F466848
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 369 | 540 | 394 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100117063|Ga0075434_1001170632 |
| Length | 449 |
| Sequence | VNLNELQKSSPDPDDRRDELVLVGVLPSAVLDYNVAVISASQGGVPGSRVRGLRAIPKSIWALGLVSMFMDLSSEMIHSLLPVFLVSVLGATALSVGLIEGVAEATASITKIFSGALSDYFGRRKFLTGLGYGLAAVTKPLFPLATSVSWVFVARFVDRVGKGIRGAPRDALVGDIAPPSLRGACYGLRQSLDTVGAFAGPLVASALMAMTLEDFRLVFWVAVVPAFLAVGILVFGVEEPAAMPPARETRLPIRIADVRALQPAYWSIVVVGTIFTFARFSEAFLLLRAQDRGVSIPLVPMVLVVMNVVYSASAYPAGRLSDRMNRRVVLAAGSLVLIVADIALALGASRLEVFIGVVLWGLHMGLTQGSLAAMVTDTAPARLRGTAFGLFNLASGIATLIASVLAGWLWTEYGPAATFSAGAGFAAAAFVGLLAIRPQHQPSPPTATC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 3 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 4 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 5 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 8 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 9 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 10 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 13 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 14 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 15 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 18 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 19 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 20 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 21 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 22 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 23 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 24 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 25 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 26 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 27 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 28 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 29 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 30 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 31 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 32 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 33 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 34 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 35 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 36 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 37 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 38 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 39 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 40 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 41 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 42 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 43 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 44 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 45 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 46 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 47 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 50 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 51 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 52 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 53 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 237 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 367 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 368 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 369 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.51 |
| Metatranscriptomes | 0.17 |
| Isolates | 8.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 5.94 |
| Nodule | 2.04 |
| Rhizoplane | 3.57 |
| Rhizosphere | 80.81 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 7.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10016383 | 3300001990 | Bacteria | 2393 |
| 2 | JGI25158J39367_1001623 | 3300002739 | Bacteria | 3880 |
| 3 | JGI25151J46595_10000180 | 3300003187 | Bacteria | 79747 |
| 4 | rootH1_10028768 | 3300003316 | Bacteria | 10344 |
| 5 | rootH1_10221365 | 3300003323 | Bacteria | 4844 |
| 6 | JGI25160J50197_1005372 | 3300003354 | Bacteria | 5345 |
| 7 | JGI25161J50226_1000762 | 3300003374 | Bacteria | 12357 |
| 8 | JGI25161J50226_1002283 | 3300003374 | Bacteria | 5016 |
| 9 | Ga0055525_1000105 | 3300003759 | Bacteria | 134026 |
| 10 | Ga0055537_1004952 | 3300003773 | Bacteria | 3676 |
| 11 | Ga0055537_1007027 | 3300003773 | Bacteria | 2771 |
| 12 | Ga0055524_1004541 | 3300003775 | Bacteria | 6394 |
| 13 | Ga0055543_1000446 | 3300004625 | Bacteria | 25257 |
| 14 | Ga0065165_1000309 | 3300005262 | Bacteria | 80166 |
| 15 | Ga0065165_1001563 | 3300005262 | Bacteria | 23669 |
| 16 | Ga0070658_10054592 | 3300005327 | Bacteria | 3244 |
| 17 | Ga0070658_10073956 | 3300005327 | Bacteria | 2795 |
| 18 | Ga0070683_100238747 | 3300005329 | Bacteria | 1728 |
| 19 | Ga0070690_100016759 | 3300005330 | Bacteria | 4396 |
| 20 | Ga0070670_100020645 | 3300005331 | Bacteria | 5666 |
| 21 | Ga0070670_100077674 | 3300005331 | Bacteria | 2852 |
| 22 | Ga0070670_100143551 | 3300005331 | Unclassified | 2065 |
| 23 | Ga0070666_10005581 | 3300005335 | Bacteria | 7716 |
| 24 | Ga0070666_10074119 | 3300005335 | Bacteria | 2319 |
| 25 | Ga0068868_100075406 | 3300005338 | Bacteria | 2695 |
| 26 | Ga0070660_100005781 | 3300005339 | Bacteria | 8569 |
| 27 | Ga0070661_100000186 | 3300005344 | Bacteria | 51141 |
| 28 | Ga0070661_100043986 | 3300005344 | Bacteria | 3262 |
| 29 | Ga0070675_100030307 | 3300005354 | Bacteria | 4367 |
| 30 | Ga0070671_100000127 | 3300005355 | Bacteria | 49540 |
| 31 | Ga0070671_100025818 | 3300005355 | Bacteria | 4823 |
| 32 | Ga0070671_100053067 | 3300005355 | Bacteria | 3370 |
| 33 | Ga0070673_100177974 | 3300005364 | Bacteria | 1819 |
| 34 | Ga0070659_100038694 | 3300005366 | Bacteria | 3721 |
| 35 | Ga0070667_100029243 | 3300005367 | Bacteria | 4590 |
| 36 | Ga0070709_10005586 | 3300005434 | Bacteria | 6809 |
| 37 | Ga0070709_10023928 | 3300005434 | Bacteria | 3593 |
| 38 | Ga0070709_10038872 | 3300005434 | Bacteria | 2917 |
| 39 | Ga0070714_100024010 | 3300005435 | Bacteria | 5015 |
| 40 | Ga0070714_100075316 | 3300005435 | Bacteria | 2928 |
| 41 | Ga0070714_100108572 | 3300005435 | Bacteria | 2454 |
| 42 | Ga0070713_100007605 | 3300005436 | Bacteria | 7622 |
| 43 | Ga0070710_10061387 | 3300005437 | Bacteria | 2140 |
| 44 | Ga0070701_10031634 | 3300005438 | Bacteria | 2627 |
| 45 | Ga0070701_10032652 | 3300005438 | Bacteria | 2594 |
| 46 | Ga0070705_100017394 | 3300005440 | Bacteria | 3753 |
| 47 | Ga0070694_100023632 | 3300005444 | Bacteria | 3956 |
| 48 | Ga0070663_100025474 | 3300005455 | Bacteria | 3995 |
| 49 | Ga0070663_100120575 | 3300005455 | Bacteria | 1980 |
| 50 | Ga0070681_10185841 | 3300005458 | Bacteria | 1998 |
| 51 | Ga0068867_100017620 | 3300005459 | Bacteria | 5072 |
| 52 | Ga0070707_100046822 | 3300005468 | Unclassified | 4139 |
| 53 | Ga0070699_100055187 | 3300005518 | Bacteria | 3440 |
| 54 | Ga0070679_100060057 | 3300005530 | Bacteria | 3789 |
| 55 | Ga0070679_100139494 | 3300005530 | Bacteria | 2404 |
| 56 | Ga0070684_100094419 | 3300005535 | Bacteria | 2664 |
| 57 | Ga0070684_100180921 | 3300005535 | Bacteria | 1917 |
| 58 | Ga0068853_100224583 | 3300005539 | Bacteria | 1716 |
| 59 | Ga0070672_100015991 | 3300005543 | Bacteria | 5361 |
| 60 | Ga0070672_100143098 | 3300005543 | Bacteria | 1974 |
| 61 | Ga0070686_100005417 | 3300005544 | Bacteria | 7068 |
| 62 | Ga0070695_100153886 | 3300005545 | Bacteria | 1607 |
| 63 | Ga0070696_100062745 | 3300005546 | Bacteria | 2601 |
| 64 | Ga0070693_100000614 | 3300005547 | Bacteria | 15816 |
| 65 | Ga0070665_100027217 | 3300005548 | Bacteria | 5758 |
| 66 | Ga0070665_100040053 | 3300005548 | Bacteria | 4710 |
| 67 | Ga0070665_100116861 | 3300005548 | Bacteria | 2670 |
| 68 | Ga0070704_100042738 | 3300005549 | Bacteria | 3137 |
| 69 | Ga0070704_100061138 | 3300005549 | Bacteria | 2694 |
| 70 | Ga0068855_100006232 | 3300005563 | Bacteria | 14538 |
| 71 | Ga0068855_100008681 | 3300005563 | Bacteria | 12282 |
| 72 | Ga0068855_100034454 | 3300005563 | Bacteria | 6038 |
| 73 | Ga0068855_100116964 | 3300005563 | Bacteria | 3055 |
| 74 | Ga0068855_100379057 | 3300005563 | Bacteria | 1553 |
| 75 | Ga0068857_100046384 | 3300005577 | Bacteria | 3856 |
| 76 | Ga0068854_100071458 | 3300005578 | Bacteria | 2539 |
| 77 | Ga0068856_100009768 | 3300005614 | Bacteria | 9324 |
| 78 | Ga0068856_100036273 | 3300005614 | Bacteria | 4834 |
| 79 | Ga0068856_100274304 | 3300005614 | Bacteria | 1703 |
| 80 | Ga0068852_100022556 | 3300005616 | Bacteria | 5050 |
| 81 | Ga0068852_100028698 | 3300005616 | Bacteria | 4559 |
| 82 | Ga0068859_100000254 | 3300005617 | Bacteria | 52931 |
| 83 | Ga0068864_100000124 | 3300005618 | Bacteria | 75383 |
| 84 | Ga0068864_100003677 | 3300005618 | Bacteria | 12670 |
| 85 | Ga0068861_100035001 | 3300005719 | Bacteria | 3717 |
| 86 | Ga0068863_100012758 | 3300005841 | Bacteria | 8104 |
| 87 | Ga0068863_100041936 | 3300005841 | Bacteria | 4349 |
| 88 | Ga0068863_100058574 | 3300005841 | Bacteria | 3645 |
| 89 | Ga0068858_100000022 | 3300005842 | Bacteria | 169718 |
| 90 | Ga0068858_100000203 | 3300005842 | Bacteria | 63930 |
| 91 | Ga0068858_100024569 | 3300005842 | Bacteria | 5614 |
| 92 | Ga0068860_100055465 | 3300005843 | Bacteria | 3767 |
| 93 | Ga0068860_100074848 | 3300005843 | Bacteria | 3221 |
| 94 | Ga0068860_100139181 | 3300005843 | Bacteria | 2332 |
| 95 | Ga0075363_100007251 | 3300006048 | Bacteria | 5084 |
| 96 | Ga0075363_100049168 | 3300006048 | Bacteria | 2245 |
| 97 | Ga0070712_100064762 | 3300006175 | Bacteria | 2593 |
| 98 | Ga0075367_10137986 | 3300006178 | Bacteria | 1509 |
| 99 | Ga0097621_100022940 | 3300006237 | Bacteria | 4850 |
| 100 | Ga0097621_100061839 | 3300006237 | Bacteria | 3072 |
| 101 | Ga0097621_100071325 | 3300006237 | Bacteria | 2870 |
| 102 | Ga0068871_100002257 | 3300006358 | Bacteria | 13105 |
| 103 | Ga0075428_100016727 | 3300006844 | Bacteria | 8098 |
| 104 | Ga0075433_10026512 | 3300006852 | Bacteria | 4907 |
| 105 | Ga0075433_10173695 | 3300006852 | Bacteria | 1917 |
| 106 | Ga0075434_100018036 | 3300006871 | Bacteria | 6810 |
| 107 | Ga0075434_100039203 | 3300006871 | Bacteria | 4694 |
| 108 | Ga0075434_100050982 | 3300006871 | Bacteria | 4111 |
| 109 | Ga0075434_100117063 | 3300006871 | Bacteria | 2678 |
| 110 | Ga0075429_100081567 | 3300006880 | Bacteria | 2820 |
| 111 | Ga0075436_100093290 | 3300006914 | Bacteria | 2093 |
| 112 | Ga0075436_100105739 | 3300006914 | Bacteria | 1963 |
| 113 | Ga0097620_100000254 | 3300006931 | Bacteria | 52931 |
| 114 | Ga0075435_100108501 | 3300007076 | Bacteria | 2306 |
| 115 | Ga0075435_100109009 | 3300007076 | Bacteria | 2301 |
| 116 | Ga0105244_10009635 | 3300009036 | Bacteria | 5918 |
| 117 | Ga0105244_10081138 | 3300009036 | Bacteria | 1605 |
| 118 | Ga0105240_10012185 | 3300009093 | Bacteria | 11898 |
| 119 | Ga0105240_10014954 | 3300009093 | Bacteria | 10573 |
| 120 | Ga0105240_10026698 | 3300009093 | Bacteria | 7575 |
| 121 | Ga0105240_10027543 | 3300009093 | Bacteria | 7438 |
| 122 | Ga0105240_10040270 | 3300009093 | Bacteria | 5978 |
| 123 | Ga0105240_10191971 | 3300009093 | Bacteria | 2401 |
| 124 | Ga0105240_10287330 | 3300009093 | Bacteria | 1887 |
| 125 | Ga0111539_10218267 | 3300009094 | Bacteria | 2221 |
| 126 | Ga0105245_10050924 | 3300009098 | Bacteria | 3712 |
| 127 | Ga0105247_10000313 | 3300009101 | Bacteria | 43580 |
| 128 | Ga0114129_10031994 | 3300009147 | Bacteria | 7436 |
| 129 | Ga0114129_10037597 | 3300009147 | Bacteria | 6834 |
| 130 | Ga0114129_10217668 | 3300009147 | Bacteria | 2578 |
| 131 | Ga0114129_10290750 | 3300009147 | Bacteria | 2181 |
| 132 | Ga0105243_10093281 | 3300009148 | Bacteria | 2484 |
| 133 | Ga0105241_10016625 | 3300009174 | Bacteria | 5399 |
| 134 | Ga0105241_10125476 | 3300009174 | Bacteria | 2072 |
| 135 | Ga0105242_10024261 | 3300009176 | Bacteria | 4788 |
| 136 | Ga0105242_10129482 | 3300009176 | Bacteria | 2176 |
| 137 | Ga0105248_10002999 | 3300009177 | Bacteria | 18723 |
| 138 | Ga0105248_10009725 | 3300009177 | Bacteria | 10590 |
| 139 | Ga0105248_10028456 | 3300009177 | Bacteria | 6225 |
| 140 | Ga0105248_10077490 | 3300009177 | Bacteria | 3737 |
| 141 | Ga0105237_10010820 | 3300009545 | Bacteria | 9682 |
| 142 | Ga0105237_10137386 | 3300009545 | Bacteria | 2439 |
| 143 | Ga0105237_10143459 | 3300009545 | Bacteria | 2382 |
| 144 | Ga0105237_10239771 | 3300009545 | Bacteria | 1814 |
| 145 | Ga0105238_10016029 | 3300009551 | Bacteria | 7580 |
| 146 | Ga0105238_10017785 | 3300009551 | Bacteria | 7227 |
| 147 | Ga0105249_10071698 | 3300009553 | Bacteria | 3201 |
| 148 | Ga0105249_10109336 | 3300009553 | Bacteria | 2611 |
| 149 | Ga0105249_10368148 | 3300009553 | Bacteria | 1460 |
| 150 | Ga0105239_10018971 | 3300010375 | Bacteria | 7602 |
| 151 | Ga0105239_10051952 | 3300010375 | Bacteria | 4493 |
| 152 | Ga0105239_10163782 | 3300010375 | Bacteria | 2486 |
| 153 | Ga0105246_10082796 | 3300011119 | Bacteria | 2291 |
| 154 | Ga0105246_10215816 | 3300011119 | Bacteria | 1500 |
| 155 | Ga0157371_10118037 | 3300013102 | Bacteria | 1886 |
| 156 | Ga0157370_10002401 | 3300013104 | Bacteria | 22574 |
| 157 | Ga0157370_10024486 | 3300013104 | Bacteria | 5979 |
| 158 | Ga0157369_10016149 | 3300013105 | Bacteria | 8404 |
| 159 | Ga0157369_10057502 | 3300013105 | Bacteria | 4196 |
| 160 | Ga0157378_10141059 | 3300013297 | Bacteria | 2238 |
| 161 | Ga0157378_10228805 | 3300013297 | Bacteria | 1771 |
| 162 | Ga0163162_10002725 | 3300013306 | Bacteria | 16757 |
| 163 | Ga0157375_10004870 | 3300013308 | Bacteria | 11664 |
| 164 | Ga0163163_10086144 | 3300014325 | Unclassified | 3150 |
| 165 | Ga0157380_10005633 | 3300014326 | Bacteria | 8751 |
| 166 | Ga0157380_10038216 | 3300014326 | Bacteria | 3726 |
| 167 | Ga0157379_10052055 | 3300014968 | Bacteria | 3656 |
| 168 | Ga0157379_10199639 | 3300014968 | Bacteria | 1809 |
| 169 | Ga0206353_11325052 | 3300020082 | Bacteria | 6972 |
| 170 | Ga0209436_100271 | 3300025208 | Bacteria | 23736 |
| 171 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 172 | Ga0209677_104952 | 3300025253 | Bacteria | 3628 |
| 173 | Ga0209565_1003978 | 3300025263 | Bacteria | 4615 |
| 174 | Ga0209565_1005218 | 3300025263 | Bacteria | 3810 |
| 175 | Ga0209455_1000589 | 3300025272 | Bacteria | 23557 |
| 176 | Ga0209130_1000556 | 3300025284 | Bacteria | 37029 |
| 177 | Ga0209675_1001607 | 3300025291 | Bacteria | 12735 |
| 178 | Ga0209025_1000422 | 3300025294 | Bacteria | 84434 |
| 179 | Ga0209564_1000852 | 3300025295 | Bacteria | 40733 |
| 180 | Ga0209758_1005688 | 3300025297 | Bacteria | 9422 |
| 181 | Ga0209050_1000226 | 3300025298 | Bacteria | 124227 |
| 182 | Ga0209256_1001985 | 3300025299 | Bacteria | 18406 |
| 183 | Ga0207426_1000133 | 3300025302 | Bacteria | 206783 |
| 184 | Ga0207696_1019337 | 3300025711 | Bacteria | 2220 |
| 185 | Ga0207655_1000302 | 3300025728 | Bacteria | 74492 |
| 186 | Ga0207713_1008178 | 3300025735 | Bacteria | 6052 |
| 187 | Ga0207710_10001182 | 3300025900 | Bacteria | 13268 |
| 188 | Ga0207647_10027339 | 3300025904 | Bacteria | 3719 |
| 189 | Ga0207699_10006385 | 3300025906 | Bacteria | 5703 |
| 190 | Ga0207699_10073001 | 3300025906 | Bacteria | 2103 |
| 191 | Ga0207705_10015761 | 3300025909 | Bacteria | 5427 |
| 192 | Ga0207705_10089576 | 3300025909 | Bacteria | 2252 |
| 193 | Ga0207705_10162894 | 3300025909 | Bacteria | 1676 |
| 194 | Ga0207654_10000803 | 3300025911 | Bacteria | 17284 |
| 195 | Ga0207695_10001543 | 3300025913 | Bacteria | 37956 |
| 196 | Ga0207695_10004160 | 3300025913 | Bacteria | 19870 |
| 197 | Ga0207695_10012469 | 3300025913 | Bacteria | 10202 |
| 198 | Ga0207695_10017237 | 3300025913 | Bacteria | 8412 |
| 199 | Ga0207695_10110144 | 3300025913 | Bacteria | 2734 |
| 200 | Ga0207663_10007869 | 3300025916 | Bacteria | 5555 |
| 201 | Ga0207657_10005977 | 3300025919 | Bacteria | 12665 |
| 202 | Ga0207657_10041344 | 3300025919 | Bacteria | 4077 |
| 203 | Ga0207649_10000182 | 3300025920 | Bacteria | 51148 |
| 204 | Ga0207649_10013314 | 3300025920 | Bacteria | 4589 |
| 205 | Ga0207652_10016504 | 3300025921 | Bacteria | 6031 |
| 206 | Ga0207646_10038070 | 3300025922 | Unclassified | 4334 |
| 207 | Ga0207681_10273368 | 3300025923 | Bacteria | 1327 |
| 208 | Ga0207694_10004671 | 3300025924 | Bacteria | 10665 |
| 209 | Ga0207650_10004559 | 3300025925 | Bacteria | 9472 |
| 210 | Ga0207659_10097937 | 3300025926 | Bacteria | 2204 |
| 211 | Ga0207687_10080001 | 3300025927 | Bacteria | 2358 |
| 212 | Ga0207700_10119817 | 3300025928 | Bacteria | 2132 |
| 213 | Ga0207664_10164136 | 3300025929 | Bacteria | 1896 |
| 214 | Ga0207644_10002358 | 3300025931 | Bacteria | 12191 |
| 215 | Ga0207644_10039779 | 3300025931 | Bacteria | 3320 |
| 216 | Ga0207690_10011697 | 3300025932 | Bacteria | 5247 |
| 217 | Ga0207690_10027053 | 3300025932 | Bacteria | 3621 |
| 218 | Ga0207686_10016963 | 3300025934 | Bacteria | 4094 |
| 219 | Ga0207691_10010599 | 3300025940 | Bacteria | 8840 |
| 220 | Ga0207691_10157268 | 3300025940 | Bacteria | 1995 |
| 221 | Ga0207711_10020200 | 3300025941 | Bacteria | 5550 |
| 222 | Ga0207689_10029785 | 3300025942 | Bacteria | 4553 |
| 223 | Ga0207679_10026681 | 3300025945 | Unclassified | 3986 |
| 224 | Ga0207667_10011187 | 3300025949 | Bacteria | 10445 |
| 225 | Ga0207667_10019902 | 3300025949 | Bacteria | 7479 |
| 226 | Ga0207667_10023940 | 3300025949 | Bacteria | 6717 |
| 227 | Ga0207668_10039681 | 3300025972 | Bacteria | 3172 |
| 228 | Ga0207658_10004364 | 3300025986 | Bacteria | 9837 |
| 229 | Ga0207658_10019967 | 3300025986 | Bacteria | 4637 |
| 230 | Ga0207658_10030322 | 3300025986 | Bacteria | 3828 |
| 231 | Ga0207677_10021441 | 3300026023 | Bacteria | 3948 |
| 232 | Ga0207703_10000154 | 3300026035 | Bacteria | 79176 |
| 233 | Ga0207703_10001177 | 3300026035 | Bacteria | 24658 |
| 234 | Ga0207703_10010146 | 3300026035 | Bacteria | 7384 |
| 235 | Ga0207703_10054184 | 3300026035 | Unclassified | 3261 |
| 236 | Ga0207639_10201974 | 3300026041 | Bacteria | 1705 |
| 237 | Ga0207678_10006866 | 3300026067 | Bacteria | 10095 |
| 238 | Ga0207678_10035073 | 3300026067 | Bacteria | 4368 |
| 239 | Ga0207708_10025157 | 3300026075 | Bacteria | 4502 |
| 240 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 241 | Ga0207702_10005748 | 3300026078 | Bacteria | 10800 |
| 242 | Ga0207702_10075834 | 3300026078 | Bacteria | 2905 |
| 243 | Ga0207641_10010419 | 3300026088 | Bacteria | 7639 |
| 244 | Ga0207641_10031087 | 3300026088 | Bacteria | 4427 |
| 245 | Ga0207648_10020125 | 3300026089 | Bacteria | 6017 |
| 246 | Ga0207648_10037177 | 3300026089 | Bacteria | 4288 |
| 247 | Ga0207648_10233850 | 3300026089 | Bacteria | 1635 |
| 248 | Ga0207676_10000147 | 3300026095 | Bacteria | 61708 |
| 249 | Ga0207676_10014491 | 3300026095 | Bacteria | 5674 |
| 250 | Ga0207674_10011138 | 3300026116 | Bacteria | 10114 |
| 251 | Ga0207674_10011424 | 3300026116 | Bacteria | 9979 |
| 252 | Ga0207674_10015857 | 3300026116 | Bacteria | 8261 |
| 253 | Ga0207675_100004679 | 3300026118 | Bacteria | 13176 |
| 254 | Ga0207675_100077241 | 3300026118 | Bacteria | 3119 |
| 255 | Ga0207698_10001935 | 3300026142 | Bacteria | 12149 |
| 256 | Ga0207698_10005706 | 3300026142 | Bacteria | 7710 |
| 257 | Ga0209983_1004988 | 3300027665 | Bacteria | 2771 |
| 258 | Ga0268266_10000797 | 3300028379 | Bacteria | 41969 |
| 259 | Ga0265337_1004722 | 3300028556 | Bacteria | 5597 |
| 260 | Ga0265323_10012447 | 3300028653 | Bacteria | 3408 |
| 261 | Ga0265336_10000125 | 3300028666 | Bacteria | 57377 |
| 262 | Ga0265338_10000085 | 3300028800 | Bacteria | 175080 |
| 263 | Ga0265328_10000033 | 3300031239 | Bacteria | 99507 |
| 264 | Ga0265325_10064277 | 3300031241 | Bacteria | 1855 |
| 265 | Ga0265329_10033027 | 3300031242 | Bacteria | 1674 |
| 266 | Ga0265331_10000985 | 3300031250 | Bacteria | 22436 |
| 267 | Ga0265331_10008824 | 3300031250 | Bacteria | 5708 |
| 268 | Ga0265327_10000732 | 3300031251 | Bacteria | 51255 |
| 269 | Ga0265327_10001073 | 3300031251 | Bacteria | 38121 |
| 270 | Ga0265327_10003474 | 3300031251 | Bacteria | 14996 |
| 271 | Ga0265327_10030504 | 3300031251 | Bacteria | 3047 |
| 272 | Ga0265316_10000940 | 3300031344 | Bacteria | 31719 |
| 273 | Ga0265316_10003226 | 3300031344 | Bacteria | 16569 |
| 274 | Ga0307408_100000635 | 3300031548 | Bacteria | 29615 |
| 275 | Ga0265313_10082319 | 3300031595 | Bacteria | 1459 |
| 276 | Ga0316576_10014728 | 3300031727 | Bacteria | 5229 |
| 277 | Ga0307516_10172558 | 3300031730 | Bacteria | 1902 |
| 278 | Ga0307413_10041634 | 3300031824 | Bacteria | 2691 |
| 279 | Ga0307410_10083569 | 3300031852 | Bacteria | 2249 |
| 280 | Ga0307412_10043816 | 3300031911 | Bacteria | 2917 |
| 281 | Ga0307409_100062999 | 3300031995 | Bacteria | 2906 |
| 282 | Ga0307409_100316197 | 3300031995 | Bacteria | 1459 |
| 283 | Ga0307416_100152503 | 3300032002 | Bacteria | 2122 |
| 284 | Ga0307414_10031614 | 3300032004 | Bacteria | 3475 |
| 285 | Ga0316583_10008031 | 3300032133 | Bacteria | 3802 |
| 286 | Ga0373936_0042858 | 3300035113 | Bacteria | 1817 |
| 287 | Ga0373955_0101808 | 3300035172 | Bacteria | 1650 |
| 288 | Ga0316574_0053394 | 3300035398 | Unclassified | 2523 |
| 289 | Ga0373931_0181794 | 3300035691 | Bacteria | 1246 |
| 290 | Ga0373935_0002685 | 3300035692 | Bacteria | 10236 |
| 291 | Ga0373927_0000423 | 3300035695 | Bacteria | 32523 |
| 292 | Ga0373933_0241361 | 3300035724 | Unclassified | 1162 |
| 293 | Ga0373947_0097561 | 3300035725 | Bacteria | 1842 |
| 294 | Ga0373947_0212271 | 3300035725 | Bacteria | 1270 |
| 295 | Ga0373937_0029822 | 3300036401 | Bacteria | 4941 |
| 296 | Ga0373937_0045373 | 3300036401 | Bacteria | 4016 |
| 297 | Ga0373937_0094244 | 3300036401 | Bacteria | 2776 |
| 298 | Ga0373925_0004073 | 3300037068 | Bacteria | 11101 |
| 299 | Ga0373925_0012595 | 3300037068 | Bacteria | 6128 |
| 300 | Ga0395899_0001563 | 3300037312 | Bacteria | 19282 |
| 301 | Ga0395899_0002465 | 3300037312 | Bacteria | 15014 |
| 302 | Ga0395899_0006295 | 3300037312 | Bacteria | 9185 |
| 303 | Ga0395899_0044720 | 3300037312 | Bacteria | 3298 |
| 304 | Ga0395899_0060459 | 3300037312 | Bacteria | 2791 |
| 305 | Ga0395899_0064005 | 3300037312 | Bacteria | 2704 |
| 306 | Ga0395899_0177982 | 3300037312 | Bacteria | 1494 |
| 307 | Ga0395899_0198281 | 3300037312 | Bacteria | 1401 |
| 308 | Ga0395900_0000261 | 3300037418 | Bacteria | 81971 |
| 309 | Ga0395900_0002552 | 3300037418 | Bacteria | 19961 |
| 310 | Ga0395900_0016708 | 3300037418 | Bacteria | 7486 |
| 311 | Ga0395900_0070711 | 3300037418 | Bacteria | 3587 |
| 312 | Ga0395900_0070805 | 3300037418 | Bacteria | 3584 |
| 313 | Ga0395900_0148518 | 3300037418 | Bacteria | 2396 |
| 314 | Ga0395900_0249772 | 3300037418 | Bacteria | 1775 |
| 315 | Ga0395898_0265368 | 3300037466 | Bacteria | 1637 |
| 316 | Ga0395905_0007129 | 3300037471 | Bacteria | 11173 |
| 317 | Ga0395905_0069138 | 3300037471 | Bacteria | 3307 |
| 318 | Ga0395905_0163217 | 3300037471 | Bacteria | 2093 |
| 319 | Ga0395905_0306006 | 3300037471 | Bacteria | 1477 |
| 320 | Ga0395901_0000174 | 3300038443 | Bacteria | 83279 |
| 321 | Ga0395901_0002028 | 3300038443 | Bacteria | 20821 |
| 322 | Ga0395901_0006141 | 3300038443 | Bacteria | 12170 |
| 323 | Ga0436365_0340854 | 3300039437 | Bacteria | 10644 |
| 324 | Ga0439435_0011159 | 3300042436 | Bacteria | 2150 |
| 325 | Ga0439444_0000285 | 3300042437 | Bacteria | 5186 |
| 326 | Ga0451577_0001674 | 3300042876 | Bacteria | 28622 |
| 327 | Ga0451577_0067463 | 3300042876 | Bacteria | 3190 |
| 328 | Ga0466969_0020981 | 3300044656 | Unclassified | 3379 |
| 329 | Ga0466972_0030197 | 3300044658 | Bacteria | 2668 |
| 330 | Ga0466965_0006185 | 3300044683 | Bacteria | 5416 |
| 331 | Ga0466966_0000712 | 3300044684 | Bacteria | 21100 |
| 332 | Ga0466966_0003657 | 3300044684 | Bacteria | 10150 |
| 333 | Ga0466966_0007967 | 3300044684 | Bacteria | 7021 |
| 334 | Ga0466966_0021298 | 3300044684 | Bacteria | 4257 |
| 335 | Ga0466966_0069595 | 3300044684 | Bacteria | 2207 |
| 336 | Ga0466966_0102167 | 3300044684 | Bacteria | 1772 |
| 337 | Ga0466961_0003505 | 3300044693 | Bacteria | 9785 |
| 338 | Ga0466961_0053400 | 3300044693 | Unclassified | 2578 |
| 339 | Ga0466961_0057106 | 3300044693 | Bacteria | 2485 |
| 340 | Ga0466964_0024145 | 3300044706 | Bacteria | 2367 |
| 341 | Ga0453684_0299789 | 3300044712 | Bacteria | 1827 |
| 342 | Ga0453684_0630801 | 3300044712 | Bacteria | 1171 |
| 343 | Ga0466968_0009970 | 3300044735 | Bacteria | 3668 |
| 344 | Ga0466960_0049678 | 3300044901 | Bacteria | 2020 |
| 345 | Ga0466959_0051294 | 3300045049 | Bacteria | 3026 |
| 346 | Ga0466959_0104541 | 3300045049 | Unclassified | 2025 |
| 347 | Ga0451576_0000487 | 3300045051 | Bacteria | 87753 |
| 348 | Ga0451576_0078641 | 3300045051 | Bacteria | 3432 |
| 349 | Ga0451576_0339119 | 3300045051 | Bacteria | 1573 |
| 350 | Ga0466958_0119735 | 3300045836 | Bacteria | 1647 |
| 351 | Ga0495592_0015046 | 3300046454 | Bacteria | 5875 |
| 352 | Ga0495603_0021934 | 3300046455 | Bacteria | 3866 |
| 353 | Ga0495590_0056963 | 3300046457 | Bacteria | 1366 |
| 354 | Ga0495629_0000811 | 3300046459 | Bacteria | 25275 |
| 355 | Ga0495629_0067330 | 3300046459 | Bacteria | 2499 |
| 356 | Ga0495629_0088334 | 3300046459 | Bacteria | 2162 |
| 357 | Ga0495638_0004449 | 3300046460 | Bacteria | 10613 |
| 358 | Ga0495651_0042505 | 3300046462 | Bacteria | 3529 |
| 359 | Ga0495580_0000941 | 3300046472 | Bacteria | 25456 |
| 360 | Ga0495580_0024473 | 3300046472 | Bacteria | 4419 |
| 361 | Ga0495580_0046313 | 3300046472 | Bacteria | 3086 |
| 362 | Ga0495580_0079863 | 3300046472 | Bacteria | 2281 |
| 363 | Ga0495580_0139211 | 3300046472 | Bacteria | 1682 |
| 364 | Ga0495582_0035033 | 3300046473 | Bacteria | 2759 |
| 365 | Ga0495605_0007332 | 3300046474 | Bacteria | 6264 |
| 366 | Ga0495664_0017247 | 3300046477 | Bacteria | 4126 |
| 367 | Ga0495664_0063531 | 3300046477 | Bacteria | 2201 |
| 368 | Ga0495594_0002509 | 3300046499 | Bacteria | 9561 |
| 369 | Ga0495596_0036086 | 3300046500 | Bacteria | 1959 |
| 370 | Ga0495607_0000864 | 3300046501 | Bacteria | 28383 |
| 371 | Ga0495607_0007171 | 3300046501 | Bacteria | 7745 |
| 372 | Ga0495583_0005563 | 3300046506 | Bacteria | 8512 |
| 373 | Ga0495608_0007920 | 3300046511 | Bacteria | 7468 |
| 374 | Ga0495608_0014909 | 3300046511 | Bacteria | 5394 |
| 375 | Ga0495616_0012264 | 3300046513 | Bacteria | 4871 |
| 376 | Ga0495616_0061763 | 3300046513 | Bacteria | 1837 |
| 377 | Ga0495618_0024891 | 3300046514 | Bacteria | 3711 |
| 378 | Ga0495618_0050634 | 3300046514 | Bacteria | 2624 |
| 379 | Ga0495628_0056358 | 3300046516 | Bacteria | 3094 |
| 380 | Ga0495630_0008935 | 3300046517 | Bacteria | 7191 |
| 381 | Ga0495630_0232820 | 3300046517 | Bacteria | 1407 |
| 382 | Ga0495643_0000297 | 3300046522 | Bacteria | 69703 |
| 383 | Ga0495648_0009521 | 3300046524 | Bacteria | 7509 |
| 384 | Ga0495648_0014734 | 3300046524 | Bacteria | 5702 |
| 385 | Ga0495648_0015279 | 3300046524 | Bacteria | 5583 |
| 386 | Ga0495648_0043467 | 3300046524 | Bacteria | 2816 |
| 387 | Ga0495648_0081679 | 3300046524 | Bacteria | 1837 |
| 388 | Ga0495666_0006258 | 3300046526 | Bacteria | 5993 |
| 389 | Ga0495642_0015915 | 3300046528 | Bacteria | 2928 |
| 390 | Ga0495652_0027084 | 3300046529 | Bacteria | 5054 |
| 391 | Ga0495652_0223242 | 3300046529 | Bacteria | 1414 |
| 392 | Ga0495665_0021341 | 3300046531 | Bacteria | 3479 |
| 393 | Ga0495586_0031153 | 3300046535 | Bacteria | 2855 |
| 394 | Ga0495587_0022047 | 3300046536 | Bacteria | 3924 |
| 395 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 396 | Ga0495597_0000452 | 3300046542 | Bacteria | 34993 |
| 397 | Ga0495645_0045979 | 3300046543 | Bacteria | 3183 |
| 398 | Ga0495645_0066993 | 3300046543 | Bacteria | 2593 |
| 399 | Ga0495667_0000869 | 3300046559 | Bacteria | 19529 |
| 400 | Ga0495634_0016033 | 3300046642 | Bacteria | 5366 |
| 401 | Ga0495625_0083058 | 3300046660 | Bacteria | 2227 |
| 402 | Ga0495635_0120419 | 3300046663 | Bacteria | 1790 |
| 403 | Ga0495661_0000361 | 3300046665 | Bacteria | 49232 |
| 404 | Ga0495661_0000536 | 3300046665 | Bacteria | 39145 |
| 405 | Ga0495661_0034167 | 3300046665 | Bacteria | 3200 |
| 406 | Ga0495661_0042079 | 3300046665 | Bacteria | 2819 |
| 407 | Ga0495661_0055005 | 3300046665 | Bacteria | 2387 |
| 408 | Ga0495588_0000067 | 3300046674 | Bacteria | 238958 |
| 409 | Ga0495588_0016286 | 3300046674 | Bacteria | 3592 |
| 410 | Ga0495657_0009818 | 3300046675 | Bacteria | 7226 |
| 411 | Ga0495657_0048491 | 3300046675 | Bacteria | 2865 |
| 412 | Ga0495657_0121978 | 3300046675 | Bacteria | 1641 |
| 413 | Ga0495599_0003108 | 3300046678 | Bacteria | 9671 |
| 414 | Ga0495599_0021734 | 3300046678 | Bacteria | 4004 |
| 415 | Ga0495623_0003256 | 3300046679 | Bacteria | 10724 |
| 416 | Ga0495646_0029143 | 3300046680 | Bacteria | 3451 |
| 417 | Ga0495671_0048616 | 3300046692 | Bacteria | 2116 |
| 418 | Ga0495589_0000119 | 3300046794 | Bacteria | 73585 |
| 419 | Ga0495600_0024181 | 3300046809 | Bacteria | 3909 |
| 420 | Ga0495660_0031011 | 3300046810 | Bacteria | 3008 |
| 421 | Ga0495581_0004044 | 3300047315 | Bacteria | 8447 |
| 422 | Ga0495604_0001390 | 3300047317 | Bacteria | 19846 |
| 423 | Ga0495604_0056205 | 3300047317 | Bacteria | 3030 |
| 424 | Ga0495604_0079855 | 3300047317 | Bacteria | 2452 |
| 425 | Ga0495674_0014809 | 3300047319 | Bacteria | 7296 |
| 426 | Ga0495674_0106409 | 3300047319 | Bacteria | 2382 |
| 427 | Ga0495680_0021810 | 3300047322 | Bacteria | 5352 |
| 428 | Ga0495680_0033770 | 3300047322 | Bacteria | 4139 |
| 429 | Ga0495680_0163593 | 3300047322 | Bacteria | 1614 |
| 430 | Ga0495683_0018789 | 3300047323 | Bacteria | 3570 |
| 431 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 432 | Ga0495687_023966 | 3300047443 | Bacteria | 2909 |
| 433 | Ga0495687_025676 | 3300047443 | Bacteria | 2781 |
| 434 | Ga0495675_0005909 | 3300047444 | Bacteria | 7479 |
| 435 | Ga0495675_0030320 | 3300047444 | Bacteria | 3450 |
| 436 | Ga0495675_0036224 | 3300047444 | Bacteria | 3147 |
| 437 | Ga0495677_0000020 | 3300047445 | Bacteria | 107093 |
| 438 | Ga0495684_0203650 | 3300047471 | Bacteria | 1458 |
| 439 | Ga0495602_0025808 | 3300048088 | Bacteria | 5680 |
| 440 | Ga0495614_0001670 | 3300048089 | Bacteria | 9676 |
| 441 | Ga0495626_0000514 | 3300048091 | Bacteria | 38782 |
| 442 | Ga0496102_0039670 | 3300048905 | Bacteria | 4255 |
| 443 | Ga0496103_0110372 | 3300048906 | Unclassified | 1747 |
| 444 | Ga0496104_0024997 | 3300048907 | Bacteria | 5502 |
| 445 | Ga0496104_0070619 | 3300048907 | Bacteria | 3320 |
| 446 | Ga0496104_0223105 | 3300048907 | Bacteria | 1797 |
| 447 | Ga0496105_0080529 | 3300048908 | Bacteria | 2690 |
| 448 | Ga0496106_0052801 | 3300048909 | Bacteria | 3068 |
| 449 | Ga0496107_0007560 | 3300048910 | Bacteria | 7495 |
| 450 | Ga0496107_0190055 | 3300048910 | Bacteria | 1525 |
| 451 | Ga0496109_0003906 | 3300048912 | Bacteria | 12452 |
| 452 | Ga0496109_0324145 | 3300048912 | Bacteria | 1454 |
| 453 | Ga0496112_0005856 | 3300048915 | Bacteria | 10703 |
| 454 | Ga0496113_0003839 | 3300048916 | Bacteria | 9091 |
| 455 | Ga0496113_0021658 | 3300048916 | Bacteria | 4536 |
| 456 | Ga0496113_0074539 | 3300048916 | Bacteria | 2587 |
| 457 | Ga0496114_0075123 | 3300048917 | Bacteria | 2846 |
| 458 | Ga0496114_0087875 | 3300048917 | Bacteria | 2636 |
| 459 | Ga0496115_0149325 | 3300048918 | Bacteria | 1929 |
| 460 | Ga0496117_0001813 | 3300048920 | Bacteria | 29024 |
| 461 | Ga0496118_0002545 | 3300048921 | Bacteria | 24414 |
| 462 | Ga0496119_0013300 | 3300048922 | Bacteria | 6575 |
| 463 | Ga0496121_0000844 | 3300048924 | Bacteria | 55593 |
| 464 | Ga0496122_0000326 | 3300048925 | Bacteria | 103567 |
| 465 | Ga0496122_0002159 | 3300048925 | Bacteria | 28828 |
| 466 | Ga0496122_0002956 | 3300048925 | Bacteria | 23176 |
| 467 | Ga0496122_0005466 | 3300048925 | Bacteria | 15123 |
| 468 | Ga0496123_0000240 | 3300048926 | Bacteria | 110383 |
| 469 | Ga0496123_0000293 | 3300048926 | Bacteria | 97880 |
| 470 | Ga0496123_0006252 | 3300048926 | Bacteria | 11609 |
| 471 | Ga0496123_0012928 | 3300048926 | Bacteria | 7060 |
| 472 | Ga0496124_0011304 | 3300048927 | Bacteria | 8936 |
| 473 | Ga0496124_0082297 | 3300048927 | Bacteria | 2643 |
| 474 | Ga0496124_0165825 | 3300048927 | Bacteria | 1717 |
| 475 | Ga0496125_0000414 | 3300048928 | Bacteria | 79745 |
| 476 | Ga0496125_0001226 | 3300048928 | Bacteria | 38423 |
| 477 | Ga0496125_0002781 | 3300048928 | Bacteria | 22144 |
| 478 | Ga0496125_0036295 | 3300048928 | Bacteria | 4307 |
| 479 | Ga0496126_0001308 | 3300048929 | Bacteria | 39693 |
| 480 | Ga0496126_0163937 | 3300048929 | Bacteria | 1898 |
| 481 | Ga0495682_0008643 | 3300049460 | Bacteria | 4008 |
| 482 | Ga0495682_0018106 | 3300049460 | Bacteria | 2653 |
| 483 | Ga0501032_0035848 | 3300049569 | Bacteria | 3389 |
| 484 | Ga0501033_0202891 | 3300049570 | Bacteria | 1416 |
| 485 | Ga0501034_0022205 | 3300049571 | Bacteria | 6467 |
| 486 | Ga0501037_0068331 | 3300049573 | Bacteria | 2587 |
| 487 | Ga0501038_0000519 | 3300049574 | Bacteria | 33842 |
| 488 | Ga0501039_0007992 | 3300049575 | Bacteria | 8061 |
| 489 | Ga0501040_0136796 | 3300049576 | Bacteria | 1725 |
| 490 | Ga0501042_0071598 | 3300049578 | Bacteria | 2480 |
| 491 | Ga0501047_0029011 | 3300049581 | Bacteria | 5337 |
| 492 | Ga0501047_0140133 | 3300049581 | Bacteria | 2297 |
| 493 | Ga0501047_0248817 | 3300049581 | Unclassified | 1626 |
| 494 | Ga0501068_0040701 | 3300049584 | Bacteria | 2791 |
| 495 | Ga0501068_0099756 | 3300049584 | Bacteria | 1799 |
| 496 | Ga0501069_0024058 | 3300049585 | Bacteria | 3322 |
| 497 | Ga0501070_0004115 | 3300049586 | Bacteria | 12509 |
| 498 | Ga0501070_0051272 | 3300049586 | Bacteria | 3426 |
| 499 | Ga0501071_0096309 | 3300049587 | Bacteria | 2178 |
| 500 | Ga0501074_0000199 | 3300049590 | Bacteria | 32705 |
| 501 | Ga0501079_0051354 | 3300049741 | Bacteria | 3183 |
| 502 | Ga0501079_0125785 | 3300049741 | Bacteria | 1994 |
| 503 | Ga0501080_0084707 | 3300049742 | Bacteria | 2945 |
| 504 | Ga0501080_0116294 | 3300049742 | Bacteria | 2479 |
| 505 | Ga0501081_0085848 | 3300049743 | Bacteria | 2209 |
| 506 | Ga0501083_0005240 | 3300049744 | Bacteria | 9169 |
| 507 | Ga0501083_0028604 | 3300049744 | Bacteria | 3841 |
| 508 | Ga0501035_0117175 | 3300049822 | Bacteria | 2331 |
| 509 | Ga0501044_0020154 | 3300049823 | Bacteria | 7117 |
| 510 | Ga0501045_0034754 | 3300049824 | Bacteria | 3660 |
| 511 | nmdc:mga00v17_92671_c1 | 3300050491 | Bacteria | 1899 |
| 512 | nmdc:mga05p37_113586_c1 | 3300050507 | Bacteria | 3330 |
| 513 | nmdc:mga05p37_185582_c1 | 3300050507 | Bacteria | 2529 |
| 514 | nmdc:mga05p37_28488_c1 | 3300050507 | Bacteria | 6810 |
| 515 | nmdc:mga05p37_9870_c1 | 3300050507 | Bacteria | 11330 |
| 516 | nmdc:mga09592_71255_c1 | 3300050508 | Bacteria | 2950 |
| 517 | nmdc:mga0qj67_62323_c1 | 3300050509 | Bacteria | 2964 |
| 518 | nmdc:mga08y16_214782_c1 | 3300050511 | Bacteria | 1992 |
| 519 | nmdc:mga08y16_343764_c1 | 3300050511 | Bacteria | 1533 |
| 520 | nmdc:mga08y16_89101_c1 | 3300050511 | Bacteria | 3215 |
| 521 | nmdc:mga0n895_127117_c1 | 3300050512 | Bacteria | 2573 |
| 522 | nmdc:mga0n895_127494_c1 | 3300050512 | Bacteria | 2569 |
| 523 | nmdc:mga0n895_180667_c1 | 3300050512 | Bacteria | 2141 |
| 524 | nmdc:mga0n895_191006_c1 | 3300050512 | Bacteria | 2079 |
| 525 | nmdc:mga0rr50_166371_c1 | 3300050513 | Bacteria | 1793 |
| 526 | nmdc:mga0rr50_39097_c1 | 3300050513 | Bacteria | 3439 |
| 527 | nmdc:mga0rr50_97732_c1 | 3300050513 | Bacteria | 2300 |
| 528 | nmdc:mga08x19_108432_c1 | 3300050514 | Bacteria | 1850 |
| 529 | nmdc:mga0a205_16300_c1 | 3300050515 | Bacteria | 6958 |
| 530 | nmdc:mga0a205_19527_c1 | 3300050515 | Bacteria | 3113 |
| 531 | nmdc:mga0a205_89202_c1 | 3300050515 | Bacteria | 2981 |
| 532 | Ga0495601_0002202 | 3300053077 | Bacteria | 10973 |
| 533 | Ga0495595_0023116 | 3300053084 | Bacteria | 2734 |
| 534 | Ga0500555_032578 | 3300053103 | Bacteria | 1472 |
| 535 | Ga0500556_0005700 | 3300053104 | Bacteria | 3521 |
| 536 | Ga0500616_0058356 | 3300053153 | Bacteria | 2007 |
| 537 | Ga0500622_0003513 | 3300053156 | Bacteria | 10394 |
| 538 | Ga0500645_003049 | 3300053730 | Bacteria | 7048 |
| 539 | Ga0501082_0064146 | 3300060353 | Bacteria | 3163 |
| 540 | Ga0501082_0074299 | 3300060353 | Bacteria | 2928 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10003474 | Ga0265327_1000347413 | 340 |
| 2 | 3300048905 | Ga0496102_0039670 | Ga0496102_0039670_20_1060 | 345 |
| 3 | 3300050511 | nmdc:mga08y16_89101_c1 | nmdc:mga08y16_89101_c1_495_1739 | 345 |
| 4 | 3300035725 | Ga0373947_0212271 | Ga0373947_0212271_24_1070 | 348 |
| 5 | 3300044656 | Ga0466969_0020981 | Ga0466969_0020981_1685_2818 | 356 |
| 6 | 3300044684 | Ga0466966_0007967 | Ga0466966_0007967_150_1283 | 356 |
| 7 | 3300044693 | Ga0466961_0053400 | Ga0466961_0053400_77_1210 | 356 |
| 8 | 3300044712 | Ga0453684_0630801 | Ga0453684_0630801_23_1138 | 357 |
| 9 | 3300046516 | Ga0495628_0056358 | Ga0495628_0056358_1975_3054 | 357 |
| 10 | iso_pu_bacteria | 2902682994 | 2902691128 | 357 |
| 11 | 3300027665 | Ga0209983_1004988 | Ga0209983_10049883 | 359 |
| 12 | 3300046477 | Ga0495664_0063531 | Ga0495664_0063531_23_1111 | 360 |
| 13 | 3300031250 | Ga0265331_10008824 | Ga0265331_100088243 | 361 |
| 14 | 3300026142 | Ga0207698_10001935 | Ga0207698_1000193510 | 363 |
| 15 | 3300047443 | Ga0495687_025676 | Ga0495687_025676_1625_2740 | 364 |
| 16 | 3300049460 | Ga0495682_0008643 | Ga0495682_0008643_1807_2922 | 364 |
| 17 | 3300042436 | Ga0439435_0011159 | Ga0439435_0011159_40_1209 | 365 |
| 18 | 3300005543 | Ga0070672_100143098 | Ga0070672_1001430982 | 366 |
| 19 | 3300025940 | Ga0207691_10157268 | Ga0207691_101572682 | 366 |
| 20 | 3300025906 | Ga0207699_10006385 | Ga0207699_100063856 | 367 |
| 21 | 3300032133 | Ga0316583_10008031 | Ga0316583_100080313 | 367 |
| 22 | 3300035692 | Ga0373935_0002685 | Ga0373935_0002685_7487_8683 | 367 |
| 23 | 3300037068 | Ga0373925_0012595 | Ga0373925_0012595_946_2142 | 367 |
| 24 | 3300042437 | Ga0439444_0000285 | Ga0439444_0000285_174_1343 | 367 |
| 25 | 3300046472 | Ga0495580_0000941 | Ga0495580_0000941_13673_14869 | 367 |
| 26 | 3300050515 | nmdc:mga0a205_16300_c1 | nmdc:mga0a205_16300_c1_1438_2616 | 367 |
| 27 | iso_pu_bacteria | 2919125081 | 2919130065 | 367 |
| 28 | 3300009093 | Ga0105240_10014954 | Ga0105240_100149547 | 368 |
| 29 | 3300010375 | Ga0105239_10018971 | Ga0105239_100189713 | 368 |
| 30 | 3300035725 | Ga0373947_0097561 | Ga0373947_0097561_163_1272 | 368 |
| 31 | iso_pu_bacteria | 2917832318 | 2917834651 | 368 |
| 32 | 3300005329 | Ga0070683_100238747 | Ga0070683_1002387472 | 369 |
| 33 | 3300005437 | Ga0070710_10061387 | Ga0070710_100613872 | 369 |
| 34 | 3300031239 | Ga0265328_10000033 | Ga0265328_1000003318 | 369 |
| 35 | 3300031250 | Ga0265331_10000985 | Ga0265331_100009855 | 369 |
| 36 | 3300031251 | Ga0265327_10030504 | Ga0265327_100305042 | 369 |
| 37 | 3300031344 | Ga0265316_10003226 | Ga0265316_100032261 | 369 |
| 38 | 3300035398 | Ga0316574_0053394 | Ga0316574_0053394_1383_2495 | 369 |
| 39 | 3300035724 | Ga0373933_0241361 | Ga0373933_0241361_10_1137 | 369 |
| 40 | 3300046499 | Ga0495594_0002509 | Ga0495594_0002509_1108_2223 | 369 |
| 41 | 3300048909 | Ga0496106_0052801 | Ga0496106_0052801_417_1694 | 369 |
| 42 | 3300048912 | Ga0496109_0324145 | Ga0496109_0324145_76_1353 | 369 |
| 43 | 3300048917 | Ga0496114_0075123 | Ga0496114_0075123_51_1328 | 369 |
| 44 | 3300049581 | Ga0501047_0140133 | Ga0501047_0140133_818_2002 | 369 |
| 45 | 3300050513 | nmdc:mga0rr50_97732_c1 | nmdc:mga0rr50_97732_c1_106_1245 | 369 |
| 46 | 3300005435 | Ga0070714_100108572 | Ga0070714_1001085721 | 370 |
| 47 | 3300009174 | Ga0105241_10016625 | Ga0105241_100166252 | 370 |
| 48 | 3300031242 | Ga0265329_10033027 | Ga0265329_100330272 | 370 |
| 49 | 3300037312 | Ga0395899_0044720 | Ga0395899_0044720_1392_2510 | 370 |
| 50 | 3300045049 | Ga0466959_0104541 | Ga0466959_0104541_447_1622 | 370 |
| 51 | 3300050507 | nmdc:mga05p37_185582_c1 | nmdc:mga05p37_185582_c1_1034_2152 | 370 |
| 52 | 3300050515 | nmdc:mga0a205_89202_c1 | nmdc:mga0a205_89202_c1_989_2107 | 370 |
| 53 | iso_pu_bacteria | 2510065053 | 2510283502 | 370 |
| 54 | iso_pu_bacteria | 2510065055 | 2510292671 | 370 |
| 55 | iso_pu_bacteria | 2510065058 | 2510311762 | 370 |
| 56 | iso_pu_bacteria | 2512047030 | 2512344828 | 370 |
| 57 | iso_pu_bacteria | 2515154122 | 2515682603 | 370 |
| 58 | iso_pu_bacteria | 2885270888 | 2885279875 | 370 |
| 59 | 3300036401 | Ga0373937_0029822 | Ga0373937_0029822_312_1430 | 371 |
| 60 | 3300046543 | Ga0495645_0066993 | Ga0495645_0066993_1008_2126 | 371 |
| 61 | 3300005335 | Ga0070666_10074119 | Ga0070666_100741192 | 372 |
| 62 | 3300005355 | Ga0070671_100000127 | Ga0070671_1000001276 | 372 |
| 63 | 3300005617 | Ga0068859_100000254 | Ga0068859_10000025424 | 372 |
| 64 | 3300005841 | Ga0068863_100012758 | Ga0068863_1000127584 | 372 |
| 65 | 3300005842 | Ga0068858_100000203 | Ga0068858_1000002037 | 372 |
| 66 | 3300005843 | Ga0068860_100055465 | Ga0068860_1000554653 | 372 |
| 67 | 3300006931 | Ga0097620_100000254 | Ga0097620_10000025418 | 372 |
| 68 | 3300009101 | Ga0105247_10000313 | Ga0105247_100003137 | 372 |
| 69 | 3300009177 | Ga0105248_10028456 | Ga0105248_100284562 | 372 |
| 70 | 3300009553 | Ga0105249_10071698 | Ga0105249_100716982 | 372 |
| 71 | 3300014968 | Ga0157379_10052055 | Ga0157379_100520553 | 372 |
| 72 | 3300025900 | Ga0207710_10001182 | Ga0207710_100011828 | 372 |
| 73 | 3300025931 | Ga0207644_10039779 | Ga0207644_100397791 | 372 |
| 74 | 3300025934 | Ga0207686_10016963 | Ga0207686_100169632 | 372 |
| 75 | 3300025986 | Ga0207658_10004364 | Ga0207658_100043643 | 372 |
| 76 | 3300026035 | Ga0207703_10000154 | Ga0207703_1000015450 | 372 |
| 77 | 3300026088 | Ga0207641_10010419 | Ga0207641_100104195 | 372 |
| 78 | 3300046513 | Ga0495616_0061763 | Ga0495616_0061763_101_1228 | 372 |
| 79 | 3300047471 | Ga0495684_0203650 | Ga0495684_0203650_307_1437 | 372 |
| 80 | 3300048907 | Ga0496104_0024997 | Ga0496104_0024997_508_1635 | 372 |
| 81 | 3300048922 | Ga0496119_0013300 | Ga0496119_0013300_5021_6148 | 372 |
| 82 | 3300048924 | Ga0496121_0000844 | Ga0496121_0000844_40031_41263 | 372 |
| 83 | 3300048928 | Ga0496125_0002781 | Ga0496125_0002781_13893_15125 | 372 |
| 84 | 3300049578 | Ga0501042_0071598 | Ga0501042_0071598_462_1601 | 372 |
| 85 | 3300049584 | Ga0501068_0099756 | Ga0501068_0099756_23_1162 | 372 |
| 86 | 3300049741 | Ga0501079_0125785 | Ga0501079_0125785_292_1431 | 372 |
| 87 | 3300049743 | Ga0501081_0085848 | Ga0501081_0085848_744_1883 | 372 |
| 88 | 3300049744 | Ga0501083_0028604 | Ga0501083_0028604_741_1880 | 372 |
| 89 | 3300049824 | Ga0501045_0034754 | Ga0501045_0034754_2002_3141 | 372 |
| 90 | 3300060353 | Ga0501082_0064146 | Ga0501082_0064146_1501_2640 | 372 |
| 91 | 3300005438 | Ga0070701_10032652 | Ga0070701_100326523 | 373 |
| 92 | 3300005440 | Ga0070705_100017394 | Ga0070705_1000173943 | 373 |
| 93 | 3300005444 | Ga0070694_100023632 | Ga0070694_1000236322 | 373 |
| 94 | 3300005545 | Ga0070695_100153886 | Ga0070695_1001538862 | 373 |
| 95 | 3300005546 | Ga0070696_100062745 | Ga0070696_1000627453 | 373 |
| 96 | 3300005549 | Ga0070704_100061138 | Ga0070704_1000611381 | 373 |
| 97 | 3300005843 | Ga0068860_100074848 | Ga0068860_1000748482 | 373 |
| 98 | 3300026116 | Ga0207674_10015857 | Ga0207674_100158575 | 373 |
| 99 | 3300046517 | Ga0495630_0232820 | Ga0495630_0232820_63_1190 | 373 |
| 100 | 3300046524 | Ga0495648_0081679 | Ga0495648_0081679_648_1775 | 373 |
| 101 | 3300046529 | Ga0495652_0223242 | Ga0495652_0223242_63_1190 | 373 |
| 102 | 3300046665 | Ga0495661_0055005 | Ga0495661_0055005_19_1146 | 373 |
| 103 | 3300048906 | Ga0496103_0110372 | Ga0496103_0110372_23_1228 | 373 |
| 104 | 3300048929 | Ga0496126_0163937 | Ga0496126_0163937_86_1219 | 373 |
| 105 | 3300005327 | Ga0070658_10054592 | Ga0070658_100545922 | 374 |
| 106 | 3300005530 | Ga0070679_100060057 | Ga0070679_1000600572 | 374 |
| 107 | 3300025909 | Ga0207705_10089576 | Ga0207705_100895762 | 374 |
| 108 | 3300025921 | Ga0207652_10016504 | Ga0207652_100165042 | 374 |
| 109 | 3300046454 | Ga0495592_0015046 | Ga0495592_0015046_638_1768 | 374 |
| 110 | 3300046472 | Ga0495580_0079863 | Ga0495580_0079863_727_1857 | 374 |
| 111 | 3300046477 | Ga0495664_0017247 | Ga0495664_0017247_2385_3515 | 374 |
| 112 | 3300046500 | Ga0495596_0036086 | Ga0495596_0036086_588_1718 | 374 |
| 113 | 3300046514 | Ga0495618_0024891 | Ga0495618_0024891_1361_2491 | 374 |
| 114 | 3300046517 | Ga0495630_0008935 | Ga0495630_0008935_3047_4177 | 374 |
| 115 | 3300046526 | Ga0495666_0006258 | Ga0495666_0006258_3046_4176 | 374 |
| 116 | 3300046535 | Ga0495586_0031153 | Ga0495586_0031153_922_2052 | 374 |
| 117 | 3300046680 | Ga0495646_0029143 | Ga0495646_0029143_961_2091 | 374 |
| 118 | 3300046809 | Ga0495600_0024181 | Ga0495600_0024181_2273_3403 | 374 |
| 119 | 3300047315 | Ga0495581_0004044 | Ga0495581_0004044_4499_5629 | 374 |
| 120 | 3300047317 | Ga0495604_0056205 | Ga0495604_0056205_1361_2491 | 374 |
| 121 | 3300047319 | Ga0495674_0106409 | Ga0495674_0106409_984_2114 | 374 |
| 122 | 3300047322 | Ga0495680_0021810 | Ga0495680_0021810_3002_4132 | 374 |
| 123 | 3300047323 | Ga0495683_0018789 | Ga0495683_0018789_50_1180 | 374 |
| 124 | 3300047444 | Ga0495675_0030320 | Ga0495675_0030320_960_2090 | 374 |
| 125 | 3300048089 | Ga0495614_0001670 | Ga0495614_0001670_4881_6011 | 374 |
| 126 | 3300005435 | Ga0070714_100075316 | Ga0070714_1000753164 | 375 |
| 127 | 3300025929 | Ga0207664_10164136 | Ga0207664_101641361 | 375 |
| 128 | 3300039437 | Ga0436365_0340854 | Ga0436365_0340854_1210_2403 | 375 |
| 129 | 3300042876 | Ga0451577_0001674 | Ga0451577_0001674_4282_5454 | 375 |
| 130 | 3300044693 | Ga0466961_0003505 | Ga0466961_0003505_210_1349 | 375 |
| 131 | 3300046524 | Ga0495648_0043467 | Ga0495648_0043467_93_1226 | 375 |
| 132 | 3300049581 | Ga0501047_0248817 | Ga0501047_0248817_13_1458 | 375 |
| 133 | iso_pu_bacteria | 2510065045 | 2510252777 | 375 |
| 134 | 3300006914 | Ga0075436_100105739 | Ga0075436_1001057392 | 376 |
| 135 | 3300031824 | Ga0307413_10041634 | Ga0307413_100416343 | 376 |
| 136 | 3300031852 | Ga0307410_10083569 | Ga0307410_100835692 | 376 |
| 137 | 3300031995 | Ga0307409_100062999 | Ga0307409_1000629992 | 376 |
| 138 | 3300032004 | Ga0307414_10031614 | Ga0307414_100316142 | 376 |
| 139 | 3300044735 | Ga0466968_0009970 | Ga0466968_0009970_32_1174 | 376 |
| 140 | iso_pu_bacteria | 2842454564 | 2842461740 | 376 |
| 141 | 3300005327 | Ga0070658_10073956 | Ga0070658_100739562 | 377 |
| 142 | 3300009093 | Ga0105240_10287330 | Ga0105240_102873302 | 377 |
| 143 | 3300013104 | Ga0157370_10002401 | Ga0157370_100024011 | 377 |
| 144 | 3300046459 | Ga0495629_0088334 | Ga0495629_0088334_663_1889 | 377 |
| 145 | 3300047322 | Ga0495680_0163593 | Ga0495680_0163593_298_1524 | 377 |
| 146 | 3300049742 | Ga0501080_0116294 | Ga0501080_0116294_117_1334 | 377 |
| 147 | 3300005614 | Ga0068856_100274304 | Ga0068856_1002743042 | 378 |
| 148 | 3300009094 | Ga0111539_10218267 | Ga0111539_102182672 | 378 |
| 149 | 3300010375 | Ga0105239_10163782 | Ga0105239_101637822 | 378 |
| 150 | 3300025923 | Ga0207681_10273368 | Ga0207681_102733682 | 378 |
| 151 | 3300025972 | Ga0207668_10039681 | Ga0207668_100396813 | 378 |
| 152 | 3300035113 | Ga0373936_0042858 | Ga0373936_0042858_14_1252 | 378 |
| 153 | 3300037418 | Ga0395900_0148518 | Ga0395900_0148518_1116_2327 | 378 |
| 154 | 3300046474 | Ga0495605_0007332 | Ga0495605_0007332_2416_3561 | 378 |
| 155 | 3300046501 | Ga0495607_0000864 | Ga0495607_0000864_26283_27428 | 378 |
| 156 | 3300046513 | Ga0495616_0012264 | Ga0495616_0012264_3158_4303 | 378 |
| 157 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_199483_200628 | 378 |
| 158 | 3300046665 | Ga0495661_0000361 | Ga0495661_0000361_42055_43200 | 378 |
| 159 | 3300046794 | Ga0495589_0000119 | Ga0495589_0000119_30102_31247 | 378 |
| 160 | 3300047443 | Ga0495687_000019 | Ga0495687_000019_199483_200628 | 378 |
| 161 | 3300047445 | Ga0495677_0000020 | Ga0495677_0000020_28683_29828 | 378 |
| 162 | 3300048091 | Ga0495626_0000514 | Ga0495626_0000514_13978_15123 | 378 |
| 163 | 3300050511 | nmdc:mga08y16_343764_c1 | nmdc:mga08y16_343764_c1_291_1472 | 378 |
| 164 | 3300005331 | Ga0070670_100077674 | Ga0070670_1000776742 | 379 |
| 165 | 3300005338 | Ga0068868_100075406 | Ga0068868_1000754063 | 379 |
| 166 | 3300005354 | Ga0070675_100030307 | Ga0070675_1000303072 | 379 |
| 167 | 3300005355 | Ga0070671_100053067 | Ga0070671_1000530673 | 379 |
| 168 | 3300005459 | Ga0068867_100017620 | Ga0068867_1000176203 | 379 |
| 169 | 3300009147 | Ga0114129_10031994 | Ga0114129_100319949 | 379 |
| 170 | 3300032002 | Ga0307416_100152503 | Ga0307416_1001525032 | 379 |
| 171 | 3300045051 | Ga0451576_0078641 | Ga0451576_0078641_893_2080 | 379 |
| 172 | 3300046457 | Ga0495590_0056963 | Ga0495590_0056963_199_1347 | 379 |
| 173 | 3300046459 | Ga0495629_0000811 | Ga0495629_0000811_9795_10943 | 379 |
| 174 | 3300046462 | Ga0495651_0042505 | Ga0495651_0042505_2043_3191 | 379 |
| 175 | 3300046678 | Ga0495599_0021734 | Ga0495599_0021734_2408_3556 | 379 |
| 176 | 3300046679 | Ga0495623_0003256 | Ga0495623_0003256_5518_6666 | 379 |
| 177 | 3300047317 | Ga0495604_0001390 | Ga0495604_0001390_13623_14771 | 379 |
| 178 | 3300047322 | Ga0495680_0033770 | Ga0495680_0033770_2305_3453 | 379 |
| 179 | 3300047444 | Ga0495675_0005909 | Ga0495675_0005909_1604_2752 | 379 |
| 180 | 3300048088 | Ga0495602_0025808 | Ga0495602_0025808_449_1597 | 379 |
| 181 | 3300050507 | nmdc:mga05p37_113586_c1 | nmdc:mga05p37_113586_c1_626_1771 | 379 |
| 182 | 3300009176 | Ga0105242_10024261 | Ga0105242_100242614 | 380 |
| 183 | 3300045051 | Ga0451576_0000487 | Ga0451576_0000487_12236_13402 | 380 |
| 184 | 3300048907 | Ga0496104_0070619 | Ga0496104_0070619_337_1491 | 380 |
| 185 | 3300048908 | Ga0496105_0080529 | Ga0496105_0080529_571_1725 | 380 |
| 186 | 3300049586 | Ga0501070_0051272 | Ga0501070_0051272_1627_2823 | 380 |
| 187 | 3300049742 | Ga0501080_0084707 | Ga0501080_0084707_540_1736 | 380 |
| 188 | 3300050513 | nmdc:mga0rr50_166371_c1 | nmdc:mga0rr50_166371_c1_601_1749 | 380 |
| 189 | 3300003354 | JGI25160J50197_1005372 | JGI25160J50197_10053724 | 381 |
| 190 | 3300009147 | Ga0114129_10290750 | Ga0114129_102907503 | 381 |
| 191 | 3300025302 | Ga0207426_1000133 | Ga0207426_100013312 | 381 |
| 192 | 3300028556 | Ga0265337_1004722 | Ga0265337_10047228 | 381 |
| 193 | 3300044684 | Ga0466966_0102167 | Ga0466966_0102167_108_1307 | 381 |
| 194 | 3300003323 | rootH1_10221365 | rootH1_102213652 | 382 |
| 195 | 3300005614 | Ga0068856_100009768 | Ga0068856_1000097686 | 382 |
| 196 | 3300009093 | Ga0105240_10012185 | Ga0105240_100121855 | 382 |
| 197 | 3300009553 | Ga0105249_10368148 | Ga0105249_103681482 | 382 |
| 198 | 3300025913 | Ga0207695_10110144 | Ga0207695_101101441 | 382 |
| 199 | 3300025932 | Ga0207690_10011697 | Ga0207690_100116972 | 382 |
| 200 | 3300026078 | Ga0207702_10005748 | Ga0207702_100057483 | 382 |
| 201 | 3300031995 | Ga0307409_100316197 | Ga0307409_1003161971 | 382 |
| 202 | 3300009036 | Ga0105244_10009635 | Ga0105244_100096353 | 383 |
| 203 | 3300025711 | Ga0207696_1019337 | Ga0207696_10193372 | 383 |
| 204 | 3300025728 | Ga0207655_1000302 | Ga0207655_100030263 | 383 |
| 205 | 3300025735 | Ga0207713_1008178 | Ga0207713_10081782 | 383 |
| 206 | 3300031251 | Ga0265327_10000732 | Ga0265327_100007327 | 383 |
| 207 | 3300031344 | Ga0265316_10000940 | Ga0265316_1000094015 | 383 |
| 208 | 3300031730 | Ga0307516_10172558 | Ga0307516_101725582 | 383 |
| 209 | 3300046522 | Ga0495643_0000297 | Ga0495643_0000297_66332_67534 | 383 |
| 210 | 3300048917 | Ga0496114_0087875 | Ga0496114_0087875_216_1418 | 383 |
| 211 | 3300048920 | Ga0496117_0001813 | Ga0496117_0001813_25716_26918 | 383 |
| 212 | 3300048921 | Ga0496118_0002545 | Ga0496118_0002545_2031_3233 | 383 |
| 213 | 3300048927 | Ga0496124_0011304 | Ga0496124_0011304_2148_3350 | 383 |
| 214 | 3300048928 | Ga0496125_0036295 | Ga0496125_0036295_2600_3802 | 383 |
| 215 | iso_pu_bacteria | 2854601825 | 2854602410 | 383 |
| 216 | 3300020082 | Ga0206353_11325052 | Ga0206353_113250524 | 384 |
| 217 | 3300031911 | Ga0307412_10043816 | Ga0307412_100438163 | 384 |
| 218 | 3300048925 | Ga0496122_0002159 | Ga0496122_0002159_25479_26681 | 384 |
| 219 | 3300048926 | Ga0496123_0000240 | Ga0496123_0000240_2148_3350 | 384 |
| 220 | 3300050509 | nmdc:mga0qj67_62323_c1 | nmdc:mga0qj67_62323_c1_564_1733 | 384 |
| 221 | 3300053103 | Ga0500555_032578 | Ga0500555_032578_289_1443 | 384 |
| 222 | 3300053153 | Ga0500616_0058356 | Ga0500616_0058356_63_1217 | 384 |
| 223 | iso_pu_bacteria | 2515154123 | 2515690581 | 384 |
| 224 | iso_pu_bacteria | 2547132103 | 2547371098 | 384 |
| 225 | iso_pu_bacteria | 2843690924 | 2843692227 | 384 |
| 226 | iso_pu_bacteria | 8011350971 | 8011353139 | 384 |
| 227 | 3300003316 | rootH1_10028768 | rootH1_100287687 | 385 |
| 228 | 3300005434 | Ga0070709_10023928 | Ga0070709_100239282 | 385 |
| 229 | 3300005436 | Ga0070713_100007605 | Ga0070713_1000076052 | 385 |
| 230 | 3300006844 | Ga0075428_100016727 | Ga0075428_1000167278 | 385 |
| 231 | 3300006880 | Ga0075429_100081567 | Ga0075429_1000815673 | 385 |
| 232 | 3300025906 | Ga0207699_10073001 | Ga0207699_100730012 | 385 |
| 233 | 3300025928 | Ga0207700_10119817 | Ga0207700_101198172 | 385 |
| 234 | 3300037471 | Ga0395905_0306006 | Ga0395905_0306006_136_1317 | 385 |
| 235 | 3300050511 | nmdc:mga08y16_214782_c1 | nmdc:mga08y16_214782_c1_349_1536 | 385 |
| 236 | 3300005458 | Ga0070681_10185841 | Ga0070681_101858412 | 386 |
| 237 | 3300005530 | Ga0070679_100139494 | Ga0070679_1001394942 | 386 |
| 238 | 3300026035 | Ga0207703_10010146 | Ga0207703_100101465 | 386 |
| 239 | 3300038443 | Ga0395901_0002028 | Ga0395901_0002028_6550_7734 | 386 |
| 240 | 3300049569 | Ga0501032_0035848 | Ga0501032_0035848_923_2083 | 386 |
| 241 | 3300049570 | Ga0501033_0202891 | Ga0501033_0202891_17_1177 | 386 |
| 242 | 3300049571 | Ga0501034_0022205 | Ga0501034_0022205_1478_2638 | 386 |
| 243 | 3300049573 | Ga0501037_0068331 | Ga0501037_0068331_923_2083 | 386 |
| 244 | 3300049574 | Ga0501038_0000519 | Ga0501038_0000519_1286_2446 | 386 |
| 245 | 3300049575 | Ga0501039_0007992 | Ga0501039_0007992_5518_6678 | 386 |
| 246 | 3300049823 | Ga0501044_0020154 | Ga0501044_0020154_4736_5896 | 386 |
| 247 | iso_pu_bacteria | 2739367865 | 2740030887 | 386 |
| 248 | iso_pu_bacteria | 8054002106 | 8054003528 | 386 |
| 249 | iso_pu_bacteria | 2984504281 | 2984507968 | 387 |
| 250 | iso_pu_bacteria | 8016728285 | 8016729860 | 387 |
| 251 | 3300003759 | Ga0055525_1000105 | Ga0055525_100010578 | 388 |
| 252 | 3300005518 | Ga0070699_100055187 | Ga0070699_1000551875 | 388 |
| 253 | 3300005563 | Ga0068855_100116964 | Ga0068855_1001169642 | 388 |
| 254 | 3300013297 | Ga0157378_10228805 | Ga0157378_102288052 | 388 |
| 255 | 3300025230 | Ga0209563_100007 | Ga0209563_1000071299 | 388 |
| 256 | 3300025253 | Ga0209677_104952 | Ga0209677_1049522 | 388 |
| 257 | 3300025909 | Ga0207705_10162894 | Ga0207705_101628942 | 388 |
| 258 | 3300025919 | Ga0207657_10005977 | Ga0207657_1000597714 | 388 |
| 259 | 3300025932 | Ga0207690_10027053 | Ga0207690_100270534 | 388 |
| 260 | 3300026089 | Ga0207648_10233850 | Ga0207648_102338502 | 388 |
| 261 | 3300037312 | Ga0395899_0064005 | Ga0395899_0064005_580_1764 | 388 |
| 262 | 3300037418 | Ga0395900_0000261 | Ga0395900_0000261_3741_4925 | 388 |
| 263 | 3300037418 | Ga0395900_0070805 | Ga0395900_0070805_1741_2925 | 388 |
| 264 | 3300037466 | Ga0395898_0265368 | Ga0395898_0265368_218_1402 | 388 |
| 265 | 3300037471 | Ga0395905_0069138 | Ga0395905_0069138_1567_2751 | 388 |
| 266 | 3300042876 | Ga0451577_0067463 | Ga0451577_0067463_240_1424 | 388 |
| 267 | 3300044684 | Ga0466966_0021298 | Ga0466966_0021298_2074_3258 | 388 |
| 268 | 3300044684 | Ga0466966_0069595 | Ga0466966_0069595_568_1752 | 388 |
| 269 | 3300044712 | Ga0453684_0299789 | Ga0453684_0299789_20_1204 | 388 |
| 270 | 3300045049 | Ga0466959_0051294 | Ga0466959_0051294_698_1882 | 388 |
| 271 | 3300045051 | Ga0451576_0339119 | Ga0451576_0339119_76_1260 | 388 |
| 272 | 3300046473 | Ga0495582_0035033 | Ga0495582_0035033_917_2098 | 388 |
| 273 | 3300046501 | Ga0495607_0007171 | Ga0495607_0007171_559_1743 | 388 |
| 274 | 3300046524 | Ga0495648_0009521 | Ga0495648_0009521_5941_7125 | 388 |
| 275 | 3300046529 | Ga0495652_0027084 | Ga0495652_0027084_47_1228 | 388 |
| 276 | 3300046531 | Ga0495665_0021341 | Ga0495665_0021341_314_1495 | 388 |
| 277 | 3300046642 | Ga0495634_0016033 | Ga0495634_0016033_1681_2862 | 388 |
| 278 | 3300046665 | Ga0495661_0034167 | Ga0495661_0034167_1452_2636 | 388 |
| 279 | 3300046665 | Ga0495661_0042079 | Ga0495661_0042079_895_2079 | 388 |
| 280 | 3300046674 | Ga0495588_0000067 | Ga0495588_0000067_62679_63863 | 388 |
| 281 | 3300046810 | Ga0495660_0031011 | Ga0495660_0031011_1542_2732 | 388 |
| 282 | 3300047317 | Ga0495604_0079855 | Ga0495604_0079855_844_2025 | 388 |
| 283 | 3300047444 | Ga0495675_0036224 | Ga0495675_0036224_1045_2226 | 388 |
| 284 | 3300048916 | Ga0496113_0074539 | Ga0496113_0074539_956_2140 | 388 |
| 285 | 3300048925 | Ga0496122_0002956 | Ga0496122_0002956_5501_6685 | 388 |
| 286 | 3300048926 | Ga0496123_0006252 | Ga0496123_0006252_10229_11413 | 388 |
| 287 | 3300048927 | Ga0496124_0082297 | Ga0496124_0082297_344_1528 | 388 |
| 288 | 3300048927 | Ga0496124_0165825 | Ga0496124_0165825_393_1586 | 388 |
| 289 | 3300005331 | Ga0070670_100143551 | Ga0070670_1001435511 | 389 |
| 290 | 3300005366 | Ga0070659_100038694 | Ga0070659_1000386941 | 389 |
| 291 | 3300005434 | Ga0070709_10005586 | Ga0070709_100055867 | 389 |
| 292 | 3300005435 | Ga0070714_100024010 | Ga0070714_1000240105 | 389 |
| 293 | 3300005547 | Ga0070693_100000614 | Ga0070693_1000006146 | 389 |
| 294 | 3300005563 | Ga0068855_100008681 | Ga0068855_10000868111 | 389 |
| 295 | 3300005841 | Ga0068863_100058574 | Ga0068863_1000585745 | 389 |
| 296 | 3300005842 | Ga0068858_100024569 | Ga0068858_1000245692 | 389 |
| 297 | 3300005843 | Ga0068860_100139181 | Ga0068860_1001391812 | 389 |
| 298 | 3300006175 | Ga0070712_100064762 | Ga0070712_1000647622 | 389 |
| 299 | 3300006237 | Ga0097621_100022940 | Ga0097621_1000229404 | 389 |
| 300 | 3300006237 | Ga0097621_100061839 | Ga0097621_1000618392 | 389 |
| 301 | 3300006358 | Ga0068871_100002257 | Ga0068871_1000022572 | 389 |
| 302 | 3300009093 | Ga0105240_10191971 | Ga0105240_101919712 | 389 |
| 303 | 3300009098 | Ga0105245_10050924 | Ga0105245_100509243 | 389 |
| 304 | 3300009176 | Ga0105242_10129482 | Ga0105242_101294822 | 389 |
| 305 | 3300009177 | Ga0105248_10009725 | Ga0105248_100097255 | 389 |
| 306 | 3300009553 | Ga0105249_10109336 | Ga0105249_101093362 | 389 |
| 307 | 3300013297 | Ga0157378_10141059 | Ga0157378_101410592 | 389 |
| 308 | 3300014968 | Ga0157379_10199639 | Ga0157379_101996392 | 389 |
| 309 | 3300025913 | Ga0207695_10004160 | Ga0207695_1000416019 | 389 |
| 310 | 3300025916 | Ga0207663_10007869 | Ga0207663_100078694 | 389 |
| 311 | 3300025927 | Ga0207687_10080001 | Ga0207687_100800012 | 389 |
| 312 | 3300025941 | Ga0207711_10020200 | Ga0207711_100202002 | 389 |
| 313 | 3300025942 | Ga0207689_10029785 | Ga0207689_100297854 | 389 |
| 314 | 3300025949 | Ga0207667_10023940 | Ga0207667_100239404 | 389 |
| 315 | 3300026088 | Ga0207641_10031087 | Ga0207641_100310872 | 389 |
| 316 | 3300028379 | Ga0268266_10000797 | Ga0268266_1000079738 | 389 |
| 317 | 3300035691 | Ga0373931_0181794 | Ga0373931_0181794_43_1227 | 389 |
| 318 | 3300037312 | Ga0395899_0002465 | Ga0395899_0002465_8694_9887 | 389 |
| 319 | 3300037418 | Ga0395900_0016708 | Ga0395900_0016708_4819_6012 | 389 |
| 320 | 3300037471 | Ga0395905_0007129 | Ga0395905_0007129_8929_10122 | 389 |
| 321 | 3300046511 | Ga0495608_0007920 | Ga0495608_0007920_458_1642 | 389 |
| 322 | 3300046536 | Ga0495587_0022047 | Ga0495587_0022047_1958_3142 | 389 |
| 323 | 3300046543 | Ga0495645_0045979 | Ga0495645_0045979_227_1411 | 389 |
| 324 | 3300046663 | Ga0495635_0120419 | Ga0495635_0120419_150_1334 | 389 |
| 325 | 3300046675 | Ga0495657_0048491 | Ga0495657_0048491_570_1754 | 389 |
| 326 | 3300046678 | Ga0495599_0003108 | Ga0495599_0003108_4519_5703 | 389 |
| 327 | 3300048918 | Ga0496115_0149325 | Ga0496115_0149325_668_1882 | 389 |
| 328 | 3300050515 | nmdc:mga0a205_19527_c1 | nmdc:mga0a205_19527_c1_495_1679 | 389 |
| 329 | 3300053077 | Ga0495601_0002202 | Ga0495601_0002202_2211_3395 | 389 |
| 330 | 3300053084 | Ga0495595_0023116 | Ga0495595_0023116_492_1676 | 389 |
| 331 | iso_pu_bacteria | 2501025502 | 2501079375 | 389 |
| 332 | iso_pu_bacteria | 2510917013 | 2511093747 | 389 |
| 333 | iso_pu_bacteria | 2883087390 | 2883094253 | 389 |
| 334 | 3300005535 | Ga0070684_100180921 | Ga0070684_1001809211 | 390 |
| 335 | 3300050507 | nmdc:mga05p37_9870_c1 | nmdc:mga05p37_9870_c1_6651_7967 | 390 |
| 336 | iso_pu_bacteria | 2599185240 | 2599743836 | 390 |
| 337 | iso_pu_bacteria | 2599185355 | 2600207096 | 390 |
| 338 | iso_pu_bacteria | 2617270889 | 2617917762 | 390 |
| 339 | iso_pu_bacteria | 2675903129 | 2676742379 | 390 |
| 340 | iso_pu_bacteria | 642555144 | 642606002 | 390 |
| 341 | 3300005468 | Ga0070707_100046822 | Ga0070707_1000468223 | 391 |
| 342 | 3300025922 | Ga0207646_10038070 | Ga0207646_100380702 | 391 |
| 343 | 3300031241 | Ga0265325_10064277 | Ga0265325_100642772 | 391 |
| 344 | 3300031595 | Ga0265313_10082319 | Ga0265313_100823192 | 391 |
| 345 | 3300037312 | Ga0395899_0177982 | Ga0395899_0177982_54_1247 | 391 |
| 346 | 3300044684 | Ga0466966_0003657 | Ga0466966_0003657_6394_7596 | 391 |
| 347 | 3300046675 | Ga0495657_0121978 | Ga0495657_0121978_362_1564 | 391 |
| 348 | 3300053730 | Ga0500645_003049 | Ga0500645_003049_4068_5267 | 391 |
| 349 | iso_pu_bacteria | 2515154189 | 2516023261 | 391 |
| 350 | iso_pu_bacteria | 2744054900 | 2746085378 | 391 |
| 351 | iso_pu_bacteria | 2744054901 | 2746093826 | 391 |
| 352 | iso_pu_bacteria | 2932422444 | 2932426207 | 391 |
| 353 | 3300005330 | Ga0070690_100016759 | Ga0070690_1000167593 | 392 |
| 354 | 3300005331 | Ga0070670_100020645 | Ga0070670_1000206453 | 392 |
| 355 | 3300005335 | Ga0070666_10005581 | Ga0070666_100055814 | 392 |
| 356 | 3300005339 | Ga0070660_100005781 | Ga0070660_1000057812 | 392 |
| 357 | 3300005344 | Ga0070661_100000186 | Ga0070661_10000018626 | 392 |
| 358 | 3300005344 | Ga0070661_100043986 | Ga0070661_1000439862 | 392 |
| 359 | 3300005355 | Ga0070671_100025818 | Ga0070671_1000258183 | 392 |
| 360 | 3300005364 | Ga0070673_100177974 | Ga0070673_1001779742 | 392 |
| 361 | 3300005367 | Ga0070667_100029243 | Ga0070667_1000292432 | 392 |
| 362 | 3300005455 | Ga0070663_100025474 | Ga0070663_1000254742 | 392 |
| 363 | 3300005535 | Ga0070684_100094419 | Ga0070684_1000944192 | 392 |
| 364 | 3300005543 | Ga0070672_100015991 | Ga0070672_1000159913 | 392 |
| 365 | 3300005544 | Ga0070686_100005417 | Ga0070686_1000054172 | 392 |
| 366 | 3300005548 | Ga0070665_100027217 | Ga0070665_1000272174 | 392 |
| 367 | 3300005563 | Ga0068855_100006232 | Ga0068855_1000062326 | 392 |
| 368 | 3300005563 | Ga0068855_100034454 | Ga0068855_1000344542 | 392 |
| 369 | 3300005577 | Ga0068857_100046384 | Ga0068857_1000463843 | 392 |
| 370 | 3300005614 | Ga0068856_100036273 | Ga0068856_1000362731 | 392 |
| 371 | 3300005616 | Ga0068852_100028698 | Ga0068852_1000286983 | 392 |
| 372 | 3300005618 | Ga0068864_100003677 | Ga0068864_1000036774 | 392 |
| 373 | 3300005841 | Ga0068863_100041936 | Ga0068863_1000419363 | 392 |
| 374 | 3300006048 | Ga0075363_100007251 | Ga0075363_1000072516 | 392 |
| 375 | 3300009093 | Ga0105240_10040270 | Ga0105240_100402707 | 392 |
| 376 | 3300009148 | Ga0105243_10093281 | Ga0105243_100932812 | 392 |
| 377 | 3300009177 | Ga0105248_10002999 | Ga0105248_100029992 | 392 |
| 378 | 3300009545 | Ga0105237_10137386 | Ga0105237_101373864 | 392 |
| 379 | 3300009551 | Ga0105238_10016029 | Ga0105238_100160294 | 392 |
| 380 | 3300010375 | Ga0105239_10051952 | Ga0105239_100519524 | 392 |
| 381 | 3300011119 | Ga0105246_10082796 | Ga0105246_100827962 | 392 |
| 382 | 3300011119 | Ga0105246_10215816 | Ga0105246_102158161 | 392 |
| 383 | 3300013104 | Ga0157370_10024486 | Ga0157370_100244862 | 392 |
| 384 | 3300013105 | Ga0157369_10057502 | Ga0157369_100575024 | 392 |
| 385 | 3300013308 | Ga0157375_10004870 | Ga0157375_100048705 | 392 |
| 386 | 3300014325 | Ga0163163_10086144 | Ga0163163_100861443 | 392 |
| 387 | 3300014326 | Ga0157380_10005633 | Ga0157380_100056333 | 392 |
| 388 | 3300025909 | Ga0207705_10015761 | Ga0207705_100157611 | 392 |
| 389 | 3300025913 | Ga0207695_10012469 | Ga0207695_1001246913 | 392 |
| 390 | 3300025919 | Ga0207657_10041344 | Ga0207657_100413444 | 392 |
| 391 | 3300025920 | Ga0207649_10000182 | Ga0207649_1000018228 | 392 |
| 392 | 3300025920 | Ga0207649_10013314 | Ga0207649_100133143 | 392 |
| 393 | 3300025924 | Ga0207694_10004671 | Ga0207694_1000467111 | 392 |
| 394 | 3300025925 | Ga0207650_10004559 | Ga0207650_100045594 | 392 |
| 395 | 3300025926 | Ga0207659_10097937 | Ga0207659_100979371 | 392 |
| 396 | 3300025931 | Ga0207644_10002358 | Ga0207644_100023588 | 392 |
| 397 | 3300025940 | Ga0207691_10010599 | Ga0207691_100105997 | 392 |
| 398 | 3300025945 | Ga0207679_10026681 | Ga0207679_100266813 | 392 |
| 399 | 3300025949 | Ga0207667_10011187 | Ga0207667_100111875 | 392 |
| 400 | 3300025986 | Ga0207658_10019967 | Ga0207658_100199672 | 392 |
| 401 | 3300026023 | Ga0207677_10021441 | Ga0207677_100214412 | 392 |
| 402 | 3300026035 | Ga0207703_10054184 | Ga0207703_100541843 | 392 |
| 403 | 3300026067 | Ga0207678_10006866 | Ga0207678_1000686611 | 392 |
| 404 | 3300026078 | Ga0207702_10075834 | Ga0207702_100758344 | 392 |
| 405 | 3300026089 | Ga0207648_10020125 | Ga0207648_100201255 | 392 |
| 406 | 3300026095 | Ga0207676_10014491 | Ga0207676_100144913 | 392 |
| 407 | 3300026116 | Ga0207674_10011424 | Ga0207674_100114248 | 392 |
| 408 | 3300026142 | Ga0207698_10005706 | Ga0207698_1000570611 | 392 |
| 409 | 3300036401 | Ga0373937_0045373 | Ga0373937_0045373_655_1866 | 392 |
| 410 | 3300036401 | Ga0373937_0094244 | Ga0373937_0094244_781_1992 | 392 |
| 411 | 3300046459 | Ga0495629_0067330 | Ga0495629_0067330_108_1319 | 392 |
| 412 | 3300046511 | Ga0495608_0014909 | Ga0495608_0014909_2134_3345 | 392 |
| 413 | 3300046514 | Ga0495618_0050634 | Ga0495618_0050634_113_1324 | 392 |
| 414 | 3300046559 | Ga0495667_0000869 | Ga0495667_0000869_8995_10206 | 392 |
| 415 | 3300046675 | Ga0495657_0009818 | Ga0495657_0009818_5225_6436 | 392 |
| 416 | 3300047319 | Ga0495674_0014809 | Ga0495674_0014809_3953_5164 | 392 |
| 417 | 3300003187 | JGI25151J46595_10000180 | JGI25151J46595_1000018075 | 393 |
| 418 | 3300005842 | Ga0068858_100000022 | Ga0068858_10000002241 | 393 |
| 419 | 3300006178 | Ga0075367_10137986 | Ga0075367_101379862 | 393 |
| 420 | 3300006871 | Ga0075434_100018036 | Ga0075434_1000180363 | 393 |
| 421 | 3300009177 | Ga0105248_10077490 | Ga0105248_100774904 | 393 |
| 422 | 3300025294 | Ga0209025_1000422 | Ga0209025_10004229 | 393 |
| 423 | 3300025297 | Ga0209758_1005688 | Ga0209758_10056888 | 393 |
| 424 | 3300026035 | Ga0207703_10001177 | Ga0207703_100011773 | 393 |
| 425 | 3300026089 | Ga0207648_10037177 | Ga0207648_100371773 | 393 |
| 426 | 3300031727 | Ga0316576_10014728 | Ga0316576_100147284 | 393 |
| 427 | 3300035172 | Ga0373955_0101808 | Ga0373955_0101808_287_1504 | 393 |
| 428 | 3300037312 | Ga0395899_0060459 | Ga0395899_0060459_1534_2733 | 393 |
| 429 | 3300037312 | Ga0395899_0198281 | Ga0395899_0198281_137_1336 | 393 |
| 430 | 3300037418 | Ga0395900_0002552 | Ga0395900_0002552_9247_10446 | 393 |
| 431 | 3300037418 | Ga0395900_0249772 | Ga0395900_0249772_394_1593 | 393 |
| 432 | 3300037471 | Ga0395905_0163217 | Ga0395905_0163217_188_1387 | 393 |
| 433 | 3300038443 | Ga0395901_0000174 | Ga0395901_0000174_79858_81057 | 393 |
| 434 | 3300044684 | Ga0466966_0000712 | Ga0466966_0000712_17872_19074 | 393 |
| 435 | 3300045836 | Ga0466958_0119735 | Ga0466958_0119735_197_1396 | 393 |
| 436 | 3300046455 | Ga0495603_0021934 | Ga0495603_0021934_1624_2832 | 393 |
| 437 | 3300046472 | Ga0495580_0024473 | Ga0495580_0024473_704_1912 | 393 |
| 438 | 3300046472 | Ga0495580_0139211 | Ga0495580_0139211_392_1600 | 393 |
| 439 | 3300046506 | Ga0495583_0005563 | Ga0495583_0005563_2987_4195 | 393 |
| 440 | 3300046524 | Ga0495648_0014734 | Ga0495648_0014734_4030_5238 | 393 |
| 441 | 3300047443 | Ga0495687_023966 | Ga0495687_023966_1309_2517 | 393 |
| 442 | 3300048910 | Ga0496107_0007560 | Ga0496107_0007560_1016_2215 | 393 |
| 443 | 3300048929 | Ga0496126_0001308 | Ga0496126_0001308_9273_10481 | 393 |
| 444 | 3300049460 | Ga0495682_0018106 | Ga0495682_0018106_329_1537 | 393 |
| 445 | 3300050508 | nmdc:mga09592_71255_c1 | nmdc:mga09592_71255_c1_363_1586 | 393 |
| 446 | 3300050512 | nmdc:mga0n895_180667_c1 | nmdc:mga0n895_180667_c1_712_1968 | 393 |
| 447 | iso_pu_bacteria | 2513237087 | 2513590080 | 393 |
| 448 | iso_pu_bacteria | 2844533157 | 2844535607 | 393 |
| 449 | 3300002739 | JGI25158J39367_1001623 | JGI25158J39367_10016234 | 394 |
| 450 | 3300003374 | JGI25161J50226_1000762 | JGI25161J50226_10007624 | 394 |
| 451 | 3300003374 | JGI25161J50226_1002283 | JGI25161J50226_10022832 | 394 |
| 452 | 3300003773 | Ga0055537_1004952 | Ga0055537_10049522 | 394 |
| 453 | 3300003773 | Ga0055537_1007027 | Ga0055537_10070273 | 394 |
| 454 | 3300003775 | Ga0055524_1004541 | Ga0055524_10045414 | 394 |
| 455 | 3300004625 | Ga0055543_1000446 | Ga0055543_100044615 | 394 |
| 456 | 3300005262 | Ga0065165_1001563 | Ga0065165_100156315 | 394 |
| 457 | 3300005438 | Ga0070701_10031634 | Ga0070701_100316341 | 394 |
| 458 | 3300005549 | Ga0070704_100042738 | Ga0070704_1000427382 | 394 |
| 459 | 3300005618 | Ga0068864_100000124 | Ga0068864_10000012465 | 394 |
| 460 | 3300005719 | Ga0068861_100035001 | Ga0068861_1000350013 | 394 |
| 461 | 3300006852 | Ga0075433_10026512 | Ga0075433_100265123 | 394 |
| 462 | 3300006871 | Ga0075434_100050982 | Ga0075434_1000509824 | 394 |
| 463 | 3300007076 | Ga0075435_100109009 | Ga0075435_1001090093 | 394 |
| 464 | 3300009147 | Ga0114129_10217668 | Ga0114129_102176684 | 394 |
| 465 | 3300013306 | Ga0163162_10002725 | Ga0163162_1000272514 | 394 |
| 466 | 3300014326 | Ga0157380_10038216 | Ga0157380_100382164 | 394 |
| 467 | 3300025208 | Ga0209436_100271 | Ga0209436_1002716 | 394 |
| 468 | 3300025263 | Ga0209565_1003978 | Ga0209565_10039782 | 394 |
| 469 | 3300025263 | Ga0209565_1005218 | Ga0209565_10052183 | 394 |
| 470 | 3300025284 | Ga0209130_1000556 | Ga0209130_100055618 | 394 |
| 471 | 3300025291 | Ga0209675_1001607 | Ga0209675_10016076 | 394 |
| 472 | 3300025295 | Ga0209564_1000852 | Ga0209564_100085224 | 394 |
| 473 | 3300025298 | Ga0209050_1000226 | Ga0209050_100022624 | 394 |
| 474 | 3300025299 | Ga0209256_1001985 | Ga0209256_100198510 | 394 |
| 475 | 3300026075 | Ga0207708_10025157 | Ga0207708_100251572 | 394 |
| 476 | 3300026095 | Ga0207676_10000147 | Ga0207676_1000014740 | 394 |
| 477 | 3300026118 | Ga0207675_100004679 | Ga0207675_1000046799 | 394 |
| 478 | 3300026118 | Ga0207675_100077241 | Ga0207675_1000772413 | 394 |
| 479 | 3300031548 | Ga0307408_100000635 | Ga0307408_1000006357 | 394 |
| 480 | 3300037312 | Ga0395899_0001563 | Ga0395899_0001563_6814_8037 | 394 |
| 481 | 3300037312 | Ga0395899_0006295 | Ga0395899_0006295_654_1877 | 394 |
| 482 | 3300037418 | Ga0395900_0070711 | Ga0395900_0070711_1463_2686 | 394 |
| 483 | 3300038443 | Ga0395901_0006141 | Ga0395901_0006141_3769_4992 | 394 |
| 484 | 3300046472 | Ga0495580_0046313 | Ga0495580_0046313_1459_2670 | 394 |
| 485 | iso_pu_bacteria | 2773857672 | 2774128731 | 394 |
| 486 | iso_pu_bacteria | 2974298342 | 2974299146 | 394 |
| 487 | iso_pu_bacteria | 2984499530 | 2984501461 | 394 |
| 488 | 3300025272 | Ga0209455_1000589 | Ga0209455_100058925 | 395 |
| 489 | 3300035695 | Ga0373927_0000423 | Ga0373927_0000423_23639_24835 | 395 |
| 490 | 3300037068 | Ga0373925_0004073 | Ga0373925_0004073_8867_10063 | 395 |
| 491 | 3300049576 | Ga0501040_0136796 | Ga0501040_0136796_384_1613 | 395 |
| 492 | 3300049587 | Ga0501071_0096309 | Ga0501071_0096309_505_1734 | 395 |
| 493 | 3300050512 | nmdc:mga0n895_191006_c1 | nmdc:mga0n895_191006_c1_376_1581 | 395 |
| 494 | 3300050513 | nmdc:mga0rr50_39097_c1 | nmdc:mga0rr50_39097_c1_974_2179 | 395 |
| 495 | iso_pu_bacteria | 2904479285 | 2904480646 | 395 |
| 496 | 3300005434 | Ga0070709_10038872 | Ga0070709_100388722 | 396 |
| 497 | 3300005563 | Ga0068855_100379057 | Ga0068855_1003790571 | 396 |
| 498 | 3300005578 | Ga0068854_100071458 | Ga0068854_1000714582 | 396 |
| 499 | 3300005616 | Ga0068852_100022556 | Ga0068852_1000225563 | 396 |
| 500 | 3300006852 | Ga0075433_10173695 | Ga0075433_101736952 | 396 |
| 501 | 3300006871 | Ga0075434_100039203 | Ga0075434_1000392032 | 396 |
| 502 | 3300006914 | Ga0075436_100093290 | Ga0075436_1000932901 | 396 |
| 503 | 3300025904 | Ga0207647_10027339 | Ga0207647_100273392 | 396 |
| 504 | 3300025911 | Ga0207654_10000803 | Ga0207654_1000080319 | 396 |
| 505 | 3300025913 | Ga0207695_10001543 | Ga0207695_100015437 | 396 |
| 506 | 3300025986 | Ga0207658_10030322 | Ga0207658_100303222 | 396 |
| 507 | 3300026041 | Ga0207639_10201974 | Ga0207639_102019742 | 396 |
| 508 | 3300026067 | Ga0207678_10035073 | Ga0207678_100350734 | 396 |
| 509 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005291 | 396 |
| 510 | 3300026116 | Ga0207674_10011138 | Ga0207674_100111386 | 396 |
| 511 | 3300028653 | Ga0265323_10012447 | Ga0265323_100124472 | 396 |
| 512 | 3300028666 | Ga0265336_10000125 | Ga0265336_1000012514 | 396 |
| 513 | 3300028800 | Ga0265338_10000085 | Ga0265338_1000008540 | 396 |
| 514 | 3300046542 | Ga0495597_0000452 | Ga0495597_0000452_17866_19080 | 396 |
| 515 | 3300046665 | Ga0495661_0000536 | Ga0495661_0000536_19215_20468 | 396 |
| 516 | 3300048912 | Ga0496109_0003906 | Ga0496109_0003906_1577_2830 | 396 |
| 517 | 3300048916 | Ga0496113_0003839 | Ga0496113_0003839_2679_3932 | 396 |
| 518 | 3300048925 | Ga0496122_0000326 | Ga0496122_0000326_82579_83832 | 396 |
| 519 | 3300048926 | Ga0496123_0000293 | Ga0496123_0000293_19434_20687 | 396 |
| 520 | 3300048928 | Ga0496125_0001226 | Ga0496125_0001226_12739_13992 | 396 |
| 521 | 3300049581 | Ga0501047_0029011 | Ga0501047_0029011_2522_3739 | 396 |
| 522 | 3300049584 | Ga0501068_0040701 | Ga0501068_0040701_512_1729 | 396 |
| 523 | 3300049585 | Ga0501069_0024058 | Ga0501069_0024058_1184_2401 | 396 |
| 524 | 3300049586 | Ga0501070_0004115 | Ga0501070_0004115_1317_2534 | 396 |
| 525 | 3300049590 | Ga0501074_0000199 | Ga0501074_0000199_7918_9135 | 396 |
| 526 | 3300049741 | Ga0501079_0051354 | Ga0501079_0051354_1752_2969 | 396 |
| 527 | 3300049744 | Ga0501083_0005240 | Ga0501083_0005240_6637_7854 | 396 |
| 528 | 3300049822 | Ga0501035_0117175 | Ga0501035_0117175_556_1773 | 396 |
| 529 | 3300050512 | nmdc:mga0n895_127494_c1 | nmdc:mga0n895_127494_c1_844_2109 | 396 |
| 530 | 3300050514 | nmdc:mga08x19_108432_c1 | nmdc:mga08x19_108432_c1_572_1837 | 396 |
| 531 | 3300060353 | Ga0501082_0074299 | Ga0501082_0074299_1297_2514 | 396 |
| 532 | 3300006048 | Ga0075363_100049168 | Ga0075363_1000491681 | 397 |
| 533 | 3300009036 | Ga0105244_10081138 | Ga0105244_100811382 | 397 |
| 534 | 3300009093 | Ga0105240_10026698 | Ga0105240_100266983 | 397 |
| 535 | 3300009545 | Ga0105237_10010820 | Ga0105237_1001082010 | 397 |
| 536 | 3300013102 | Ga0157371_10118037 | Ga0157371_101180372 | 397 |
| 537 | 3300013105 | Ga0157369_10016149 | Ga0157369_100161498 | 397 |
| 538 | 3300025913 | Ga0207695_10017237 | Ga0207695_100172373 | 397 |
| 539 | 3300025949 | Ga0207667_10019902 | Ga0207667_100199023 | 397 |
| 540 | 3300046674 | Ga0495588_0016286 | Ga0495588_0016286_1685_2896 | 397 |
| 541 | 3300048907 | Ga0496104_0223105 | Ga0496104_0223105_191_1405 | 397 |
| 542 | 3300048925 | Ga0496122_0005466 | Ga0496122_0005466_11097_12317 | 397 |
| 543 | 3300048926 | Ga0496123_0012928 | Ga0496123_0012928_4826_6046 | 397 |
| 544 | 3300048928 | Ga0496125_0000414 | Ga0496125_0000414_14013_15233 | 397 |
| 545 | 3300050491 | nmdc:mga00v17_92671_c1 | nmdc:mga00v17_92671_c1_316_1518 | 397 |
| 546 | iso_pu_bacteria | 2516143018 | 2516209850 | 397 |
| 547 | iso_pu_bacteria | 2791355091 | 2792620301 | 397 |
| 548 | iso_pu_bacteria | 2791355092 | 2792626282 | 397 |
| 549 | iso_pu_bacteria | 2922386360 | 2922390420 | 397 |
| 550 | 3300006237 | Ga0097621_100071325 | Ga0097621_1000713253 | 398 |
| 551 | 3300044658 | Ga0466972_0030197 | Ga0466972_0030197_982_2202 | 398 |
| 552 | 3300044683 | Ga0466965_0006185 | Ga0466965_0006185_3677_4897 | 398 |
| 553 | 3300044706 | Ga0466964_0024145 | Ga0466964_0024145_849_2069 | 398 |
| 554 | 3300046528 | Ga0495642_0015915 | Ga0495642_0015915_672_1907 | 398 |
| 555 | iso_pu_bacteria | 2562617112 | 2563058192 | 398 |
| 556 | iso_pu_bacteria | 2711768613 | 2713480818 | 398 |
| 557 | 3300044693 | Ga0466961_0057106 | Ga0466961_0057106_103_1461 | 399 |
| 558 | iso_pu_bacteria | 2643221651 | 2644291655 | 399 |
| 559 | 3300044901 | Ga0466960_0049678 | Ga0466960_0049678_177_1415 | 400 |
| 560 | 3300046460 | Ga0495638_0004449 | Ga0495638_0004449_6319_7551 | 400 |
| 561 | 3300048910 | Ga0496107_0190055 | Ga0496107_0190055_93_1331 | 400 |
| 562 | 3300048915 | Ga0496112_0005856 | Ga0496112_0005856_8171_9409 | 400 |
| 563 | 3300048916 | Ga0496113_0021658 | Ga0496113_0021658_2840_4078 | 400 |
| 564 | iso_pu_bacteria | 2879110137 | 2879111530 | 400 |
| 565 | 3300006871 | Ga0075434_100117063 | Ga0075434_1001170632 | 401 |
| 566 | 3300050512 | nmdc:mga0n895_127117_c1 | nmdc:mga0n895_127117_c1_558_1907 | 401 |
| 567 | iso_pu_bacteria | 2775507049 | 2776911913 | 401 |
| 568 | 3300005262 | Ga0065165_1000309 | Ga0065165_100030911 | 402 |
| 569 | 3300007076 | Ga0075435_100108501 | Ga0075435_1001085013 | 402 |
| 570 | 3300009147 | Ga0114129_10037597 | Ga0114129_100375977 | 402 |
| 571 | 3300050507 | nmdc:mga05p37_28488_c1 | nmdc:mga05p37_28488_c1_4993_6333 | 402 |
| 572 | 3300005548 | Ga0070665_100040053 | Ga0070665_1000400534 | 403 |
| 573 | 3300046692 | Ga0495671_0048616 | Ga0495671_0048616_311_1555 | 403 |
| 574 | iso_pu_bacteria | 2909042592 | 2909046740 | 403 |
| 575 | 3300046524 | Ga0495648_0015279 | Ga0495648_0015279_933_2216 | 406 |
| 576 | 3300046660 | Ga0495625_0083058 | Ga0495625_0083058_118_1401 | 406 |
| 577 | 3300053104 | Ga0500556_0005700 | Ga0500556_0005700_981_2264 | 406 |
| 578 | 3300053156 | Ga0500622_0003513 | Ga0500622_0003513_4662_5945 | 406 |
| 579 | iso_pu_bacteria | 2582581283 | 2585166915 | 406 |
| 580 | 3300005548 | Ga0070665_100116861 | Ga0070665_1001168612 | 407 |
| 581 | 3300009545 | Ga0105237_10143459 | Ga0105237_101434592 | 409 |
| 582 | 3300031251 | Ga0265327_10001073 | Ga0265327_100010738 | 411 |
| 583 | 3300001990 | JGI24737J22298_10016383 | JGI24737J22298_100163832 | 418 |
| 584 | 3300005455 | Ga0070663_100120575 | Ga0070663_1001205752 | 418 |
| 585 | 3300005539 | Ga0068853_100224583 | Ga0068853_1002245832 | 418 |
| 586 | 3300009093 | Ga0105240_10027543 | Ga0105240_100275433 | 418 |
| 587 | 3300009174 | Ga0105241_10125476 | Ga0105241_101254762 | 418 |
| 588 | 3300009545 | Ga0105237_10239771 | Ga0105237_102397712 | 418 |
| 589 | 3300009551 | Ga0105238_10017785 | Ga0105238_100177852 | 418 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6t1z-assembly1.cif.gz_A | lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 | 0.8663 | 15 | 400 |
| 7lo8-assembly1.cif.gz_Z | nora in complex with fab36 | 0.8633 | 19 | 399 |
| 7ckr-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. | 0.8619 | 19 | 400 |
| 7lo8-assembly1.cif.gz_Z | nora in complex with fab36 | 0.8484 | 19 | 399 |
| 6t1z-assembly1.cif.gz_A | lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 | 0.8477 | 15 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58713_262_398_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9639 | 261 | 396 | 1.20.1250.20 |
| af_Q58713_262_398_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9436 | 261 | 396 | 1.20.1250.20 |
| af_P9WLG3_19_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9368 | 19 | 194 | 1.20.1250.20 |
| af_P76417_195_402_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9206 | 222 | 394 | 1.20.1250.20 |
| af_E7FB53_277_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9188 | 225 | 400 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5SP13-F1-model_v4 | MFS transporter | 0.9863 | 54 | 396 |
GO:0016020
GO:0022857 |
| AF-A0A7K2QQD8-F1-model_v4 | MFS transporter | 0.9694 | 28 | 190 |
GO:0016020
GO:0022857 |
| AF-A0A4P5SP13-F1-model_v4 | MFS transporter | 0.9612 | 54 | 396 |
GO:0016020
GO:0022857 |
| AF-A0A7K2QQD8-F1-model_v4 | MFS transporter | 0.9467 | 28 | 190 |
GO:0016020
GO:0022857 |
| AF-A0A660YW01-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9155 | 224 | 399 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar