ga0055537_1004952 3300003773 Bacteria 3676
11 Ga0055537_1007027 3300003773 Bacteria 2771
12 Ga0055524_1004541 3300003775 Bacteria 6394
13 Ga0055543_1000446 3300004625 Bacteria 25257
14 Ga0065165_1000309 3300005262 Bacteria 80166
15 Ga0065165_1001563 3300005262 Bacteria 23669
16 Ga0070658_10054592 3300005327 Bacteria 3244
17 Ga0070658_10073956 3300005327 Bacteria 2795
18 Ga0070683_100238747 3300005329 Bacteria 1728
19 Ga0070690_100016759 3300005330 Bacteria 4396
20 Ga0070670_100020645 3300005331 Bacteria 5666
21 Ga0070670_100077674 3300005331 Bacteria 2852
22 Ga0070670_100143551 3300005331 Unclassified 2065
23 Ga0070666_10005581 3300005335 Bacteria 7716
24 Ga0070666_10074119 3300005335 Bacteria 2319
25 Ga0068868_100075406 3300005338 Bacteria 2695
26 Ga0070660_100005781 3300005339 Bacteria 8569
27 Ga0070661_100000186 3300005344 Bacteria 51141
28 Ga0070661_100043986 3300005344 Bacteria 3262
29 Ga0070675_100030307 3300005354 Bacteria 4367
30 Ga0070671_100000127 3300005355 Bacteria 49540
31 Ga0070671_100025818 3300005355 Bacteria 4823
32 Ga0070671_100053067 3300005355 Bacteria 3370
33 Ga0070673_100177974 3300005364 Bacteria 1819
34 Ga0070659_100038694 3300005366 Bacteria 3721
35 Ga0070667_100029243 3300005367 Bacteria 4590
36 Ga0070709_10005586 3300005434 Bacteria 6809
37 Ga0070709_10023928 3300005434 Bacteria 3593
38 Ga0070709_10038872 3300005434 Bacteria 2917
39 Ga0070714_100024010 3300005435 Bacteria 5015
40 Ga0070714_100075316 3300005435 Bacteria 2928
41 Ga0070714_100108572 3300005435 Bacteria 2454
42 Ga0070713_100007605 3300005436 Bacteria 7622
43 Ga0070710_10061387 3300005437 Bacteria 2140
44 Ga0070701_10031634 3300005438 Bacteria 2627
45 Ga0070701_10032652 3300005438 Bacteria 2594
46 Ga0070705_100017394 3300005440 Bacteria 3753
47 Ga0070694_100023632 3300005444 Bacteria 3956
48 Ga0070663_100025474 3300005455 Bacteria 3995
49 Ga0070663_100120575 3300005455 Bacteria 1980
50 Ga0070681_10185841 3300005458 Bacteria 1998
51 Ga0068867_100017620 3300005459 Bacteria 5072
52 Ga0070707_100046822 3300005468 Unclassified 4139
53 Ga0070699_100055187 3300005518 Bacteria 3440
54 Ga0070679_100060057 3300005530 Bacteria 3789
55 Ga0070679_100139494 3300005530 Bacteria 2404
56 Ga0070684_100094419 3300005535 Bacteria 2664
57 Ga0070684_100180921 3300005535 Bacteria 1917
58 Ga0068853_100224583 3300005539 Bacteria 1716
59 Ga0070672_100015991 3300005543 Bacteria 5361
60 Ga0070672_100143098 3300005543 Bacteria 1974
61 Ga0070686_100005417 3300005544 Bacteria 7068
62 Ga0070695_100153886 3300005545 Bacteria 1607
63 Ga0070696_100062745 3300005546 Bacteria 2601
64 Ga0070693_100000614 3300005547 Bacteria 15816
65 Ga0070665_100027217 3300005548 Bacteria 5758
66 Ga0070665_100040053 3300005548 Bacteria 4710
67 Ga0070665_100116861 3300005548 Bacteria 2670
68 Ga0070704_100042738 3300005549 Bacteria 3137
69 Ga0070704_100061138 3300005549 Bacteria 2694
70 Ga0068855_100006232 3300005563 Bacteria 14538
71 Ga0068855_100008681 3300005563 Bacteria 12282
72 Ga0068855_100034454 3300005563 Bacteria 6038
73 Ga0068855_100116964 3300005563 Bacteria 3055
74 Ga0068855_100379057 3300005563 Bacteria 1553
75 Ga0068857_100046384 3300005577 Bacteria 3856
76 Ga0068854_100071458 3300005578 Bacteria 2539
77 Ga0068856_100009768 3300005614 Bacteria 9324
78 Ga0068856_100036273 3300005614 Bacteria 4834
79 Ga0068856_100274304 3300005614 Bacteria 1703
80 Ga0068852_100022556 3300005616 Bacteria 5050
81 Ga0068852_100028698 3300005616 Bacteria 4559
82 Ga0068859_100000254 3300005617 Bacteria 52931
83 Ga0068864_100000124 3300005618 Bacteria 75383
84 Ga0068864_100003677 3300005618 Bacteria 12670
85 Ga0068861_100035001 3300005719 Bacteria 3717
86 Ga0068863_100012758 3300005841 Bacteria 8104
87 Ga0068863_100041936 3300005841 Bacteria 4349
88 Ga0068863_100058574 3300005841 Bacteria 3645
89 Ga0068858_100000022 3300005842 Bacteria 169718
90 Ga0068858_100000203 3300005842 Bacteria 63930
91 Ga0068858_100024569 3300005842 Bacteria 5614
92 Ga0068860_100055465 3300005843 Bacteria 3767
93 Ga0068860_100074848 3300005843 Bacteria 3221
94 Ga0068860_100139181 3300005843 Bacteria 2332
95 Ga0075363_100007251 3300006048 Bacteria 5084
96 Ga0075363_100049168 3300006048 Bacteria 2245
97 Ga0070712_100064762 3300006175 Bacteria 2593
98 Ga0075367_10137986 3300006178 Bacteria 1509
99 Ga0097621_100022940 3300006237 Bacteria 4850
100 Ga0097621_100061839 3300006237 Bacteria 3072
101 Ga0097621_100071325 3300006237 Bacteria 2870
102 Ga0068871_100002257 3300006358 Bacteria 13105
103 Ga0075428_100016727 3300006844 Bacteria 8098
104 Ga0075433_10026512 3300006852 Bacteria 4907
105 Ga0075433_10173695 3300006852 Bacteria 1917
106 Ga0075434_100018036 3300006871 Bacteria 6810
107 Ga0075434_100039203 3300006871 Bacteria 4694
108 Ga0075434_100050982 3300006871 Bacteria 4111
109 Ga0075434_100117063 3300006871 Bacteria 2678
110 Ga0075429_100081567 3300006880 Bacteria 2820
111 Ga0075436_100093290 3300006914 Bacteria 2093
112 Ga0075436_100105739 3300006914 Bacteria 1963
113 Ga0097620_100000254 3300006931 Bacteria 52931
114 Ga0075435_100108501 3300007076 Bacteria 2306
115 Ga0075435_100109009 3300007076 Bacteria 2301
116 Ga0105244_10009635 3300009036 Bacteria 5918
117 Ga0105244_10081138 3300009036 Bacteria 1605
118 Ga0105240_10012185 3300009093 Bacteria 11898
119 Ga0105240_10014954 3300009093 Bacteria 10573
120 Ga0105240_10026698 3300009093 Bacteria 7575
121 Ga0105240_10027543 3300009093 Bacteria 7438
122 Ga0105240_10040270 3300009093 Bacteria 5978
123 Ga0105240_10191971 3300009093 Bacteria 2401
124 Ga0105240_10287330 3300009093 Bacteria 1887
125 Ga0111539_10218267 3300009094 Bacteria 2221
126 Ga0105245_10050924 3300009098 Bacteria 3712
127 Ga0105247_10000313 3300009101 Bacteria 43580
128 Ga0114129_10031994 3300009147 Bacteria 7436
129 Ga0114129_10037597 3300009147 Bacteria 6834
130 Ga0114129_10217668 3300009147 Bacteria 2578
131 Ga0114129_10290750 3300009147 Bacteria 2181
132 Ga0105243_10093281 3300009148 Bacteria 2484
133 Ga0105241_10016625 3300009174 Bacteria 5399
134 Ga0105241_10125476 3300009174 Bacteria 2072
135 Ga0105242_10024261 3300009176 Bacteria 4788
136 Ga0105242_10129482 3300009176 Bacteria 2176
137 Ga0105248_10002999 3300009177 Bacteria 18723
138 Ga0105248_10009725 3300009177 Bacteria 10590
139 Ga0105248_10028456 3300009177 Bacteria 6225
140 Ga0105248_10077490 3300009177 Bacteria 3737
141 Ga0105237_10010820 3300009545 Bacteria 9682
142 Ga0105237_10137386 3300009545 Bacteria 2439
143 Ga0105237_10143459 3300009545 Bacteria 2382
144 Ga0105237_10239771 3300009545 Bacteria 1814
145 Ga0105238_10016029 3300009551 Bacteria 7580
146 Ga0105238_10017785 3300009551 Bacteria 7227
147 Ga0105249_10071698 3300009553 Bacteria 3201
148 Ga0105249_10109336 3300009553 Bacteria 2611
149 Ga0105249_10368148 3300009553 Bacteria 1460
150 Ga0105239_10018971 3300010375 Bacteria 7602
151 Ga0105239_10051952 3300010375 Bacteria 4493
152 Ga0105239_10163782 3300010375 Bacteria 2486
153 Ga0105246_10082796 3300011119 Bacteria 2291
154 Ga0105246_10215816 3300011119 Bacteria 1500
155 Ga0157371_10118037 3300013102 Bacteria 1886
156 Ga0157370_10002401 3300013104 Bacteria 22574
157 Ga0157370_10024486 3300013104 Bacteria 5979
158 Ga0157369_10016149 3300013105 Bacteria 8404
159 Ga0157369_10057502 3300013105 Bacteria 4196
160 Ga0157378_10141059 3300013297 Bacteria 2238
161 Ga0157378_10228805 3300013297 Bacteria 1771
162 Ga0163162_10002725 3300013306 Bacteria 16757
163 Ga0157375_10004870 3300013308 Bacteria 11664
164 Ga0163163_10086144 3300014325 Unclassified 3150
165 Ga0157380_10005633 3300014326 Bacteria 8751
166 Ga0157380_10038216 3300014326 Bacteria 3726
167 Ga0157379_10052055 3300014968 Bacteria 3656
168 Ga0157379_10199639 3300014968 Bacteria 1809
169 Ga0206353_11325052 3300020082 Bacteria 6972
170 Ga0209436_100271 3300025208 Bacteria 23736
171 Ga0209563_100007 3300025230 Bacteria 1579402
172 Ga0209677_104952 3300025253 Bacteria 3628
173 Ga0209565_1003978 3300025263 Bacteria 4615
174 Ga0209565_1005218 3300025263 Bacteria 3810
175 Ga0209455_1000589 3300025272 Bacteria 23557
176 Ga0209130_1000556 3300025284 Bacteria 37029
177 Ga0209675_1001607 3300025291 Bacteria 12735
178 Ga0209025_1000422 3300025294 Bacteria 84434
179 Ga0209564_1000852 3300025295 Bacteria 40733
180 Ga0209758_1005688 3300025297 Bacteria 9422
181 Ga0209050_1000226 3300025298 Bacteria 124227
182 Ga0209256_1001985 3300025299 Bacteria 18406
183 Ga0207426_1000133 3300025302 Bacteria 206783
184 Ga0207696_1019337 3300025711 Bacteria 2220
185 Ga0207655_1000302 3300025728 Bacteria 74492
186 Ga0207713_1008178 3300025735 Bacteria 6052
187 Ga0207710_10001182 3300025900 Bacteria 13268
188 Ga0207647_10027339 3300025904 Bacteria 3719
189 Ga0207699_10006385 3300025906 Bacteria 5703
190 Ga0207699_10073001 3300025906 Bacteria 2103
191 Ga0207705_10015761 3300025909 Bacteria 5427
192 Ga0207705_10089576 3300025909 Bacteria 2252
193 Ga0207705_10162894 3300025909 Bacteria 1676
194 Ga0207654_10000803 3300025911 Bacteria 17284
195 Ga0207695_10001543 3300025913 Bacteria 37956
196 Ga0207695_10004160 3300025913 Bacteria 19870
197 Ga0207695_10012469 3300025913 Bacteria 10202
198 Ga0207695_10017237 3300025913 Bacteria 8412
199 Ga0207695_10110144 3300025913 Bacteria 2734
200 Ga0207663_10007869 3300025916 Bacteria 5555
201 Ga0207657_10005977 3300025919 Bacteria 12665
202 Ga0207657_10041344 3300025919 Bacteria 4077
203 Ga0207649_10000182 3300025920 Bacteria 51148
204 Ga0207649_10013314 3300025920 Bacteria 4589
205 Ga0207652_10016504 3300025921 Bacteria 6031
206 Ga0207646_10038070 3300025922 Unclassified 4334
207 Ga0207681_10273368 3300025923 Bacteria 1327
208 Ga0207694_10004671 3300025924 Bacteria 10665
209 Ga0207650_10004559 3300025925 Bacteria 9472
210 Ga0207659_10097937 3300025926 Bacteria 2204
211 Ga0207687_10080001 3300025927 Bacteria 2358
212 Ga0207700_10119817 3300025928 Bacteria 2132
213 Ga0207664_10164136 3300025929 Bacteria 1896
214 Ga0207644_10002358 3300025931 Bacteria 12191
215 Ga0207644_10039779 3300025931 Bacteria 3320
216 Ga0207690_10011697 3300025932 Bacteria 5247
217 Ga0207690_10027053 3300025932 Bacteria 3621
218 Ga0207686_10016963 3300025934 Bacteria 4094
219 Ga0207691_10010599 3300025940 Bacteria 8840
220 Ga0207691_10157268 3300025940 Bacteria 1995
221 Ga0207711_10020200 3300025941 Bacteria 5550
222 Ga0207689_10029785 3300025942 Bacteria 4553
223 Ga0207679_10026681 3300025945 Unclassified 3986
224 Ga0207667_10011187 3300025949 Bacteria 10445
225 Ga0207667_10019902 3300025949 Bacteria 7479
226 Ga0207667_10023940 3300025949 Bacteria 6717
227 Ga0207668_10039681 3300025972 Bacteria 3172
228 Ga0207658_10004364 3300025986 Bacteria 9837
229 Ga0207658_10019967 3300025986 Bacteria 4637
230 Ga0207658_10030322 3300025986 Bacteria 3828
231 Ga0207677_10021441 3300026023 Bacteria 3948
232 Ga0207703_10000154 3300026035 Bacteria 79176
233 Ga0207703_10001177 3300026035 Bacteria 24658
234 Ga0207703_10010146 3300026035 Bacteria 7384
235 Ga0207703_10054184 3300026035 Unclassified 3261
236 Ga0207639_10201974 3300026041 Bacteria 1705
237 Ga0207678_10006866 3300026067 Bacteria 10095
238 Ga0207678_10035073 3300026067 Bacteria 4368
239 Ga0207708_10025157 3300026075 Bacteria 4502
240 Ga0207702_10000005 3300026078 Bacteria 420296
241 Ga0207702_10005748 3300026078 Bacteria 10800
242 Ga0207702_10075834 3300026078 Bacteria 2905
243 Ga0207641_10010419 3300026088 Bacteria 7639
244 Ga0207641_10031087 3300026088 Bacteria 4427
245 Ga0207648_10020125 3300026089 Bacteria 6017
246 Ga0207648_10037177 3300026089 Bacteria 4288
247 Ga0207648_10233850 3300026089 Bacteria 1635
248 Ga0207676_10000147 3300026095 Bacteria 61708
249 Ga0207676_10014491 3300026095 Bacteria 5674
250 Ga0207674_10011138 3300026116 Bacteria 10114
251 Ga0207674_10011424 3300026116 Bacteria 9979
252 Ga0207674_10015857 3300026116 Bacteria 8261
253 Ga0207675_100004679 3300026118 Bacteria 13176
254 Ga0207675_100077241 3300026118 Bacteria 3119
255 Ga0207698_10001935 3300026142 Bacteria 12149
256 Ga0207698_10005706 3300026142 Bacteria 7710
257 Ga0209983_1004988 3300027665 Bacteria 2771
258 Ga0268266_10000797 3300028379 Bacteria 41969
259 Ga0265337_1004722 3300028556 Bacteria 5597
260 Ga0265323_10012447 3300028653 Bacteria 3408
261 Ga0265336_10000125 3300028666 Bacteria 57377
262 Ga0265338_10000085 3300028800 Bacteria 175080
263 Ga0265328_10000033 3300031239 Bacteria 99507
264 Ga0265325_10064277 3300031241 Bacteria 1855
265 Ga0265329_10033027 3300031242 Bacteria 1674
266 Ga0265331_10000985 3300031250 Bacteria 22436
267 Ga0265331_10008824 3300031250 Bacteria 5708
268 Ga0265327_10000732 3300031251 Bacteria 51255
269 Ga0265327_10001073 3300031251 Bacteria 38121
270 Ga0265327_10003474 3300031251 Bacteria 14996
271 Ga0265327_10030504 3300031251 Bacteria 3047
272 Ga0265316_10000940 3300031344 Bacteria 31719
273 Ga0265316_10003226 3300031344 Bacteria 16569
274 Ga0307408_100000635 3300031548 Bacteria 29615
275 Ga0265313_10082319 3300031595 Bacteria 1459
276 Ga0316576_10014728 3300031727 Bacteria 5229
277 Ga0307516_10172558 3300031730 Bacteria 1902
278 Ga0307413_10041634 3300031824 Bacteria 2691
279 Ga0307410_10083569 3300031852 Bacteria 2249
280 Ga0307412_10043816 3300031911 Bacteria 2917
281 Ga0307409_100062999 3300031995 Bacteria 2906
282 Ga0307409_100316197 3300031995 Bacteria 1459
283 Ga0307416_100152503 3300032002 Bacteria 2122
284 Ga0307414_10031614 3300032004 Bacteria 3475
285 Ga0316583_10008031 3300032133 Bacteria 3802
286 Ga0373936_0042858 3300035113 Bacteria 1817
287 Ga0373955_0101808 3300035172 Bacteria 1650
288 Ga0316574_0053394 3300035398 Unclassified 2523
289 Ga0373931_0181794 3300035691 Bacteria 1246
290 Ga0373935_0002685 3300035692 Bacteria 10236
291 Ga0373927_0000423 3300035695 Bacteria 32523
292 Ga0373933_0241361 3300035724 Unclassified 1162
293 Ga0373947_0097561 3300035725 Bacteria 1842
294 Ga0373947_0212271 3300035725 Bacteria 1270
295 Ga0373937_0029822 3300036401 Bacteria 4941
296 Ga0373937_0045373 3300036401 Bacteria 4016
297 Ga0373937_0094244 3300036401 Bacteria 2776
298 Ga0373925_0004073 3300037068 Bacteria 11101
299 Ga0373925_0012595 3300037068 Bacteria 6128
300 Ga0395899_0001563 3300037312 Bacteria 19282
301 Ga0395899_0002465 3300037312 Bacteria 15014
302 Ga0395899_0006295 3300037312 Bacteria 9185
303 Ga0395899_0044720 3300037312 Bacteria 3298
304 Ga0395899_0060459 3300037312 Bacteria 2791
305 Ga0395899_0064005 3300037312 Bacteria 2704
306 Ga0395899_0177982 3300037312 Bacteria 1494
307 Ga0395899_0198281 3300037312 Bacteria 1401
308 Ga0395900_0000261 3300037418 Bacteria 81971
309 Ga0395900_0002552 3300037418 Bacteria 19961
310 Ga0395900_0016708 3300037418 Bacteria 7486
311 Ga0395900_0070711 3300037418 Bacteria 3587
312 Ga0395900_0070805 3300037418 Bacteria 3584
313 Ga0395900_0148518 3300037418 Bacteria 2396
314 Ga0395900_0249772 3300037418 Bacteria 1775
315 Ga0395898_0265368 3300037466 Bacteria 1637
316 Ga0395905_0007129 3300037471 Bacteria 11173
317 Ga0395905_0069138 3300037471 Bacteria 3307
318 Ga0395905_0163217 3300037471 Bacteria 2093
319 Ga0395905_0306006 3300037471 Bacteria 1477
320 Ga0395901_0000174 3300038443 Bacteria 83279
321 Ga0395901_0002028 3300038443 Bacteria 20821
322 Ga0395901_0006141 3300038443 Bacteria 12170
323 Ga0436365_0340854 3300039437 Bacteria 10644
324 Ga0439435_0011159 3300042436 Bacteria 2150
325 Ga0439444_0000285 3300042437 Bacteria 5186
326 Ga0451577_0001674 3300042876 Bacteria 28622
327 Ga0451577_0067463 3300042876 Bacteria 3190
328 Ga0466969_0020981 3300044656 Unclassified 3379
329 Ga0466972_0030197 3300044658 Bacteria 2668
330 Ga0466965_0006185 3300044683 Bacteria 5416
331 Ga0466966_0000712 3300044684 Bacteria 21100
332 Ga0466966_0003657 3300044684 Bacteria 10150
333 Ga0466966_0007967 3300044684 Bacteria 7021
334 Ga0466966_0021298 3300044684 Bacteria 4257
335 Ga0466966_0069595 3300044684 Bacteria 2207
336 Ga0466966_0102167 3300044684 Bacteria 1772
337 Ga0466961_0003505 3300044693 Bacteria 9785
338 Ga0466961_0053400 3300044693 Unclassified 2578
339 Ga0466961_0057106 3300044693 Bacteria 2485
340 Ga0466964_0024145 3300044706 Bacteria 2367
341 Ga0453684_0299789 3300044712 Bacteria 1827
342 Ga0453684_0630801 3300044712 Bacteria 1171
343 Ga0466968_0009970 3300044735 Bacteria 3668
344 Ga0466960_0049678 3300044901 Bacteria 2020
345 Ga0466959_0051294 3300045049 Bacteria 3026
346 Ga0466959_0104541 3300045049 Unclassified 2025
347 Ga0451576_0000487 3300045051 Bacteria 87753
348 Ga0451576_0078641 3300045051 Bacteria 3432
349 Ga0451576_0339119 3300045051 Bacteria 1573
350 Ga0466958_0119735 3300045836 Bacteria 1647
351 Ga0495592_0015046 3300046454 Bacteria 5875
352 Ga0495603_0021934 3300046455 Bacteria 3866
353 Ga0495590_0056963 3300046457 Bacteria 1366
354 Ga0495629_0000811 3300046459 Bacteria 25275
355 Ga0495629_0067330 3300046459 Bacteria 2499
356 Ga0495629_0088334 3300046459 Bacteria 2162
357 Ga0495638_0004449 3300046460 Bacteria 10613
358 Ga0495651_0042505 3300046462 Bacteria 3529
359 Ga0495580_0000941 3300046472 Bacteria 25456
360 Ga0495580_0024473 3300046472 Bacteria 4419
361 Ga0495580_0046313 3300046472 Bacteria 3086
362 Ga0495580_0079863 3300046472 Bacteria 2281
363 Ga0495580_0139211 3300046472 Bacteria 1682
364 Ga0495582_0035033 3300046473 Bacteria 2759
365 Ga0495605_0007332 3300046474 Bacteria 6264
366 Ga0495664_0017247 3300046477 Bacteria 4126
367 Ga0495664_0063531 3300046477 Bacteria 2201
368 Ga0495594_0002509 3300046499 Bacteria 9561
369 Ga0495596_0036086 3300046500 Bacteria 1959
370 Ga0495607_0000864 3300046501 Bacteria 28383
371 Ga0495607_0007171 3300046501 Bacteria 7745
372 Ga0495583_0005563 3300046506 Bacteria 8512
373 Ga0495608_0007920 3300046511 Bacteria 7468
374 Ga0495608_0014909 3300046511 Bacteria 5394
375 Ga0495616_0012264 3300046513 Bacteria 4871
376 Ga0495616_0061763 3300046513 Bacteria 1837
377 Ga0495618_0024891 3300046514 Bacteria 3711
378 Ga0495618_0050634 3300046514 Bacteria 2624
379 Ga0495628_0056358 3300046516 Bacteria 3094
380 Ga0495630_0008935 3300046517 Bacteria 7191
381 Ga0495630_0232820 3300046517 Bacteria 1407
382 Ga0495643_0000297 3300046522 Bacteria 69703
383 Ga0495648_0009521 3300046524 Bacteria 7509
384 Ga0495648_0014734 3300046524 Bacteria 5702
385 Ga0495648_0015279 3300046524 Bacteria 5583
386 Ga0495648_0043467 3300046524 Bacteria 2816
387 Ga0495648_0081679 3300046524 Bacteria 1837
388 Ga0495666_0006258 3300046526 Bacteria 5993
389 Ga0495642_0015915 3300046528 Bacteria 2928
390 Ga0495652_0027084 3300046529 Bacteria 5054
391 Ga0495652_0223242 3300046529 Bacteria 1414
392 Ga0495665_0021341 3300046531 Bacteria 3479
393 Ga0495586_0031153 3300046535 Bacteria 2855
394 Ga0495587_0022047 3300046536 Bacteria 3924
395 Ga0495609_0000001 3300046538 Bacteria 1060094
396 Ga0495597_0000452 3300046542 Bacteria 34993
397 Ga0495645_0045979 3300046543 Bacteria 3183
398 Ga0495645_0066993 3300046543 Bacteria 2593
399 Ga0495667_0000869 3300046559 Bacteria 19529
400 Ga0495634_0016033 3300046642 Bacteria 5366
401 Ga0495625_0083058 3300046660 Bacteria 2227
402 Ga0495635_0120419 3300046663 Bacteria 1790
403 Ga0495661_0000361 3300046665 Bacteria 49232
404 Ga0495661_0000536 3300046665 Bacteria 39145
405 Ga0495661_0034167 3300046665 Bacteria 3200
406 Ga0495661_0042079 3300046665 Bacteria 2819
407 Ga0495661_0055005 3300046665 Bacteria 2387
408 Ga0495588_0000067 3300046674 Bacteria 238958
409 Ga0495588_0016286 3300046674 Bacteria 3592
410 Ga0495657_0009818 3300046675 Bacteria 7226
411 Ga0495657_0048491 3300046675 Bacteria 2865
412 Ga0495657_0121978 3300046675 Bacteria 1641
413 Ga0495599_0003108 3300046678 Bacteria 9671
414 Ga0495599_0021734 3300046678 Bacteria 4004
415 Ga0495623_0003256 3300046679 Bacteria 10724
416 Ga0495646_0029143 3300046680 Bacteria 3451
417 Ga0495671_0048616 3300046692 Bacteria 2116
418 Ga0495589_0000119 3300046794 Bacteria 73585
419 Ga0495600_0024181 3300046809 Bacteria 3909
420 Ga0495660_0031011 3300046810 Bacteria 3008
421 Ga0495581_0004044 3300047315 Bacteria 8447
422 Ga0495604_0001390 3300047317 Bacteria 19846
423 Ga0495604_0056205 3300047317 Bacteria 3030
424 Ga0495604_0079855 3300047317 Bacteria 2452
425 Ga0495674_0014809 3300047319 Bacteria 7296
426 Ga0495674_0106409 3300047319 Bacteria 2382
427 Ga0495680_0021810 3300047322 Bacteria 5352
428 Ga0495680_0033770 3300047322 Bacteria 4139
429 Ga0495680_0163593 3300047322 Bacteria 1614
430 Ga0495683_0018789 3300047323 Bacteria 3570
431 Ga0495687_000019 3300047443 Bacteria 341756
432 Ga0495687_023966 3300047443 Bacteria 2909
433 Ga0495687_025676 3300047443 Bacteria 2781
434 Ga0495675_0005909 3300047444 Bacteria 7479
435 Ga0495675_0030320 3300047444 Bacteria 3450
436 Ga0495675_0036224 3300047444 Bacteria 3147
437 Ga0495677_0000020 3300047445 Bacteria 107093
438 Ga0495684_0203650 3300047471 Bacteria 1458
439 Ga0495602_0025808 3300048088 Bacteria 5680
440 Ga0495614_0001670 3300048089 Bacteria 9676
441 Ga0495626_0000514 3300048091 Bacteria 38782
442 Ga0496102_0039670 3300048905 Bacteria 4255
443 Ga0496103_0110372 3300048906 Unclassified 1747
444 Ga0496104_0024997 3300048907 Bacteria 5502
445 Ga0496104_0070619 3300048907 Bacteria 3320
446 Ga0496104_0223105 3300048907 Bacteria 1797
447 Ga0496105_0080529 3300048908 Bacteria 2690
448 Ga0496106_0052801 3300048909 Bacteria 3068
449 Ga0496107_0007560 3300048910 Bacteria 7495
450 Ga0496107_0190055 3300048910 Bacteria 1525
451 Ga0496109_0003906 3300048912 Bacteria 12452
452 Ga0496109_0324145 3300048912 Bacteria 1454
453 Ga0496112_0005856 3300048915 Bacteria 10703
454 Ga0496113_0003839 3300048916 Bacteria 9091
455 Ga0496113_0021658 3300048916 Bacteria 4536
456 Ga0496113_0074539 3300048916 Bacteria 2587
457 Ga0496114_0075123 3300048917 Bacteria 2846
458 Ga0496114_0087875 3300048917 Bacteria 2636
459 Ga0496115_0149325 3300048918 Bacteria 1929
460 Ga0496117_0001813 3300048920 Bacteria 29024
461 Ga0496118_0002545 3300048921 Bacteria 24414
462 Ga0496119_0013300 3300048922 Bacteria 6575
463 Ga0496121_0000844 3300048924 Bacteria 55593
464 Ga0496122_0000326 3300048925 Bacteria 103567
465 Ga0496122_0002159 3300048925 Bacteria 28828
466 Ga0496122_0002956 3300048925 Bacteria 23176
467 Ga0496122_0005466 3300048925 Bacteria 15123
468 Ga0496123_0000240 3300048926 Bacteria 110383
469 Ga0496123_0000293 3300048926 Bacteria 97880
470 Ga0496123_0006252 3300048926 Bacteria 11609
471 Ga0496123_0012928 3300048926 Bacteria 7060
472 Ga0496124_0011304 3300048927 Bacteria 8936
473 Ga0496124_0082297 3300048927 Bacteria 2643
474 Ga0496124_0165825 3300048927 Bacteria 1717
475 Ga0496125_0000414 3300048928 Bacteria 79745
476 Ga0496125_0001226 3300048928 Bacteria 38423
477 Ga0496125_0002781 3300048928 Bacteria 22144
478 Ga0496125_0036295 3300048928 Bacteria 4307
479 Ga0496126_0001308 3300048929 Bacteria 39693
480 Ga0496126_0163937 3300048929 Bacteria 1898
481 Ga0495682_0008643 3300049460 Bacteria 4008
482 Ga0495682_0018106 3300049460 Bacteria 2653
483 Ga0501032_0035848 3300049569 Bacteria 3389
484 Ga0501033_0202891 3300049570 Bacteria 1416
485 Ga0501034_0022205 3300049571 Bacteria 6467
486 Ga0501037_0068331 3300049573 Bacteria 2587
487 Ga0501038_0000519 3300049574 Bacteria 33842
488 Ga0501039_0007992 3300049575 Bacteria 8061
489 Ga0501040_0136796 3300049576 Bacteria 1725
490 Ga0501042_0071598 3300049578 Bacteria 2480
491 Ga0501047_0029011 3300049581 Bacteria 5337
492 Ga0501047_0140133 3300049581 Bacteria 2297
493 Ga0501047_0248817 3300049581 Unclassified 1626
494 Ga0501068_0040701 3300049584 Bacteria 2791
495 Ga0501068_0099756 3300049584 Bacteria 1799
496 Ga0501069_0024058 3300049585 Bacteria 3322
497 Ga0501070_0004115 3300049586 Bacteria 12509
498 Ga0501070_0051272 3300049586 Bacteria 3426
499 Ga0501071_0096309 3300049587 Bacteria 2178
500 Ga0501074_0000199 3300049590 Bacteria 32705
501 Ga0501079_0051354 3300049741 Bacteria 3183
502 Ga0501079_0125785 3300049741 Bacteria 1994
503 Ga0501080_0084707 3300049742 Bacteria 2945
504 Ga0501080_0116294 3300049742 Bacteria 2479
505 Ga0501081_0085848 3300049743 Bacteria 2209
506 Ga0501083_0005240 3300049744 Bacteria 9169
507 Ga0501083_0028604 3300049744 Bacteria 3841
508 Ga0501035_0117175 3300049822 Bacteria 2331
509 Ga0501044_0020154 3300049823 Bacteria 7117
510 Ga0501045_0034754 3300049824 Bacteria 3660
511 nmdc:mga00v17_92671_c1 3300050491 Bacteria 1899
512 nmdc:mga05p37_113586_c1 3300050507 Bacteria 3330
513 nmdc:mga05p37_185582_c1 3300050507 Bacteria 2529
514 nmdc:mga05p37_28488_c1 3300050507 Bacteria 6810
515 nmdc:mga05p37_9870_c1 3300050507 Bacteria 11330
516 nmdc:mga09592_71255_c1 3300050508 Bacteria 2950
517 nmdc:mga0qj67_62323_c1 3300050509 Bacteria 2964
518 nmdc:mga08y16_214782_c1 3300050511 Bacteria 1992
519 nmdc:mga08y16_343764_c1 3300050511 Bacteria 1533
520 nmdc:mga08y16_89101_c1 3300050511 Bacteria 3215
521 nmdc:mga0n895_127117_c1 3300050512 Bacteria 2573
522 nmdc:mga0n895_127494_c1 3300050512 Bacteria 2569
523 nmdc:mga0n895_180667_c1 3300050512 Bacteria 2141
524 nmdc:mga0n895_191006_c1 3300050512 Bacteria 2079
525 nmdc:mga0rr50_166371_c1 3300050513 Bacteria 1793
526 nmdc:mga0rr50_39097_c1 3300050513 Bacteria 3439
527 nmdc:mga0rr50_97732_c1 3300050513 Bacteria 2300
528 nmdc:mga08x19_108432_c1 3300050514 Bacteria 1850
529 nmdc:mga0a205_16300_c1 3300050515 Bacteria 6958
530 nmdc:mga0a205_19527_c1 3300050515 Bacteria 3113
531 nmdc:mga0a205_89202_c1 3300050515 Bacteria 2981
532 Ga0495601_0002202 3300053077 Bacteria 10973
533 Ga0495595_0023116 3300053084 Bacteria 2734
534 Ga0500555_032578 3300053103 Bacteria 1472
535 Ga0500556_0005700 3300053104 Bacteria 3521
536 Ga0500616_0058356 3300053153 Bacteria 2007
537 Ga0500622_0003513 3300053156 Bacteria 10394
538 Ga0500645_003049 3300053730 Bacteria 7048
539 Ga0501082_0064146 3300060353 Bacteria 3163
540 Ga0501082_0074299 3300060353 Bacteria 2928

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10003474 Ga0265327_1000347413 340
2 3300048905 Ga0496102_0039670 Ga0496102_0039670_20_1060 345
3 3300050511 nmdc:mga08y16_89101_c1 nmdc:mga08y16_89101_c1_495_1739 345
4 3300035725 Ga0373947_0212271 Ga0373947_0212271_24_1070 348
5 3300044656 Ga0466969_0020981 Ga0466969_0020981_1685_2818 356
6 3300044684 Ga0466966_0007967 Ga0466966_0007967_150_1283 356
7 3300044693 Ga0466961_0053400 Ga0466961_0053400_77_1210 356
8 3300044712 Ga0453684_0630801 Ga0453684_0630801_23_1138 357
9 3300046516 Ga0495628_0056358 Ga0495628_0056358_1975_3054 357
10 iso_pu_bacteria 2902682994 2902691128 357
11 3300027665 Ga0209983_1004988 Ga0209983_10049883 359
12 3300046477 Ga0495664_0063531 Ga0495664_0063531_23_1111 360
13 3300031250 Ga0265331_10008824 Ga0265331_100088243 361
14 3300026142 Ga0207698_10001935 Ga0207698_1000193510 363
15 3300047443 Ga0495687_025676 Ga0495687_025676_1625_2740 364
16 3300049460 Ga0495682_0008643 Ga0495682_0008643_1807_2922 364
17 3300042436 Ga0439435_0011159 Ga0439435_0011159_40_1209 365
18 3300005543 Ga0070672_100143098 Ga0070672_1001430982 366
19 3300025940 Ga0207691_10157268 Ga0207691_101572682 366
20 3300025906 Ga0207699_10006385 Ga0207699_100063856 367
21 3300032133 Ga0316583_10008031 Ga0316583_100080313 367
22 3300035692 Ga0373935_0002685 Ga0373935_0002685_7487_8683 367
23 3300037068 Ga0373925_0012595 Ga0373925_0012595_946_2142 367
24 3300042437 Ga0439444_0000285 Ga0439444_0000285_174_1343 367
25 3300046472 Ga0495580_0000941 Ga0495580_0000941_13673_14869 367
26 3300050515 nmdc:mga0a205_16300_c1 nmdc:mga0a205_16300_c1_1438_2616 367
27 iso_pu_bacteria 2919125081 2919130065 367
28 3300009093 Ga0105240_10014954 Ga0105240_100149547 368
29 3300010375 Ga0105239_10018971 Ga0105239_100189713 368
30 3300035725 Ga0373947_0097561 Ga0373947_0097561_163_1272 368
31 iso_pu_bacteria 2917832318 2917834651 368
32 3300005329 Ga0070683_100238747 Ga0070683_1002387472 369
33 3300005437 Ga0070710_10061387 Ga0070710_100613872 369
34 3300031239 Ga0265328_10000033 Ga0265328_1000003318 369
35 3300031250 Ga0265331_10000985 Ga0265331_100009855 369
36 3300031251 Ga0265327_10030504 Ga0265327_100305042 369
37 3300031344 Ga0265316_10003226 Ga0265316_100032261 369
38 3300035398 Ga0316574_0053394 Ga0316574_0053394_1383_2495 369
39 3300035724 Ga0373933_0241361 Ga0373933_0241361_10_1137 369
40 3300046499 Ga0495594_0002509 Ga0495594_0002509_1108_2223 369
41 3300048909 Ga0496106_0052801 Ga0496106_0052801_417_1694 369
42 3300048912 Ga0496109_0324145 Ga0496109_0324145_76_1353 369
43 3300048917 Ga0496114_0075123 Ga0496114_0075123_51_1328 369
44 3300049581 Ga0501047_0140133 Ga0501047_0140133_818_2002 369
45 3300050513 nmdc:mga0rr50_97732_c1 nmdc:mga0rr50_97732_c1_106_1245 369
46 3300005435 Ga0070714_100108572 Ga0070714_1001085721 370
47 3300009174 Ga0105241_10016625 Ga0105241_100166252 370
48 3300031242 Ga0265329_10033027 Ga0265329_100330272 370
49 3300037312 Ga0395899_0044720 Ga0395899_0044720_1392_2510 370
50 3300045049 Ga0466959_0104541 Ga0466959_0104541_447_1622 370
51 3300050507 nmdc:mga05p37_185582_c1 nmdc:mga05p37_185582_c1_1034_2152 370
52 3300050515 nmdc:mga0a205_89202_c1 nmdc:mga0a205_89202_c1_989_2107 370
53 iso_pu_bacteria 2510065053 2510283502 370
54 iso_pu_bacteria 2510065055 2510292671 370
55 iso_pu_bacteria 2510065058 2510311762 370
56 iso_pu_bacteria 2512047030 2512344828 370
57 iso_pu_bacteria 2515154122 2515682603 370
58 iso_pu_bacteria 2885270888 2885279875 370
59 3300036401 Ga0373937_0029822 Ga0373937_0029822_312_1430 371
60 3300046543 Ga0495645_0066993 Ga0495645_0066993_1008_2126 371
61 3300005335 Ga0070666_10074119 Ga0070666_100741192 372
62 3300005355 Ga0070671_100000127 Ga0070671_1000001276 372
63 3300005617 Ga0068859_100000254 Ga0068859_10000025424 372
64 3300005841 Ga0068863_100012758 Ga0068863_1000127584 372
65 3300005842 Ga0068858_100000203 Ga0068858_1000002037 372
66 3300005843 Ga0068860_100055465 Ga0068860_1000554653 372
67 3300006931 Ga0097620_100000254 Ga0097620_10000025418 372
68 3300009101 Ga0105247_10000313 Ga0105247_100003137 372
69 3300009177 Ga0105248_10028456 Ga0105248_100284562 372
70 3300009553 Ga0105249_10071698 Ga0105249_100716982 372
71 3300014968 Ga0157379_10052055 Ga0157379_100520553 372
72 3300025900 Ga0207710_10001182 Ga0207710_100011828 372
73 3300025931 Ga0207644_10039779 Ga0207644_100397791 372
74 3300025934 Ga0207686_10016963 Ga0207686_100169632 372
75 3300025986 Ga0207658_10004364 Ga0207658_100043643 372
76 3300026035 Ga0207703_10000154 Ga0207703_1000015450 372
77 3300026088 Ga0207641_10010419 Ga0207641_100104195 372
78 3300046513 Ga0495616_0061763 Ga0495616_0061763_101_1228 372
79 3300047471 Ga0495684_0203650 Ga0495684_0203650_307_1437 372
80 3300048907 Ga0496104_0024997 Ga0496104_0024997_508_1635 372
81 3300048922 Ga0496119_0013300 Ga0496119_0013300_5021_6148 372
82 3300048924 Ga0496121_0000844 Ga0496121_0000844_40031_41263 372
83 3300048928 Ga0496125_0002781 Ga0496125_0002781_13893_15125 372
84 3300049578 Ga0501042_0071598 Ga0501042_0071598_462_1601 372
85 3300049584 Ga0501068_0099756 Ga0501068_0099756_23_1162 372
86 3300049741 Ga0501079_0125785 Ga0501079_0125785_292_1431 372
87 3300049743 Ga0501081_0085848 Ga0501081_0085848_744_1883 372
88 3300049744 Ga0501083_0028604 Ga0501083_0028604_741_1880 372
89 3300049824 Ga0501045_0034754 Ga0501045_0034754_2002_3141 372
90 3300060353 Ga0501082_0064146 Ga0501082_0064146_1501_2640 372
91 3300005438 Ga0070701_10032652 Ga0070701_100326523 373
92 3300005440 Ga0070705_100017394 Ga0070705_1000173943 373
93 3300005444 Ga0070694_100023632 Ga0070694_1000236322 373
94 3300005545 Ga0070695_100153886 Ga0070695_1001538862 373
95 3300005546 Ga0070696_100062745 Ga0070696_1000627453 373
96 3300005549 Ga0070704_100061138 Ga0070704_1000611381 373
97 3300005843 Ga0068860_100074848 Ga0068860_1000748482 373
98 3300026116 Ga0207674_10015857 Ga0207674_100158575 373
99 3300046517 Ga0495630_0232820 Ga0495630_0232820_63_1190 373
100 3300046524 Ga0495648_0081679 Ga0495648_0081679_648_1775 373
101 3300046529 Ga0495652_0223242 Ga0495652_0223242_63_1190 373
102 3300046665 Ga0495661_0055005 Ga0495661_0055005_19_1146 373
103 3300048906 Ga0496103_0110372 Ga0496103_0110372_23_1228 373
104 3300048929 Ga0496126_0163937 Ga0496126_0163937_86_1219 373
105 3300005327 Ga0070658_10054592 Ga0070658_100545922 374
106 3300005530 Ga0070679_100060057 Ga0070679_1000600572 374
107 3300025909 Ga0207705_10089576 Ga0207705_100895762 374
108 3300025921 Ga0207652_10016504 Ga0207652_100165042 374
109 3300046454 Ga0495592_0015046 Ga0495592_0015046_638_1768 374
110 3300046472 Ga0495580_0079863 Ga0495580_0079863_727_1857 374
111 3300046477 Ga0495664_0017247 Ga0495664_0017247_2385_3515 374
112 3300046500 Ga0495596_0036086 Ga0495596_0036086_588_1718 374
113 3300046514 Ga0495618_0024891 Ga0495618_0024891_1361_2491 374
114 3300046517 Ga0495630_0008935 Ga0495630_0008935_3047_4177 374
115 3300046526 Ga0495666_0006258 Ga0495666_0006258_3046_4176 374
116 3300046535 Ga0495586_0031153 Ga0495586_0031153_922_2052 374
117 3300046680 Ga0495646_0029143 Ga0495646_0029143_961_2091 374
118 3300046809 Ga0495600_0024181 Ga0495600_0024181_2273_3403 374
119 3300047315 Ga0495581_0004044 Ga0495581_0004044_4499_5629 374
120 3300047317 Ga0495604_0056205 Ga0495604_0056205_1361_2491 374
121 3300047319 Ga0495674_0106409 Ga0495674_0106409_984_2114 374
122 3300047322 Ga0495680_0021810 Ga0495680_0021810_3002_4132 374
123 3300047323 Ga0495683_0018789 Ga0495683_0018789_50_1180 374
124 3300047444 Ga0495675_0030320 Ga0495675_0030320_960_2090 374
125 3300048089 Ga0495614_0001670 Ga0495614_0001670_4881_6011 374
126 3300005435 Ga0070714_100075316 Ga0070714_1000753164 375
127 3300025929 Ga0207664_10164136 Ga0207664_101641361 375
128 3300039437 Ga0436365_0340854 Ga0436365_0340854_1210_2403 375
129 3300042876 Ga0451577_0001674 Ga0451577_0001674_4282_5454 375
130 3300044693 Ga0466961_0003505 Ga0466961_0003505_210_1349 375
131 3300046524 Ga0495648_0043467 Ga0495648_0043467_93_1226 375
132 3300049581 Ga0501047_0248817 Ga0501047_0248817_13_1458 375
133 iso_pu_bacteria 2510065045 2510252777 375
134 3300006914 Ga0075436_100105739 Ga0075436_1001057392 376
135 3300031824 Ga0307413_10041634 Ga0307413_100416343 376
136 3300031852 Ga0307410_10083569 Ga0307410_100835692 376
137 3300031995 Ga0307409_100062999 Ga0307409_1000629992 376
138 3300032004 Ga0307414_10031614 Ga0307414_100316142 376
139 3300044735 Ga0466968_0009970 Ga0466968_0009970_32_1174 376
140 iso_pu_bacteria 2842454564 2842461740 376
141 3300005327 Ga0070658_10073956 Ga0070658_100739562 377
142 3300009093 Ga0105240_10287330 Ga0105240_102873302 377
143 3300013104 Ga0157370_10002401 Ga0157370_100024011 377
144 3300046459 Ga0495629_0088334 Ga0495629_0088334_663_1889 377
145 3300047322 Ga0495680_0163593 Ga0495680_0163593_298_1524 377
146 3300049742 Ga0501080_0116294 Ga0501080_0116294_117_1334 377
147 3300005614 Ga0068856_100274304 Ga0068856_1002743042 378
148 3300009094 Ga0111539_10218267 Ga0111539_102182672 378
149 3300010375 Ga0105239_10163782 Ga0105239_101637822 378
150 3300025923 Ga0207681_10273368 Ga0207681_102733682 378
151 3300025972 Ga0207668_10039681 Ga0207668_100396813 378
152 3300035113 Ga0373936_0042858 Ga0373936_0042858_14_1252 378
153 3300037418 Ga0395900_0148518 Ga0395900_0148518_1116_2327 378
154 3300046474 Ga0495605_0007332 Ga0495605_0007332_2416_3561 378
155 3300046501 Ga0495607_0000864 Ga0495607_0000864_26283_27428 378
156 3300046513 Ga0495616_0012264 Ga0495616_0012264_3158_4303 378
157 3300046538 Ga0495609_0000001 Ga0495609_0000001_199483_200628 378
158 3300046665 Ga0495661_0000361 Ga0495661_0000361_42055_43200 378
159 3300046794 Ga0495589_0000119 Ga0495589_0000119_30102_31247 378
160 3300047443 Ga0495687_000019 Ga0495687_000019_199483_200628 378
161 3300047445 Ga0495677_0000020 Ga0495677_0000020_28683_29828 378
162 3300048091 Ga0495626_0000514 Ga0495626_0000514_13978_15123 378
163 3300050511 nmdc:mga08y16_343764_c1 nmdc:mga08y16_343764_c1_291_1472 378
164 3300005331 Ga0070670_100077674 Ga0070670_1000776742 379
165 3300005338 Ga0068868_100075406 Ga0068868_1000754063 379
166 3300005354 Ga0070675_100030307 Ga0070675_1000303072 379
167 3300005355 Ga0070671_100053067 Ga0070671_1000530673 379
168 3300005459 Ga0068867_100017620 Ga0068867_1000176203 379
169 3300009147 Ga0114129_10031994 Ga0114129_100319949 379
170 3300032002 Ga0307416_100152503 Ga0307416_1001525032 379
171 3300045051 Ga0451576_0078641 Ga0451576_0078641_893_2080 379
172 3300046457 Ga0495590_0056963 Ga0495590_0056963_199_1347 379
173 3300046459 Ga0495629_0000811 Ga0495629_0000811_9795_10943 379
174 3300046462 Ga0495651_0042505 Ga0495651_0042505_2043_3191 379
175 3300046678 Ga0495599_0021734 Ga0495599_0021734_2408_3556 379
176 3300046679 Ga0495623_0003256 Ga0495623_0003256_5518_6666 379
177 3300047317 Ga0495604_0001390 Ga0495604_0001390_13623_14771 379
178 3300047322 Ga0495680_0033770 Ga0495680_0033770_2305_3453 379
179 3300047444 Ga0495675_0005909 Ga0495675_0005909_1604_2752 379
180 3300048088 Ga0495602_0025808 Ga0495602_0025808_449_1597 379
181 3300050507 nmdc:mga05p37_113586_c1 nmdc:mga05p37_113586_c1_626_1771 379
182 3300009176 Ga0105242_10024261 Ga0105242_100242614 380
183 3300045051 Ga0451576_0000487 Ga0451576_0000487_12236_13402 380
184 3300048907 Ga0496104_0070619 Ga0496104_0070619_337_1491 380
185 3300048908 Ga0496105_0080529 Ga0496105_0080529_571_1725 380
186 3300049586 Ga0501070_0051272 Ga0501070_0051272_1627_2823 380
187 3300049742 Ga0501080_0084707 Ga0501080_0084707_540_1736 380
188 3300050513 nmdc:mga0rr50_166371_c1 nmdc:mga0rr50_166371_c1_601_1749 380
189 3300003354 JGI25160J50197_1005372 JGI25160J50197_10053724 381
190 3300009147 Ga0114129_10290750 Ga0114129_102907503 381
191 3300025302 Ga0207426_1000133 Ga0207426_100013312 381
192 3300028556 Ga0265337_1004722 Ga0265337_10047228 381
193 3300044684 Ga0466966_0102167 Ga0466966_0102167_108_1307 381
194 3300003323 rootH1_10221365 rootH1_102213652 382
195 3300005614 Ga0068856_100009768 Ga0068856_1000097686 382
196 3300009093 Ga0105240_10012185 Ga0105240_100121855 382
197 3300009553 Ga0105249_10368148 Ga0105249_103681482 382
198 3300025913 Ga0207695_10110144 Ga0207695_101101441 382
199 3300025932 Ga0207690_10011697 Ga0207690_100116972 382
200 3300026078 Ga0207702_10005748 Ga0207702_100057483 382
201 3300031995 Ga0307409_100316197 Ga0307409_1003161971 382
202 3300009036 Ga0105244_10009635 Ga0105244_100096353 383
203 3300025711 Ga0207696_1019337 Ga0207696_10193372 383
204 3300025728 Ga0207655_1000302 Ga0207655_100030263 383
205 3300025735 Ga0207713_1008178 Ga0207713_10081782 383
206 3300031251 Ga0265327_10000732 Ga0265327_100007327 383
207 3300031344 Ga0265316_10000940 Ga0265316_1000094015 383
208 3300031730 Ga0307516_10172558 Ga0307516_101725582 383
209 3300046522 Ga0495643_0000297 Ga0495643_0000297_66332_67534 383
210 3300048917 Ga0496114_0087875 Ga0496114_0087875_216_1418 383
211 3300048920 Ga0496117_0001813 Ga0496117_0001813_25716_26918 383
212 3300048921 Ga0496118_0002545 Ga0496118_0002545_2031_3233 383
213 3300048927 Ga0496124_0011304 Ga0496124_0011304_2148_3350 383
214 3300048928 Ga0496125_0036295 Ga0496125_0036295_2600_3802 383
215 iso_pu_bacteria 2854601825 2854602410 383
216 3300020082 Ga0206353_11325052 Ga0206353_113250524 384
217 3300031911 Ga0307412_10043816 Ga0307412_100438163 384
218 3300048925 Ga0496122_0002159 Ga0496122_0002159_25479_26681 384
219 3300048926 Ga0496123_0000240 Ga0496123_0000240_2148_3350 384
220 3300050509 nmdc:mga0qj67_62323_c1 nmdc:mga0qj67_62323_c1_564_1733 384
221 3300053103 Ga0500555_032578 Ga0500555_032578_289_1443 384
222 3300053153 Ga0500616_0058356 Ga0500616_0058356_63_1217 384
223 iso_pu_bacteria 2515154123 2515690581 384
224 iso_pu_bacteria 2547132103 2547371098 384
225 iso_pu_bacteria 2843690924 2843692227 384
226 iso_pu_bacteria 8011350971 8011353139 384
227 3300003316 rootH1_10028768 rootH1_100287687 385
228 3300005434 Ga0070709_10023928 Ga0070709_100239282 385
229 3300005436 Ga0070713_100007605 Ga0070713_1000076052 385
230 3300006844 Ga0075428_100016727 Ga0075428_1000167278 385
231 3300006880 Ga0075429_100081567 Ga0075429_1000815673 385
232 3300025906 Ga0207699_10073001 Ga0207699_100730012 385
233 3300025928 Ga0207700_10119817 Ga0207700_101198172 385
234 3300037471 Ga0395905_0306006 Ga0395905_0306006_136_1317 385
235 3300050511 nmdc:mga08y16_214782_c1 nmdc:mga08y16_214782_c1_349_1536 385
236 3300005458 Ga0070681_10185841 Ga0070681_101858412 386
237 3300005530 Ga0070679_100139494 Ga0070679_1001394942 386
238 3300026035 Ga0207703_10010146 Ga0207703_100101465 386
239 3300038443 Ga0395901_0002028 Ga0395901_0002028_6550_7734 386
240 3300049569 Ga0501032_0035848 Ga0501032_0035848_923_2083 386
241 3300049570 Ga0501033_0202891 Ga0501033_0202891_17_1177 386
242 3300049571 Ga0501034_0022205 Ga0501034_0022205_1478_2638 386
243 3300049573 Ga0501037_0068331 Ga0501037_0068331_923_2083 386
244 3300049574 Ga0501038_0000519 Ga0501038_0000519_1286_2446 386
245 3300049575 Ga0501039_0007992 Ga0501039_0007992_5518_6678 386
246 3300049823 Ga0501044_0020154 Ga0501044_0020154_4736_5896 386
247 iso_pu_bacteria 2739367865 2740030887 386
248 iso_pu_bacteria 8054002106 8054003528 386
249 iso_pu_bacteria 2984504281 2984507968 387
250 iso_pu_bacteria 8016728285 8016729860 387
251 3300003759 Ga0055525_1000105 Ga0055525_100010578 388
252 3300005518 Ga0070699_100055187 Ga0070699_1000551875 388
253 3300005563 Ga0068855_100116964 Ga0068855_1001169642 388
254 3300013297 Ga0157378_10228805 Ga0157378_102288052 388
255 3300025230 Ga0209563_100007 Ga0209563_1000071299 388
256 3300025253 Ga0209677_104952 Ga0209677_1049522 388
257 3300025909 Ga0207705_10162894 Ga0207705_101628942 388
258 3300025919 Ga0207657_10005977 Ga0207657_1000597714 388
259 3300025932 Ga0207690_10027053 Ga0207690_100270534 388
260 3300026089 Ga0207648_10233850 Ga0207648_102338502 388
261 3300037312 Ga0395899_0064005 Ga0395899_0064005_580_1764 388
262 3300037418 Ga0395900_0000261 Ga0395900_0000261_3741_4925 388
263 3300037418 Ga0395900_0070805 Ga0395900_0070805_1741_2925 388
264 3300037466 Ga0395898_0265368 Ga0395898_0265368_218_1402 388
265 3300037471 Ga0395905_0069138 Ga0395905_0069138_1567_2751 388
266 3300042876 Ga0451577_0067463 Ga0451577_0067463_240_1424 388
267 3300044684 Ga0466966_0021298 Ga0466966_0021298_2074_3258 388
268 3300044684 Ga0466966_0069595 Ga0466966_0069595_568_1752 388
269 3300044712 Ga0453684_0299789 Ga0453684_0299789_20_1204 388
270 3300045049 Ga0466959_0051294 Ga0466959_0051294_698_1882 388
271 3300045051 Ga0451576_0339119 Ga0451576_0339119_76_1260 388
272 3300046473 Ga0495582_0035033 Ga0495582_0035033_917_2098 388
273 3300046501 Ga0495607_0007171 Ga0495607_0007171_559_1743 388
274 3300046524 Ga0495648_0009521 Ga0495648_0009521_5941_7125 388
275 3300046529 Ga0495652_0027084 Ga0495652_0027084_47_1228 388
276 3300046531 Ga0495665_0021341 Ga0495665_0021341_314_1495 388
277 3300046642 Ga0495634_0016033 Ga0495634_0016033_1681_2862 388
278 3300046665 Ga0495661_0034167 Ga0495661_0034167_1452_2636 388
279 3300046665 Ga0495661_0042079 Ga0495661_0042079_895_2079 388
280 3300046674 Ga0495588_0000067 Ga0495588_0000067_62679_63863 388
281 3300046810 Ga0495660_0031011 Ga0495660_0031011_1542_2732 388
282 3300047317 Ga0495604_0079855 Ga0495604_0079855_844_2025 388
283 3300047444 Ga0495675_0036224 Ga0495675_0036224_1045_2226 388
284 3300048916 Ga0496113_0074539 Ga0496113_0074539_956_2140 388
285 3300048925 Ga0496122_0002956 Ga0496122_0002956_5501_6685 388
286 3300048926 Ga0496123_0006252 Ga0496123_0006252_10229_11413 388
287 3300048927 Ga0496124_0082297 Ga0496124_0082297_344_1528 388
288 3300048927 Ga0496124_0165825 Ga0496124_0165825_393_1586 388
289 3300005331 Ga0070670_100143551 Ga0070670_1001435511 389
290 3300005366 Ga0070659_100038694 Ga0070659_1000386941 389
291 3300005434 Ga0070709_10005586 Ga0070709_100055867 389
292 3300005435 Ga0070714_100024010 Ga0070714_1000240105 389
293 3300005547 Ga0070693_100000614 Ga0070693_1000006146 389
294 3300005563 Ga0068855_100008681 Ga0068855_10000868111 389
295 3300005841 Ga0068863_100058574 Ga0068863_1000585745 389
296 3300005842 Ga0068858_100024569 Ga0068858_1000245692 389
297 3300005843 Ga0068860_100139181 Ga0068860_1001391812 389
298 3300006175 Ga0070712_100064762 Ga0070712_1000647622 389
299 3300006237 Ga0097621_100022940 Ga0097621_1000229404 389
300 3300006237 Ga0097621_100061839 Ga0097621_1000618392 389
301 3300006358 Ga0068871_100002257 Ga0068871_1000022572 389
302 3300009093 Ga0105240_10191971 Ga0105240_101919712 389
303 3300009098 Ga0105245_10050924 Ga0105245_100509243 389
304 3300009176 Ga0105242_10129482 Ga0105242_101294822 389
305 3300009177 Ga0105248_10009725 Ga0105248_100097255 389
306 3300009553 Ga0105249_10109336 Ga0105249_101093362 389
307 3300013297 Ga0157378_10141059 Ga0157378_101410592 389
308 3300014968 Ga0157379_10199639 Ga0157379_101996392 389
309 3300025913 Ga0207695_10004160 Ga0207695_1000416019 389
310 3300025916 Ga0207663_10007869 Ga0207663_100078694 389
311 3300025927 Ga0207687_10080001 Ga0207687_100800012 389
312 3300025941 Ga0207711_10020200 Ga0207711_100202002 389
313 3300025942 Ga0207689_10029785 Ga0207689_100297854 389
314 3300025949 Ga0207667_10023940 Ga0207667_100239404 389
315 3300026088 Ga0207641_10031087 Ga0207641_100310872 389
316 3300028379 Ga0268266_10000797 Ga0268266_1000079738 389
317 3300035691 Ga0373931_0181794 Ga0373931_0181794_43_1227 389
318 3300037312 Ga0395899_0002465 Ga0395899_0002465_8694_9887 389
319 3300037418 Ga0395900_0016708 Ga0395900_0016708_4819_6012 389
320 3300037471 Ga0395905_0007129 Ga0395905_0007129_8929_10122 389
321 3300046511 Ga0495608_0007920 Ga0495608_0007920_458_1642 389
322 3300046536 Ga0495587_0022047 Ga0495587_0022047_1958_3142 389
323 3300046543 Ga0495645_0045979 Ga0495645_0045979_227_1411 389
324 3300046663 Ga0495635_0120419 Ga0495635_0120419_150_1334 389
325 3300046675 Ga0495657_0048491 Ga0495657_0048491_570_1754 389
326 3300046678 Ga0495599_0003108 Ga0495599_0003108_4519_5703 389
327 3300048918 Ga0496115_0149325 Ga0496115_0149325_668_1882 389
328 3300050515 nmdc:mga0a205_19527_c1 nmdc:mga0a205_19527_c1_495_1679 389
329 3300053077 Ga0495601_0002202 Ga0495601_0002202_2211_3395 389
330 3300053084 Ga0495595_0023116 Ga0495595_0023116_492_1676 389
331 iso_pu_bacteria 2501025502 2501079375 389
332 iso_pu_bacteria 2510917013 2511093747 389
333 iso_pu_bacteria 2883087390 2883094253 389
334 3300005535 Ga0070684_100180921 Ga0070684_1001809211 390
335 3300050507 nmdc:mga05p37_9870_c1 nmdc:mga05p37_9870_c1_6651_7967 390
336 iso_pu_bacteria 2599185240 2599743836 390
337 iso_pu_bacteria 2599185355 2600207096 390
338 iso_pu_bacteria 2617270889 2617917762 390
339 iso_pu_bacteria 2675903129 2676742379 390
340 iso_pu_bacteria 642555144 642606002 390
341 3300005468 Ga0070707_100046822 Ga0070707_1000468223 391
342 3300025922 Ga0207646_10038070 Ga0207646_100380702 391
343 3300031241 Ga0265325_10064277 Ga0265325_100642772 391
344 3300031595 Ga0265313_10082319 Ga0265313_100823192 391
345 3300037312 Ga0395899_0177982 Ga0395899_0177982_54_1247 391
346 3300044684 Ga0466966_0003657 Ga0466966_0003657_6394_7596 391
347 3300046675 Ga0495657_0121978 Ga0495657_0121978_362_1564 391
348 3300053730 Ga0500645_003049 Ga0500645_003049_4068_5267 391
349 iso_pu_bacteria 2515154189 2516023261 391
350 iso_pu_bacteria 2744054900 2746085378 391
351 iso_pu_bacteria 2744054901 2746093826 391
352 iso_pu_bacteria 2932422444 2932426207 391
353 3300005330 Ga0070690_100016759 Ga0070690_1000167593 392
354 3300005331 Ga0070670_100020645 Ga0070670_1000206453 392
355 3300005335 Ga0070666_10005581 Ga0070666_100055814 392
356 3300005339 Ga0070660_100005781 Ga0070660_1000057812 392
357 3300005344 Ga0070661_100000186 Ga0070661_10000018626 392
358 3300005344 Ga0070661_100043986 Ga0070661_1000439862 392
359 3300005355 Ga0070671_100025818 Ga0070671_1000258183 392
360 3300005364 Ga0070673_100177974 Ga0070673_1001779742 392
361 3300005367 Ga0070667_100029243 Ga0070667_1000292432 392
362 3300005455 Ga0070663_100025474 Ga0070663_1000254742 392
363 3300005535 Ga0070684_100094419 Ga0070684_1000944192 392
364 3300005543 Ga0070672_100015991 Ga0070672_1000159913 392
365 3300005544 Ga0070686_100005417 Ga0070686_1000054172 392
366 3300005548 Ga0070665_100027217 Ga0070665_1000272174 392
367 3300005563 Ga0068855_100006232 Ga0068855_1000062326 392
368 3300005563 Ga0068855_100034454 Ga0068855_1000344542 392
369 3300005577 Ga0068857_100046384 Ga0068857_1000463843 392
370 3300005614 Ga0068856_100036273 Ga0068856_1000362731 392
371 3300005616 Ga0068852_100028698 Ga0068852_1000286983 392
372 3300005618 Ga0068864_100003677 Ga0068864_1000036774 392
373 3300005841 Ga0068863_100041936 Ga0068863_1000419363 392
374 3300006048 Ga0075363_100007251 Ga0075363_1000072516 392
375 3300009093 Ga0105240_10040270 Ga0105240_100402707 392
376 3300009148 Ga0105243_10093281 Ga0105243_100932812 392
377 3300009177 Ga0105248_10002999 Ga0105248_100029992 392
378 3300009545 Ga0105237_10137386 Ga0105237_101373864 392
379 3300009551 Ga0105238_10016029 Ga0105238_100160294 392
380 3300010375 Ga0105239_10051952 Ga0105239_100519524 392
381 3300011119 Ga0105246_10082796 Ga0105246_100827962 392
382 3300011119 Ga0105246_10215816 Ga0105246_102158161 392
383 3300013104 Ga0157370_10024486 Ga0157370_100244862 392
384 3300013105 Ga0157369_10057502 Ga0157369_100575024 392
385 3300013308 Ga0157375_10004870 Ga0157375_100048705 392
386 3300014325 Ga0163163_10086144 Ga0163163_100861443 392
387 3300014326 Ga0157380_10005633 Ga0157380_100056333 392
388 3300025909 Ga0207705_10015761 Ga0207705_100157611 392
389 3300025913 Ga0207695_10012469 Ga0207695_1001246913 392
390 3300025919 Ga0207657_10041344 Ga0207657_100413444 392
391 3300025920 Ga0207649_10000182 Ga0207649_1000018228 392
392 3300025920 Ga0207649_10013314 Ga0207649_100133143 392
393 3300025924 Ga0207694_10004671 Ga0207694_1000467111 392
394 3300025925 Ga0207650_10004559 Ga0207650_100045594 392
395 3300025926 Ga0207659_10097937 Ga0207659_100979371 392
396 3300025931 Ga0207644_10002358 Ga0207644_100023588 392
397 3300025940 Ga0207691_10010599 Ga0207691_100105997 392
398 3300025945 Ga0207679_10026681 Ga0207679_100266813 392
399 3300025949 Ga0207667_10011187 Ga0207667_100111875 392
400 3300025986 Ga0207658_10019967 Ga0207658_100199672 392
401 3300026023 Ga0207677_10021441 Ga0207677_100214412 392
402 3300026035 Ga0207703_10054184 Ga0207703_100541843 392
403 3300026067 Ga0207678_10006866 Ga0207678_1000686611 392
404 3300026078 Ga0207702_10075834 Ga0207702_100758344 392
405 3300026089 Ga0207648_10020125 Ga0207648_100201255 392
406 3300026095 Ga0207676_10014491 Ga0207676_100144913 392
407 3300026116 Ga0207674_10011424 Ga0207674_100114248 392
408 3300026142 Ga0207698_10005706 Ga0207698_1000570611 392
409 3300036401 Ga0373937_0045373 Ga0373937_0045373_655_1866 392
410 3300036401 Ga0373937_0094244 Ga0373937_0094244_781_1992 392
411 3300046459 Ga0495629_0067330 Ga0495629_0067330_108_1319 392
412 3300046511 Ga0495608_0014909 Ga0495608_0014909_2134_3345 392
413 3300046514 Ga0495618_0050634 Ga0495618_0050634_113_1324 392
414 3300046559 Ga0495667_0000869 Ga0495667_0000869_8995_10206 392
415 3300046675 Ga0495657_0009818 Ga0495657_0009818_5225_6436 392
416 3300047319 Ga0495674_0014809 Ga0495674_0014809_3953_5164 392
417 3300003187 JGI25151J46595_10000180 JGI25151J46595_1000018075 393
418 3300005842 Ga0068858_100000022 Ga0068858_10000002241 393
419 3300006178 Ga0075367_10137986 Ga0075367_101379862 393
420 3300006871 Ga0075434_100018036 Ga0075434_1000180363 393
421 3300009177 Ga0105248_10077490 Ga0105248_100774904 393
422 3300025294 Ga0209025_1000422 Ga0209025_10004229 393
423 3300025297 Ga0209758_1005688 Ga0209758_10056888 393
424 3300026035 Ga0207703_10001177 Ga0207703_100011773 393
425 3300026089 Ga0207648_10037177 Ga0207648_100371773 393
426 3300031727 Ga0316576_10014728 Ga0316576_100147284 393
427 3300035172 Ga0373955_0101808 Ga0373955_0101808_287_1504 393
428 3300037312 Ga0395899_0060459 Ga0395899_0060459_1534_2733 393
429 3300037312 Ga0395899_0198281 Ga0395899_0198281_137_1336 393
430 3300037418 Ga0395900_0002552 Ga0395900_0002552_9247_10446 393
431 3300037418 Ga0395900_0249772 Ga0395900_0249772_394_1593 393
432 3300037471 Ga0395905_0163217 Ga0395905_0163217_188_1387 393
433 3300038443 Ga0395901_0000174 Ga0395901_0000174_79858_81057 393
434 3300044684 Ga0466966_0000712 Ga0466966_0000712_17872_19074 393
435 3300045836 Ga0466958_0119735 Ga0466958_0119735_197_1396 393
436 3300046455 Ga0495603_0021934 Ga0495603_0021934_1624_2832 393
437 3300046472 Ga0495580_0024473 Ga0495580_0024473_704_1912 393
438 3300046472 Ga0495580_0139211 Ga0495580_0139211_392_1600 393
439 3300046506 Ga0495583_0005563 Ga0495583_0005563_2987_4195 393
440 3300046524 Ga0495648_0014734 Ga0495648_0014734_4030_5238 393
441 3300047443 Ga0495687_023966 Ga0495687_023966_1309_2517 393
442 3300048910 Ga0496107_0007560 Ga0496107_0007560_1016_2215 393
443 3300048929 Ga0496126_0001308 Ga0496126_0001308_9273_10481 393
444 3300049460 Ga0495682_0018106 Ga0495682_0018106_329_1537 393
445 3300050508 nmdc:mga09592_71255_c1 nmdc:mga09592_71255_c1_363_1586 393
446 3300050512 nmdc:mga0n895_180667_c1 nmdc:mga0n895_180667_c1_712_1968 393
447 iso_pu_bacteria 2513237087 2513590080 393
448 iso_pu_bacteria 2844533157 2844535607 393
449 3300002739 JGI25158J39367_1001623 JGI25158J39367_10016234 394
450 3300003374 JGI25161J50226_1000762 JGI25161J50226_10007624 394
451 3300003374 JGI25161J50226_1002283 JGI25161J50226_10022832 394
452 3300003773 Ga0055537_1004952 Ga0055537_10049522 394
453 3300003773 Ga0055537_1007027 Ga0055537_10070273 394
454 3300003775 Ga0055524_1004541 Ga0055524_10045414 394
455 3300004625 Ga0055543_1000446 Ga0055543_100044615 394
456 3300005262 Ga0065165_1001563 Ga0065165_100156315 394
457 3300005438 Ga0070701_10031634 Ga0070701_100316341 394
458 3300005549 Ga0070704_100042738 Ga0070704_1000427382 394
459 3300005618 Ga0068864_100000124 Ga0068864_10000012465 394
460 3300005719 Ga0068861_100035001 Ga0068861_1000350013 394
461 3300006852 Ga0075433_10026512 Ga0075433_100265123 394
462 3300006871 Ga0075434_100050982 Ga0075434_1000509824 394
463 3300007076 Ga0075435_100109009 Ga0075435_1001090093 394
464 3300009147 Ga0114129_10217668 Ga0114129_102176684 394
465 3300013306 Ga0163162_10002725 Ga0163162_1000272514 394
466 3300014326 Ga0157380_10038216 Ga0157380_100382164 394
467 3300025208 Ga0209436_100271 Ga0209436_1002716 394
468 3300025263 Ga0209565_1003978 Ga0209565_10039782 394
469 3300025263 Ga0209565_1005218 Ga0209565_10052183 394
470 3300025284 Ga0209130_1000556 Ga0209130_100055618 394
471 3300025291 Ga0209675_1001607 Ga0209675_10016076 394
472 3300025295 Ga0209564_1000852 Ga0209564_100085224 394
473 3300025298 Ga0209050_1000226 Ga0209050_100022624 394
474 3300025299 Ga0209256_1001985 Ga0209256_100198510 394
475 3300026075 Ga0207708_10025157 Ga0207708_100251572 394
476 3300026095 Ga0207676_10000147 Ga0207676_1000014740 394
477 3300026118 Ga0207675_100004679 Ga0207675_1000046799 394
478 3300026118 Ga0207675_100077241 Ga0207675_1000772413 394
479 3300031548 Ga0307408_100000635 Ga0307408_1000006357 394
480 3300037312 Ga0395899_0001563 Ga0395899_0001563_6814_8037 394
481 3300037312 Ga0395899_0006295 Ga0395899_0006295_654_1877 394
482 3300037418 Ga0395900_0070711 Ga0395900_0070711_1463_2686 394
483 3300038443 Ga0395901_0006141 Ga0395901_0006141_3769_4992 394
484 3300046472 Ga0495580_0046313 Ga0495580_0046313_1459_2670 394
485 iso_pu_bacteria 2773857672 2774128731 394
486 iso_pu_bacteria 2974298342 2974299146 394
487 iso_pu_bacteria 2984499530 2984501461 394
488 3300025272 Ga0209455_1000589 Ga0209455_100058925 395
489 3300035695 Ga0373927_0000423 Ga0373927_0000423_23639_24835 395
490 3300037068 Ga0373925_0004073 Ga0373925_0004073_8867_10063 395
491 3300049576 Ga0501040_0136796 Ga0501040_0136796_384_1613 395
492 3300049587 Ga0501071_0096309 Ga0501071_0096309_505_1734 395
493 3300050512 nmdc:mga0n895_191006_c1 nmdc:mga0n895_191006_c1_376_1581 395
494 3300050513 nmdc:mga0rr50_39097_c1 nmdc:mga0rr50_39097_c1_974_2179 395
495 iso_pu_bacteria 2904479285 2904480646 395
496 3300005434 Ga0070709_10038872 Ga0070709_100388722 396
497 3300005563 Ga0068855_100379057 Ga0068855_1003790571 396
498 3300005578 Ga0068854_100071458 Ga0068854_1000714582 396
499 3300005616 Ga0068852_100022556 Ga0068852_1000225563 396
500 3300006852 Ga0075433_10173695 Ga0075433_101736952 396
501 3300006871 Ga0075434_100039203 Ga0075434_1000392032 396
502 3300006914 Ga0075436_100093290 Ga0075436_1000932901 396
503 3300025904 Ga0207647_10027339 Ga0207647_100273392 396
504 3300025911 Ga0207654_10000803 Ga0207654_1000080319 396
505 3300025913 Ga0207695_10001543 Ga0207695_100015437 396
506 3300025986 Ga0207658_10030322 Ga0207658_100303222 396
507 3300026041 Ga0207639_10201974 Ga0207639_102019742 396
508 3300026067 Ga0207678_10035073 Ga0207678_100350734 396
509 3300026078 Ga0207702_10000005 Ga0207702_10000005291 396
510 3300026116 Ga0207674_10011138 Ga0207674_100111386 396
511 3300028653 Ga0265323_10012447 Ga0265323_100124472 396
512 3300028666 Ga0265336_10000125 Ga0265336_1000012514 396
513 3300028800 Ga0265338_10000085 Ga0265338_1000008540 396
514 3300046542 Ga0495597_0000452 Ga0495597_0000452_17866_19080 396
515 3300046665 Ga0495661_0000536 Ga0495661_0000536_19215_20468 396
516 3300048912 Ga0496109_0003906 Ga0496109_0003906_1577_2830 396
517 3300048916 Ga0496113_0003839 Ga0496113_0003839_2679_3932 396
518 3300048925 Ga0496122_0000326 Ga0496122_0000326_82579_83832 396
519 3300048926 Ga0496123_0000293 Ga0496123_0000293_19434_20687 396
520 3300048928 Ga0496125_0001226 Ga0496125_0001226_12739_13992 396
521 3300049581 Ga0501047_0029011 Ga0501047_0029011_2522_3739 396
522 3300049584 Ga0501068_0040701 Ga0501068_0040701_512_1729 396
523 3300049585 Ga0501069_0024058 Ga0501069_0024058_1184_2401 396
524 3300049586 Ga0501070_0004115 Ga0501070_0004115_1317_2534 396
525 3300049590 Ga0501074_0000199 Ga0501074_0000199_7918_9135 396
526 3300049741 Ga0501079_0051354 Ga0501079_0051354_1752_2969 396
527 3300049744 Ga0501083_0005240 Ga0501083_0005240_6637_7854 396
528 3300049822 Ga0501035_0117175 Ga0501035_0117175_556_1773 396
529 3300050512 nmdc:mga0n895_127494_c1 nmdc:mga0n895_127494_c1_844_2109 396
530 3300050514 nmdc:mga08x19_108432_c1 nmdc:mga08x19_108432_c1_572_1837 396
531 3300060353 Ga0501082_0074299 Ga0501082_0074299_1297_2514 396
532 3300006048 Ga0075363_100049168 Ga0075363_1000491681 397
533 3300009036 Ga0105244_10081138 Ga0105244_100811382 397
534 3300009093 Ga0105240_10026698 Ga0105240_100266983 397
535 3300009545 Ga0105237_10010820 Ga0105237_1001082010 397
536 3300013102 Ga0157371_10118037 Ga0157371_101180372 397
537 3300013105 Ga0157369_10016149 Ga0157369_100161498 397
538 3300025913 Ga0207695_10017237 Ga0207695_100172373 397
539 3300025949 Ga0207667_10019902 Ga0207667_100199023 397
540 3300046674 Ga0495588_0016286 Ga0495588_0016286_1685_2896 397
541 3300048907 Ga0496104_0223105 Ga0496104_0223105_191_1405 397
542 3300048925 Ga0496122_0005466 Ga0496122_0005466_11097_12317 397
543 3300048926 Ga0496123_0012928 Ga0496123_0012928_4826_6046 397
544 3300048928 Ga0496125_0000414 Ga0496125_0000414_14013_15233 397
545 3300050491 nmdc:mga00v17_92671_c1 nmdc:mga00v17_92671_c1_316_1518 397
546 iso_pu_bacteria 2516143018 2516209850 397
547 iso_pu_bacteria 2791355091 2792620301 397
548 iso_pu_bacteria 2791355092 2792626282 397
549 iso_pu_bacteria 2922386360 2922390420 397
550 3300006237 Ga0097621_100071325 Ga0097621_1000713253 398
551 3300044658 Ga0466972_0030197 Ga0466972_0030197_982_2202 398
552 3300044683 Ga0466965_0006185 Ga0466965_0006185_3677_4897 398
553 3300044706 Ga0466964_0024145 Ga0466964_0024145_849_2069 398
554 3300046528 Ga0495642_0015915 Ga0495642_0015915_672_1907 398
555 iso_pu_bacteria 2562617112 2563058192 398
556 iso_pu_bacteria 2711768613 2713480818 398
557 3300044693 Ga0466961_0057106 Ga0466961_0057106_103_1461 399
558 iso_pu_bacteria 2643221651 2644291655 399
559 3300044901 Ga0466960_0049678 Ga0466960_0049678_177_1415 400
560 3300046460 Ga0495638_0004449 Ga0495638_0004449_6319_7551 400
561 3300048910 Ga0496107_0190055 Ga0496107_0190055_93_1331 400
562 3300048915 Ga0496112_0005856 Ga0496112_0005856_8171_9409 400
563 3300048916 Ga0496113_0021658 Ga0496113_0021658_2840_4078 400
564 iso_pu_bacteria 2879110137 2879111530 400
565 3300006871 Ga0075434_100117063 Ga0075434_1001170632 401
566 3300050512 nmdc:mga0n895_127117_c1 nmdc:mga0n895_127117_c1_558_1907 401
567 iso_pu_bacteria 2775507049 2776911913 401
568 3300005262 Ga0065165_1000309 Ga0065165_100030911 402
569 3300007076 Ga0075435_100108501 Ga0075435_1001085013 402
570 3300009147 Ga0114129_10037597 Ga0114129_100375977 402
571 3300050507 nmdc:mga05p37_28488_c1 nmdc:mga05p37_28488_c1_4993_6333 402
572 3300005548 Ga0070665_100040053 Ga0070665_1000400534 403
573 3300046692 Ga0495671_0048616 Ga0495671_0048616_311_1555 403
574 iso_pu_bacteria 2909042592 2909046740 403
575 3300046524 Ga0495648_0015279 Ga0495648_0015279_933_2216 406
576 3300046660 Ga0495625_0083058 Ga0495625_0083058_118_1401 406
577 3300053104 Ga0500556_0005700 Ga0500556_0005700_981_2264 406
578 3300053156 Ga0500622_0003513 Ga0500622_0003513_4662_5945 406
579 iso_pu_bacteria 2582581283 2585166915 406
580 3300005548 Ga0070665_100116861 Ga0070665_1001168612 407
581 3300009545 Ga0105237_10143459 Ga0105237_101434592 409
582 3300031251 Ga0265327_10001073 Ga0265327_100010738 411
583 3300001990 JGI24737J22298_10016383 JGI24737J22298_100163832 418
584 3300005455 Ga0070663_100120575 Ga0070663_1001205752 418
585 3300005539 Ga0068853_100224583 Ga0068853_1002245832 418
586 3300009093 Ga0105240_10027543 Ga0105240_100275433 418
587 3300009174 Ga0105241_10125476 Ga0105241_101254762 418
588 3300009545 Ga0105237_10239771 Ga0105237_102397712 418
589 3300009551 Ga0105238_10017785 Ga0105238_100177852 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

256

438

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

58

241

0.86

PF07690

MFS_1

Major Facilitator Superfamily

63

288

0.86

PF07690

MFS_1

Major Facilitator Superfamily

268

448

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.8663 15 400
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8633 19 399
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8619 19 400
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8484 19 399
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.8477 15 400
ID Description Score Start End Superfamily
af_Q58713_262_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9639 261 396 1.20.1250.20
af_Q58713_262_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9436 261 396 1.20.1250.20
af_P9WLG3_19_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9368 19 194 1.20.1250.20
af_P76417_195_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9206 222 394 1.20.1250.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9188 225 400 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4P5SP13-F1-model_v4 MFS transporter 0.9863 54 396 GO:0016020
GO:0022857
AF-A0A7K2QQD8-F1-model_v4 MFS transporter 0.9694 28 190 GO:0016020
GO:0022857
AF-A0A4P5SP13-F1-model_v4 MFS transporter 0.9612 54 396 GO:0016020
GO:0022857
AF-A0A7K2QQD8-F1-model_v4 MFS transporter 0.9467 28 190 GO:0016020
GO:0022857
AF-A0A660YW01-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9155 224 399 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.86 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map