F466705

General Info

Members Datasets Scaffolds Average Seq Length
587 302 1174 114

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0336544|Ga0496106_0336544_804_1181
Length 125
Sequence MRIHPALDNTHVVLVLIGLAAGFFSALFGVGGGIVIVPLLLLVAKWDLRPAAATSLAAIGITATAGVITYVVHGEVEPTYALLVGVPAALGAAGGSVLQQRVPVRTLSFLFAGLLAAIAVRMLVQ

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 6.81
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0336544 3300048909 Bacteria 1212
2 Ga0070658_10120530 3300005327 Bacteria 2179
3 Ga0070658_10655778 3300005327 Bacteria 911
4 Ga0070658_11754297 3300005327 Bacteria 537
5 Ga0070676_10187819 3300005328 Unclassified 1347
6 Ga0070676_11006928 3300005328 Bacteria 626
7 Ga0070683_100005729 3300005329 Bacteria 10382
8 Ga0068869_100204699 3300005334 Bacteria 1558
9 Ga0068869_100623769 3300005334 Bacteria 913
10 Ga0070680_100013061 3300005336 Bacteria 6465
11 Ga0070682_100021260 3300005337 Bacteria 3826
12 Ga0070682_100137372 3300005337 Bacteria 1662
13 Ga0068868_101552658 3300005338 Bacteria 621
14 Ga0070660_100003398 3300005339 Bacteria 10953
15 Ga0070660_100008279 3300005339 Bacteria 7266
16 Ga0070660_100014577 3300005339 Bacteria 5669
17 Ga0070660_101443687 3300005339 Unclassified 585
18 Ga0070687_100980916 3300005343 Bacteria 611
19 Ga0070661_100269520 3300005344 Bacteria 1318
20 Ga0070692_10073229 3300005345 Bacteria 1830
21 Ga0070671_100289163 3300005355 Unclassified 1395
22 Ga0070674_100220641 3300005356 Bacteria 1475
23 Ga0070659_100230108 3300005366 Bacteria 1532
24 Ga0070659_100333536 3300005366 Bacteria 1270
25 Ga0070659_100432732 3300005366 Unclassified 1114
26 Ga0070659_101931189 3300005366 Unclassified 530
27 Ga0070703_10041410 3300005406 Bacteria 1436
28 Ga0070709_10039709 3300005434 Bacteria 2889
29 Ga0070709_10040745 3300005434 Bacteria 2857
30 Ga0070709_10402841 3300005434 Bacteria 1022
31 Ga0070714_100035545 3300005435 Bacteria 4177
32 Ga0070714_100098485 3300005435 Bacteria 2572
33 Ga0070714_100119582 3300005435 Bacteria 2342
34 Ga0070714_100256614 3300005435 Bacteria 1618
35 Ga0070714_101335423 3300005435 Bacteria 700
36 Ga0070714_101576509 3300005435 Bacteria 641
37 Ga0070714_101576511 3300005435 Bacteria 641
38 Ga0070713_100035142 3300005436 Bacteria 4032
39 Ga0070713_100789734 3300005436 Bacteria 910
40 Ga0070713_101164008 3300005436 Unclassified 746
41 Ga0070705_101054411 3300005440 Bacteria 663
42 Ga0070705_101252065 3300005440 Unclassified 613
43 Ga0070700_100242816 3300005441 Bacteria 1288
44 Ga0070700_100397295 3300005441 Bacteria 1035
45 Ga0070694_100495840 3300005444 Bacteria 971
46 Ga0070694_100634115 3300005444 Unclassified 864
47 Ga0070694_100922407 3300005444 Bacteria 722
48 Ga0070678_100315199 3300005456 Unclassified 1334
49 Ga0070662_100850617 3300005457 Bacteria 777
50 Ga0070681_10035668 3300005458 Bacteria 4995
51 Ga0070681_10057340 3300005458 Bacteria 3875
52 Ga0070681_10062107 3300005458 Bacteria 3710
53 Ga0070681_10147627 3300005458 Bacteria 2279
54 Ga0070681_10330604 3300005458 Bacteria 1434
55 Ga0070681_10428494 3300005458 Bacteria 1235
56 Ga0068867_100222834 3300005459 Unclassified 1521
57 Ga0070706_100607930 3300005467 Bacteria 1016
58 Ga0070707_100028519 3300005468 Bacteria 5314
59 Ga0070707_100550430 3300005468 Bacteria 1116
60 Ga0070707_102286498 3300005468 Bacteria 508
61 Ga0070698_100026743 3300005471 Bacteria 6002
62 Ga0070698_100028350 3300005471 Bacteria 5817
63 Ga0070698_100242213 3300005471 Bacteria 1737
64 Ga0070679_100075139 3300005530 Bacteria 3369
65 Ga0070679_100096451 3300005530 Bacteria 2945
66 Ga0070679_100250426 3300005530 Bacteria 1728
67 Ga0070679_100996284 3300005530 Bacteria 782
68 Ga0070679_101209783 3300005530 Bacteria 701
69 Ga0070679_101817432 3300005530 Bacteria 558
70 Ga0070684_100021699 3300005535 Bacteria 5349
71 Ga0070684_100189734 3300005535 Bacteria 1870
72 Ga0070684_100375971 3300005535 Bacteria 1308
73 Ga0070672_100739468 3300005543 Bacteria 863
74 Ga0070695_100122685 3300005545 Bacteria 1780
75 Ga0070696_100103662 3300005546 Bacteria 2041
76 Ga0070704_100207829 3300005549 Unclassified 1584
77 Ga0068855_100041774 3300005563 Bacteria 5433
78 Ga0068855_102297202 3300005563 Bacteria 540
79 Ga0070664_100468853 3300005564 Bacteria 1158
80 Ga0070664_100758281 3300005564 Bacteria 906
81 Ga0068857_100001566 3300005577 Bacteria 18312
82 Ga0068857_100110849 3300005577 Bacteria 2466
83 Ga0068857_100915570 3300005577 Bacteria 841
84 Ga0068854_100391371 3300005578 Bacteria 1148
85 Ga0068854_101625378 3300005578 Unclassified 589
86 Ga0070702_100091926 3300005615 Bacteria 1842
87 Ga0068852_100090411 3300005616 Bacteria 2738
88 Ga0068852_100336607 3300005616 Bacteria 1470
89 Ga0068864_100375786 3300005618 Bacteria 1346
90 Ga0068864_101207423 3300005618 Unclassified 755
91 Ga0068861_100212878 3300005719 Unclassified 1629
92 Ga0068861_101508996 3300005719 Unclassified 660
93 Ga0068851_10389214 3300005834 Bacteria 818
94 Ga0068870_10186090 3300005840 Bacteria 1250
95 Ga0068858_100332703 3300005842 Unclassified 1453
96 Ga0070717_10082234 3300006028 Bacteria 2706
97 Ga0070717_10094164 3300006028 Bacteria 2533
98 Ga0070717_10155388 3300006028 Bacteria 1981
99 Ga0075365_10237086 3300006038 Bacteria 1281
100 Ga0070712_100090356 3300006175 Bacteria 2242
101 Ga0070712_101000220 3300006175 Bacteria 724
102 Ga0075367_10483616 3300006178 Bacteria 785
103 Ga0075428_100165995 3300006844 Bacteria 2395
104 Ga0075428_100522854 3300006844 Unclassified 1269
105 Ga0075430_101438458 3300006846 Bacteria 566
106 Ga0075431_100040786 3300006847 Bacteria 4785
107 Ga0075434_101420338 3300006871 Bacteria 704
108 Ga0068865_102213102 3300006881 Bacteria 500
109 Ga0075436_100371319 3300006914 Bacteria 1033
110 Ga0105250_10510846 3300009092 Bacteria 546
111 Ga0105240_10227646 3300009093 Bacteria 2168
112 Ga0105240_10826530 3300009093 Bacteria 1002
113 Ga0111539_10009040 3300009094 Bacteria 12609
114 Ga0105245_10008435 3300009098 Bacteria 8999
115 Ga0105245_10050028 3300009098 Bacteria 3744
116 Ga0105245_10093694 3300009098 Bacteria 2768
117 Ga0105245_10244672 3300009098 Bacteria 1740
118 Ga0114129_10203894 3300009147 Bacteria 2677
119 Ga0114129_10316118 3300009147 Bacteria 2077
120 Ga0114129_10370645 3300009147 Bacteria 1893
121 Ga0114129_11640042 3300009147 Unclassified 786
122 Ga0105243_10124367 3300009148 Bacteria 2179
123 Ga0105243_10822658 3300009148 Unclassified 917
124 Ga0105243_11643286 3300009148 Bacteria 670
125 Ga0105241_10615659 3300009174 Bacteria 982
126 Ga0105241_11160161 3300009174 Unclassified 730
127 Ga0105242_10655752 3300009176 Bacteria 1021
128 Ga0105248_10406763 3300009177 Bacteria 1532
129 Ga0105237_12071015 3300009545 Unclassified 578
130 Ga0105237_12592175 3300009545 Unclassified 518
131 Ga0105238_10347766 3300009551 Unclassified 1471
132 Ga0105238_12756190 3300009551 Bacteria 528
133 Ga0105249_11296023 3300009553 Bacteria 800
134 Ga0105239_10381040 3300010375 Bacteria 1594
135 Ga0105239_10647333 3300010375 Unclassified 1207
136 Ga0105239_11555823 3300010375 Bacteria 764
137 Ga0105239_11896781 3300010375 Unclassified 691
138 Ga0105246_10056193 3300011119 Bacteria 2720
139 Ga0157373_10102639 3300013100 Bacteria 2012
140 Ga0157373_10126113 3300013100 Bacteria 1800
141 Ga0157373_10268982 3300013100 Unclassified 1206
142 Ga0157371_11124580 3300013102 Unclassified 603
143 Ga0157371_11248192 3300013102 Bacteria 574
144 Ga0157370_10018694 3300013104 Bacteria 6968
145 Ga0157370_10109603 3300013104 Bacteria 2581
146 Ga0157370_10429379 3300013104 Bacteria 1215
147 Ga0157370_11602860 3300013104 Bacteria 585
148 Ga0157369_10006178 3300013105 Bacteria 13900
149 Ga0157369_10030501 3300013105 Bacteria 5946
150 Ga0157369_10061676 3300013105 Bacteria 4041
151 Ga0157369_10348917 3300013105 Bacteria 1537
152 Ga0157369_11788410 3300013105 Bacteria 624
153 Ga0157378_11694482 3300013297 Unclassified 679
154 Ga0163162_11652993 3300013306 Unclassified 731
155 Ga0157372_10635586 3300013307 Bacteria 1243
156 Ga0157372_11379033 3300013307 Bacteria 813
157 Ga0157375_10796359 3300013308 Bacteria 1094
158 Ga0157375_12240825 3300013308 Unclassified 651
159 Ga0163163_11792347 3300014325 Bacteria 674
160 Ga0157380_11616085 3300014326 Unclassified 704
161 Ga0157380_11920941 3300014326 Unclassified 653
162 Ga0182008_10001010 3300014497 Bacteria 19546
163 Ga0182008_10150851 3300014497 Bacteria 1166
164 Ga0182008_10196585 3300014497 Bacteria 1025
165 Ga0182006_1016684 3300015261 Bacteria 3130
166 Ga0182007_10015408 3300015262 Bacteria 2853
167 Ga0182007_10169782 3300015262 Bacteria 749
168 Ga0163161_10399156 3300017792 Unclassified 1102
169 Ga0197907_10371673 3300020069 Bacteria 1243
170 Ga0206356_10240272 3300020070 Bacteria 1323
171 Ga0206356_11704471 3300020070 Bacteria 3774
172 Ga0206354_10358543 3300020081 Bacteria 3540
173 Ga0206354_11360781 3300020081 Bacteria 1375
174 Ga0206353_10804099 3300020082 Bacteria 9328
175 Ga0206353_11969477 3300020082 Bacteria 4482
176 Ga0207688_10085658 3300025901 Bacteria 1805
177 Ga0207699_10208037 3300025906 Bacteria 1329
178 Ga0207699_10380642 3300025906 Bacteria 1001
179 Ga0207699_10747812 3300025906 Bacteria 717
180 Ga0207645_10403456 3300025907 Unclassified 919
181 Ga0207643_10106124 3300025908 Bacteria 1651
182 Ga0207705_10222330 3300025909 Bacteria 1435
183 Ga0207705_10290177 3300025909 Bacteria 1253
184 Ga0207705_10427540 3300025909 Bacteria 1026
185 Ga0207705_10691310 3300025909 Bacteria 793
186 Ga0207684_11086967 3300025910 Bacteria 666
187 Ga0207707_10080669 3300025912 Bacteria 2841
188 Ga0207707_10112059 3300025912 Bacteria 2385
189 Ga0207707_10341664 3300025912 Unclassified 1291
190 Ga0207707_10589534 3300025912 Unclassified 942
191 Ga0207707_10708860 3300025912 Bacteria 844
192 Ga0207707_11108455 3300025912 Bacteria 645
193 Ga0207695_10579247 3300025913 Bacteria 1004
194 Ga0207693_10301263 3300025915 Bacteria 1256
195 Ga0207693_10359419 3300025915 Bacteria 1139
196 Ga0207660_10116430 3300025917 Bacteria 2019
197 Ga0207660_10254056 3300025917 Bacteria 1388
198 Ga0207660_10667286 3300025917 Bacteria 848
199 Ga0207657_10000388 3300025919 Bacteria 46370
200 Ga0207657_10010339 3300025919 Bacteria 9313
201 Ga0207652_10007590 3300025921 Bacteria 8733
202 Ga0207652_10091565 3300025921 Bacteria 2674
203 Ga0207652_10097733 3300025921 Bacteria 2589
204 Ga0207652_10621089 3300025921 Bacteria 968
205 Ga0207652_10714358 3300025921 Bacteria 894
206 Ga0207652_11085973 3300025921 Bacteria 700
207 Ga0207646_10011935 3300025922 Bacteria 8378
208 Ga0207646_10550340 3300025922 Bacteria 1038
209 Ga0207646_10660505 3300025922 Bacteria 936
210 Ga0207646_10977459 3300025922 Bacteria 749
211 Ga0207681_11093256 3300025923 Bacteria 670
212 Ga0207694_10207330 3300025924 Bacteria 1596
213 Ga0207694_11515395 3300025924 Bacteria 566
214 Ga0207694_11636433 3300025924 Bacteria 542
215 Ga0207687_10005764 3300025927 Bacteria 8196
216 Ga0207687_10616312 3300025927 Bacteria 916
217 Ga0207687_10834972 3300025927 Unclassified 787
218 Ga0207700_10000012 3300025928 Bacteria 231712
219 Ga0207700_11018933 3300025928 Bacteria 741
220 Ga0207700_11277680 3300025928 Bacteria 654
221 Ga0207664_10058978 3300025929 Bacteria 3056
222 Ga0207664_10099886 3300025929 Bacteria 2395
223 Ga0207664_10169968 3300025929 Bacteria 1865
224 Ga0207664_10287848 3300025929 Bacteria 1443
225 Ga0207664_10642588 3300025929 Bacteria 953
226 Ga0207664_11092743 3300025929 Bacteria 713
227 Ga0207644_10539755 3300025931 Bacteria 965
228 Ga0207690_10303491 3300025932 Bacteria 1250
229 Ga0207690_10401821 3300025932 Unclassified 1093
230 Ga0207690_11292081 3300025932 Bacteria 610
231 Ga0207706_10065050 3300025933 Bacteria 3211
232 Ga0207709_11525121 3300025935 Bacteria 555
233 Ga0207669_10708365 3300025937 Bacteria 828
234 Ga0207665_10004044 3300025939 Bacteria 9785
235 Ga0207665_11010602 3300025939 Bacteria 662
236 Ga0207691_10153028 3300025940 Bacteria 2027
237 Ga0207661_10030134 3300025944 Bacteria 4175
238 Ga0207661_10076157 3300025944 Bacteria 2755
239 Ga0207661_10188601 3300025944 Bacteria 1806
240 Ga0207661_10297458 3300025944 Bacteria 1446
241 Ga0207679_10738909 3300025945 Bacteria 895
242 Ga0207667_10014195 3300025949 Bacteria 9090
243 Ga0207667_10504217 3300025949 Bacteria 1227
244 Ga0207667_10606503 3300025949 Bacteria 1103
245 Ga0207667_11414808 3300025949 Bacteria 669
246 Ga0207712_10044145 3300025961 Bacteria 3079
247 Ga0207712_10134244 3300025961 Bacteria 1890
248 Ga0207712_11052071 3300025961 Bacteria 723
249 Ga0207668_10173423 3300025972 Bacteria 1694
250 Ga0207640_10178824 3300025981 Bacteria 1589
251 Ga0207640_11589718 3300025981 Unclassified 589
252 Ga0207677_11028610 3300026023 Bacteria 748
253 Ga0207639_10063676 3300026041 Bacteria 2856
254 Ga0207678_10196840 3300026067 Bacteria 1722
255 Ga0207708_10004285 3300026075 Bacteria 10501
256 Ga0207708_10581414 3300026075 Bacteria 947
257 Ga0207702_10193378 3300026078 Bacteria 1881
258 Ga0207648_10145311 3300026089 Bacteria 2092
259 Ga0207676_11003863 3300026095 Bacteria 822
260 Ga0207676_11467860 3300026095 Unclassified 679
261 Ga0207674_10007765 3300026116 Bacteria 12479
262 Ga0207674_10152194 3300026116 Bacteria 2270
263 Ga0207674_10402805 3300026116 Bacteria 1322
264 Ga0207674_10578602 3300026116 Bacteria 1085
265 Ga0207674_10717027 3300026116 Unclassified 965
266 Ga0207675_100024563 3300026118 Bacteria 5603
267 Ga0207675_100855793 3300026118 Unclassified 924
268 Ga0207683_10437193 3300026121 Bacteria 1206
269 Ga0207698_10212817 3300026142 Unclassified 1740
270 Ga0209974_10172801 3300027876 Unclassified 788
271 Ga0207428_10008468 3300027907 Bacteria 9286
272 Ga0268265_11439767 3300028380 Bacteria 692
273 Ga0265337_1039588 3300028556 Bacteria 1362
274 Ga0265326_10004775 3300028558 Bacteria 4305
275 Ga0265326_10218220 3300028558 Bacteria 549
276 Ga0265319_1001269 3300028563 Bacteria 15335
277 Ga0265319_1005634 3300028563 Bacteria 5957
278 Ga0265319_1072331 3300028563 Bacteria 1104
279 Ga0265334_10002271 3300028573 Bacteria 9024
280 Ga0265334_10023620 3300028573 Bacteria 2499
281 Ga0265318_10002578 3300028577 Bacteria 9601
282 Ga0265318_10007841 3300028577 Bacteria 4798
283 Ga0265318_10171486 3300028577 Bacteria 795
284 Ga0265323_10076354 3300028653 Bacteria 1137
285 Ga0265322_10032908 3300028654 Bacteria 1478
286 Ga0265322_10039522 3300028654 Bacteria 1342
287 Ga0265336_10022955 3300028666 Bacteria 1983
288 Ga0265338_10003691 3300028800 Bacteria 21326
289 Ga0265338_10007351 3300028800 Bacteria 13717
290 Ga0265338_10016386 3300028800 Bacteria 8070
291 Ga0265338_10237863 3300028800 Bacteria 1350
292 Ga0265324_10032475 3300029957 Bacteria 1824
293 Ga0265330_10001454 3300031235 Bacteria 13806
294 Ga0265332_10001859 3300031238 Bacteria 11214
295 Ga0265332_10102808 3300031238 Bacteria 1205
296 Ga0265328_10000553 3300031239 Bacteria 17405
297 Ga0265320_10003137 3300031240 Bacteria 11217
298 Ga0265320_10022368 3300031240 Bacteria 3383
299 Ga0265320_10189525 3300031240 Unclassified 920
300 Ga0265325_10001515 3300031241 Bacteria 16326
301 Ga0265325_10057518 3300031241 Bacteria 1983
302 Ga0265329_10001572 3300031242 Bacteria 10934
303 Ga0265329_10320785 3300031242 Bacteria 526
304 Ga0265340_10003259 3300031247 Bacteria 9203
305 Ga0265340_10044224 3300031247 Bacteria 2179
306 Ga0265339_10003002 3300031249 Bacteria 11894
307 Ga0265339_10105639 3300031249 Bacteria 1462
308 Ga0265331_10001988 3300031250 Bacteria 14279
309 Ga0265331_10298467 3300031250 Bacteria 722
310 Ga0265327_10003921 3300031251 Bacteria 13660
311 Ga0265327_10013925 3300031251 Bacteria 5302
312 Ga0265327_10040184 3300031251 Bacteria 2532
313 Ga0265316_10004716 3300031344 Bacteria 13502
314 Ga0265316_10005504 3300031344 Bacteria 12296
315 Ga0265316_10124633 3300031344 Bacteria 1944
316 Ga0265316_10220772 3300031344 Bacteria 1399
317 Ga0307408_100025321 3300031548 Bacteria 4063
318 Ga0307408_100237638 3300031548 Bacteria 1496
319 Ga0265313_10003149 3300031595 Bacteria 13619
320 Ga0316575_10277909 3300031665 Bacteria 706
321 Ga0265314_10003611 3300031711 Bacteria 14879
322 Ga0265314_10072160 3300031711 Bacteria 2307
323 Ga0265342_10001768 3300031712 Bacteria 19717
324 Ga0265342_10066700 3300031712 Bacteria 2107
325 Ga0307405_10132517 3300031731 Unclassified 1724
326 Ga0307405_11615618 3300031731 Unclassified 572
327 Ga0307410_10047338 3300031852 Bacteria 2873
328 Ga0307410_10329930 3300031852 Bacteria 1213
329 Ga0307406_10023246 3300031901 Bacteria 3685
330 Ga0307406_10474587 3300031901 Unclassified 1009
331 Ga0307412_10038184 3300031911 Bacteria 3090
332 Ga0307412_12241993 3300031911 Unclassified 509
333 Ga0307409_100020528 3300031995 Bacteria 4505
334 Ga0307416_100002750 3300032002 Bacteria 10207
335 Ga0307416_100439810 3300032002 Bacteria 1354
336 Ga0307414_10020232 3300032004 Bacteria 4144
337 Ga0307411_10045813 3300032005 Bacteria 2815
338 Ga0307415_100074927 3300032126 Bacteria 2393
339 Ga0307415_101956194 3300032126 Bacteria 570
340 Ga0316583_10051282 3300032133 Bacteria 1452
341 Ga0316583_10175675 3300032133 Bacteria 745
342 Ga0373934_0135735 3300035086 Bacteria 1005
343 Ga0373954_0251581 3300035118 Bacteria 870
344 Ga0373956_0138072 3300035119 Bacteria 1144
345 Ga0373957_0394755 3300035120 Bacteria 595
346 Ga0373955_0542812 3300035172 Bacteria 711
347 Ga0373924_0068531 3300035410 Bacteria 1494
348 Ga0373937_0569778 3300036401 Bacteria 1076
349 Ga0395899_0002861 3300037312 Bacteria 13880
350 Ga0395899_0003419 3300037312 Bacteria 12595
351 Ga0395899_0006126 3300037312 Bacteria 9320
352 Ga0395899_0104355 3300037312 Bacteria 2043
353 Ga0395899_0271972 3300037312 Bacteria 1155
354 Ga0395899_0462699 3300037312 Bacteria 829
355 Ga0395900_0091883 3300037418 Bacteria 3118
356 Ga0395900_0204082 3300037418 Bacteria 1998
357 Ga0395900_0254506 3300037418 Bacteria 1756
358 Ga0395900_0890566 3300037418 Bacteria 814
359 Ga0395900_1023461 3300037418 Bacteria 745
360 Ga0395900_1505207 3300037418 Bacteria 585
361 Ga0395898_0001886 3300037466 Bacteria 26752
362 Ga0395898_0038076 3300037466 Bacteria 4768
363 Ga0395898_0044034 3300037466 Bacteria 4396
364 Ga0395898_0117144 3300037466 Bacteria 2552
365 Ga0395898_0147891 3300037466 Bacteria 2248
366 Ga0395898_0198660 3300037466 Bacteria 1915
367 Ga0395898_0232307 3300037466 Bacteria 1759
368 Ga0395898_0443978 3300037466 Bacteria 1236
369 Ga0395898_0486471 3300037466 Bacteria 1174
370 Ga0395898_0524571 3300037466 Bacteria 1126
371 Ga0395898_1609404 3300037466 Bacteria 574
372 Ga0395898_1761652 3300037466 Unclassified 541
373 Ga0395905_0006720 3300037471 Bacteria 11516
374 Ga0395905_0031126 3300037471 Bacteria 5024
375 Ga0395905_0127513 3300037471 Bacteria 2393
376 Ga0395905_0147876 3300037471 Bacteria 2210
377 Ga0395901_0020755 3300038443 Bacteria 6725
378 Ga0395901_0047926 3300038443 Bacteria 4437
379 Ga0395901_0062506 3300038443 Bacteria 3874
380 Ga0395901_0115634 3300038443 Bacteria 2818
381 Ga0395901_0174647 3300038443 Bacteria 2253
382 Ga0395901_0212852 3300038443 Bacteria 2022
383 Ga0395901_0441297 3300038443 Bacteria 1332
384 Ga0395901_0552295 3300038443 Bacteria 1167
385 Ga0395901_0845719 3300038443 Bacteria 901
386 Ga0395901_1118512 3300038443 Unclassified 757
387 Ga0395901_1847162 3300038443 Unclassified 553
388 Ga0242420_032860 3300038996 Bacteria 968
389 Ga0436360_0975496 3300039438 Bacteria 2482
390 Ga0436362_1260713 3300039453 Bacteria 751
391 Ga0451798_0491999 3300041458 Bacteria 524
392 Ga0451800_1563233 3300041459 Bacteria 640
393 Ga0451853_3980493 3300041512 Bacteria 675
394 Ga0450906_087238 3300042145 Bacteria 565
395 Ga0450908_073946 3300042184 Bacteria 607
396 Ga0439459_0075564 3300042438 Bacteria 787
397 Ga0450916_042888 3300042530 Unclassified 693
398 Ga0466972_0213033 3300044658 Bacteria 904
399 Ga0466966_0028061 3300044684 Bacteria 3667
400 Ga0466961_0145035 3300044693 Bacteria 1485
401 Ga0466961_0842060 3300044693 Bacteria 547
402 Ga0466963_0005592 3300044694 Bacteria 7372
403 Ga0466963_0025377 3300044694 Bacteria 3779
404 Ga0466963_0046731 3300044694 Bacteria 2855
405 Ga0466963_0102783 3300044694 Bacteria 1957
406 Ga0466963_0160614 3300044694 Bacteria 1564
407 Ga0466963_0203375 3300044694 Bacteria 1385
408 Ga0466963_0285925 3300044694 Unclassified 1159
409 Ga0466963_0432060 3300044694 Bacteria 929
410 Ga0466963_0473237 3300044694 Bacteria 884
411 Ga0466963_0498225 3300044694 Bacteria 860
412 Ga0466964_0402801 3300044706 Bacteria 715
413 Ga0466971_0024818 3300044719 Bacteria 2676
414 Ga0466970_0471290 3300044765 Bacteria 721
415 Ga0466957_0037927 3300044842 Bacteria 2902
416 Ga0466957_0060644 3300044842 Bacteria 2320
417 Ga0466957_0255344 3300044842 Bacteria 1167
418 Ga0466957_0295586 3300044842 Bacteria 1087
419 Ga0466960_0091410 3300044901 Bacteria 1552
420 Ga0466960_0197453 3300044901 Archaea 1098
421 Ga0466959_0479906 3300045049 Bacteria 841
422 Ga0466959_0534814 3300045049 Unclassified 791
423 Ga0451576_0046462 3300045051 Bacteria 4571
424 Ga0451576_0755929 3300045051 Bacteria 1021
425 Ga0466958_0011649 3300045836 Bacteria 4957
426 Ga0466958_0034402 3300045836 Bacteria 3023
427 Ga0466958_0041096 3300045836 Bacteria 2781
428 Ga0466967_0002328 3300045976 Bacteria 11748
429 Ga0466967_0005509 3300045976 Bacteria 8785
430 Ga0466967_0025009 3300045976 Bacteria 4917
431 Ga0466967_0031365 3300045976 Bacteria 4473
432 Ga0466967_0041018 3300045976 Bacteria 3987
433 Ga0466967_0042655 3300045976 Bacteria 3922
434 Ga0466967_0046656 3300045976 Unclassified 3773
435 Ga0466967_0072351 3300045976 Bacteria 3090
436 Ga0466967_0090183 3300045976 Bacteria 2784
437 Ga0466967_0124924 3300045976 Bacteria 2382
438 Ga0466967_0150944 3300045976 Bacteria 2171
439 Ga0466967_0168812 3300045976 Bacteria 2057
440 Ga0466967_0173177 3300045976 Bacteria 2032
441 Ga0466967_0180002 3300045976 Bacteria 1994
442 Ga0466967_0207959 3300045976 Bacteria 1855
443 Ga0466967_0286870 3300045976 Bacteria 1580
444 Ga0466967_0485236 3300045976 Bacteria 1211
445 Ga0466967_0563109 3300045976 Unclassified 1122
446 Ga0466967_0638276 3300045976 Bacteria 1052
447 Ga0466967_0711892 3300045976 Bacteria 995
448 Ga0495629_0195540 3300046459 Bacteria 1399
449 Ga0495641_0132948 3300046461 Bacteria 1111
450 Ga0495651_0332843 3300046462 Unclassified 1009
451 Ga0495653_0165326 3300046463 Bacteria 1532
452 Ga0495653_0389752 3300046463 Bacteria 888
453 Ga0495605_0349652 3300046474 Bacteria 620
454 Ga0495639_0650911 3300046475 Bacteria 543
455 Ga0495664_0440966 3300046477 Bacteria 780
456 Ga0495584_0045370 3300046491 Archaea 2217
457 Ga0495585_0058778 3300046492 Bacteria 2121
458 Ga0495596_0317284 3300046500 Bacteria 606
459 Ga0495608_0066869 3300046511 Bacteria 2352
460 Ga0495618_0166022 3300046514 Bacteria 1406
461 Ga0495628_0738294 3300046516 Bacteria 693
462 Ga0495637_0226961 3300046520 Unclassified 678
463 Ga0495644_0399718 3300046523 Bacteria 544
464 Ga0495663_0021110 3300046525 Bacteria 1874
465 Ga0495652_0379253 3300046529 Bacteria 1006
466 Ga0495652_0456681 3300046529 Bacteria 893
467 Ga0495654_0199577 3300046530 Unclassified 857
468 Ga0495640_0563697 3300046533 Bacteria 690
469 Ga0495587_0714120 3300046536 Bacteria 549
470 Ga0495598_0019821 3300046537 Unclassified 1769
471 Ga0495609_0121645 3300046538 Unclassified 1122
472 Ga0495621_0049382 3300046539 Archaea 1501
473 Ga0495597_0181456 3300046542 Bacteria 851
474 Ga0495633_0283242 3300046558 Bacteria 754
475 Ga0495656_0018102 3300046615 Bacteria 2700
476 Ga0495656_0058907 3300046615 Bacteria 1669
477 Ga0495668_0513089 3300046616 Bacteria 661
478 Ga0495634_0358727 3300046642 Bacteria 872
479 Ga0495634_0812769 3300046642 Bacteria 532
480 Ga0495611_0040578 3300046648 Unclassified 2076
481 Ga0495635_0436861 3300046663 Bacteria 866
482 Ga0495635_0569976 3300046663 Bacteria 741
483 Ga0495657_0033172 3300046675 Bacteria 3597
484 Ga0495613_0301089 3300046689 Bacteria 1110
485 Ga0495613_0612226 3300046689 Bacteria 724
486 Ga0495670_0227750 3300046691 Bacteria 991
487 Ga0495671_0332822 3300046692 Bacteria 729
488 Ga0495589_0034458 3300046794 Bacteria 2542
489 Ga0495600_0404962 3300046809 Bacteria 848
490 Ga0495674_1030248 3300047319 Bacteria 629
491 Ga0495680_0098320 3300047322 Bacteria 2184
492 Ga0495680_0389558 3300047322 Bacteria 964
493 Ga0495677_0275511 3300047445 Unclassified 660
494 Ga0495677_0442224 3300047445 Unclassified 515
495 Ga0495684_0208608 3300047471 Bacteria 1437
496 Ga0496100_1001740 3300048903 Bacteria 657
497 Ga0496101_0975213 3300048904 Bacteria 667
498 Ga0496101_1060810 3300048904 Bacteria 637
499 Ga0496102_0925521 3300048905 Bacteria 793
500 Ga0496102_1381709 3300048905 Bacteria 623
501 Ga0496103_0418678 3300048906 Bacteria 860
502 Ga0496104_0313705 3300048907 Bacteria 1481
503 Ga0496104_1326777 3300048907 Unclassified 623
504 Ga0496106_0001856 3300048909 Bacteria 15812
505 Ga0496106_0419288 3300048909 Bacteria 1076
506 Ga0496106_0980419 3300048909 Bacteria 665
507 Ga0496107_0029123 3300048910 Bacteria 3926
508 Ga0496107_0890619 3300048910 Bacteria 649
509 Ga0496108_0458672 3300048911 Bacteria 1113
510 Ga0496108_0630274 3300048911 Unclassified 933
511 Ga0496109_0001953 3300048912 Bacteria 17112
512 Ga0496109_0100769 3300048912 Bacteria 2680
513 Ga0496109_0130074 3300048912 Unclassified 2349
514 Ga0496110_0003586 3300048913 Bacteria 11931
515 Ga0496110_0008300 3300048913 Bacteria 8351
516 Ga0496110_0011237 3300048913 Bacteria 7319
517 Ga0496111_0016313 3300048914 Bacteria 5116
518 Ga0496111_0161001 3300048914 Bacteria 1666
519 Ga0496111_0323827 3300048914 Bacteria 1141
520 Ga0496111_1171394 3300048914 Unclassified 546
521 Ga0496112_0022546 3300048915 Bacteria 6001
522 Ga0496112_0028506 3300048915 Bacteria 5390
523 Ga0496112_0107315 3300048915 Bacteria 2762
524 Ga0496112_0208500 3300048915 Bacteria 1912
525 Ga0496112_0309667 3300048915 Bacteria 1524
526 Ga0496112_1005770 3300048915 Bacteria 753
527 Ga0496112_1546476 3300048915 Bacteria 577
528 Ga0496113_0187245 3300048916 Bacteria 1642
529 Ga0496113_0219254 3300048916 Bacteria 1516
530 Ga0496113_0304137 3300048916 Bacteria 1277
531 Ga0496113_0384306 3300048916 Bacteria 1127
532 Ga0496115_0291423 3300048918 Bacteria 1339
533 Ga0495678_151962 3300049459 Bacteria 747
534 Ga0501291_071328 3300049514 Unclassified 674
535 Ga0501031_0010035 3300049568 Bacteria 6167
536 Ga0501034_0025130 3300049571 Bacteria 6063
537 Ga0501037_0013435 3300049573 Bacteria 6030
538 Ga0501038_0004512 3300049574 Bacteria 12952
539 Ga0501039_0028620 3300049575 Bacteria 4289
540 Ga0501040_0008979 3300049576 Bacteria 6501
541 Ga0501040_0578208 3300049576 Bacteria 811
542 Ga0501041_0228921 3300049577 Bacteria 1167
543 Ga0501042_0089431 3300049578 Bacteria 2209
544 Ga0501043_0001258 3300049579 Bacteria 22340
545 Ga0501046_0020345 3300049580 Bacteria 5491
546 Ga0501048_0041983 3300049582 Bacteria 3276
547 Ga0501067_0284530 3300049583 Bacteria 920
548 Ga0501068_0000695 3300049584 Bacteria 17241
549 Ga0501069_0074203 3300049585 Bacteria 1908
550 Ga0501069_0083244 3300049585 Bacteria 1804
551 Ga0501069_0176083 3300049585 Bacteria 1235
552 Ga0501070_0009516 3300049586 Bacteria 8212
553 Ga0501072_0052114 3300049588 Bacteria 3221
554 Ga0501073_0000769 3300049589 Bacteria 22750
555 Ga0501074_0038752 3300049590 Bacteria 3452
556 Ga0501075_0039944 3300049591 Bacteria 3512
557 Ga0501076_0980282 3300049592 Unclassified 696
558 Ga0501251_012021 3300049681 Bacteria 1040
559 Ga0501079_0010912 3300049741 Bacteria 6920
560 Ga0501079_0382207 3300049741 Bacteria 1104
561 Ga0501080_0071721 3300049742 Bacteria 3221
562 Ga0501081_0008853 3300049743 Bacteria 6542
563 Ga0501083_0011179 3300049744 Bacteria 6297
564 Ga0501035_0065407 3300049822 Bacteria 3229
565 Ga0501044_0004238 3300049823 Bacteria 16102
566 Ga0501045_0048568 3300049824 Bacteria 3093
567 nmdc:mga0yw44_633331_c1 3300050492 Bacteria 727
568 nmdc:mga05p37_1409197_c1 3300050507 Unclassified 701
569 nmdc:mga05p37_425867_c1 3300050507 Bacteria 1543
570 nmdc:mga05p37_433661_c1 3300050507 Bacteria 1526
571 nmdc:mga0qj67_359205_c1 3300050509 Bacteria 1177
572 nmdc:mga06r32_845297_c1 3300050510 Bacteria 874
573 nmdc:mga08y16_14040_c1 3300050511 Bacteria 8430
574 nmdc:mga0n895_1010823_c1 3300050512 Bacteria 812
575 nmdc:mga0rr50_497742_c1 3300050513 Bacteria 1036
576 Ga0495601_0129798 3300053077 Bacteria 1641
577 Ga0495601_0202730 3300053077 Bacteria 1296
578 Ga0495655_0027026 3300053083 Bacteria 1357
579 Ga0495655_0357710 3300053083 Bacteria 512
580 Ga0495595_0037190 3300053084 Bacteria 2212
581 Ga0495619_0556052 3300053085 Unclassified 787
582 Ga0495619_0828973 3300053085 Bacteria 625
583 Ga0501084_0098854 3300054114 Bacteria 2450
584 Ga0501082_0486542 3300060353 Bacteria 1078
585 Ga0466962_0589931 3300061719 Bacteria 566
586 Ga0530510_0268395 3300061734 Bacteria 1273
587 Ga0530510_0349355 3300061734 Bacteria 1111
588 Ga0496106_0336544
589 Ga0070658_10120530
590 Ga0070658_10655778
591 Ga0070658_11754297
592 Ga0070676_10187819
593 Ga0070676_11006928
594 Ga0070683_100005729
595 Ga0068869_100204699
596 Ga0068869_100623769
597 Ga0070680_100013061
598 Ga0070682_100021260
599 Ga0070682_100137372
600 Ga0068868_101552658
601 Ga0070660_100003398
602 Ga0070660_100008279
603 Ga0070660_100014577
604 Ga0070660_101443687
605 Ga0070687_100980916
606 Ga0070661_100269520
607 Ga0070692_10073229
608 Ga0070671_100289163
609 Ga0070674_100220641
610 Ga0070659_100230108
611 Ga0070659_100333536
612 Ga0070659_100432732
613 Ga0070659_101931189
614 Ga0070703_10041410
615 Ga0070709_10039709
616 Ga0070709_10040745
617 Ga0070709_10402841
618 Ga0070714_100035545
619 Ga0070714_100098485
620 Ga0070714_100119582
621 Ga0070714_100256614
622 Ga0070714_101335423
623 Ga0070714_101576509
624 Ga0070714_101576511
625 Ga0070713_100035142
626 Ga0070713_100789734
627 Ga0070713_101164008
628 Ga0070705_101054411
629 Ga0070705_101252065
630 Ga0070700_100242816
631 Ga0070700_100397295
632 Ga0070694_100495840
633 Ga0070694_100634115
634 Ga0070694_100922407
635 Ga0070678_100315199
636 Ga0070662_100850617
637 Ga0070681_10035668
638 Ga0070681_10057340
639 Ga0070681_10062107
640 Ga0070681_10147627
641 Ga0070681_10330604
642 Ga0070681_10428494
643 Ga0068867_100222834
644 Ga0070706_100607930
645 Ga0070707_100028519
646 Ga0070707_100550430
647 Ga0070707_102286498
648 Ga0070698_100026743
649 Ga0070698_100028350
650 Ga0070698_100242213
651 Ga0070679_100075139
652 Ga0070679_100096451
653 Ga0070679_100250426
654 Ga0070679_100996284
655 Ga0070679_101209783
656 Ga0070679_101817432
657 Ga0070684_100021699
658 Ga0070684_100189734
659 Ga0070684_100375971
660 Ga0070672_100739468
661 Ga0070695_100122685
662 Ga0070696_100103662
663 Ga0070704_100207829
664 Ga0068855_100041774
665 Ga0068855_102297202
666 Ga0070664_100468853
667 Ga0070664_100758281
668 Ga0068857_100001566
669 Ga0068857_100110849
670 Ga0068857_100915570
671 Ga0068854_100391371
672 Ga0068854_101625378
673 Ga0070702_100091926
674 Ga0068852_100090411
675 Ga0068852_100336607
676 Ga0068864_100375786
677 Ga0068864_101207423
678 Ga0068861_100212878
679 Ga0068861_101508996
680 Ga0068851_10389214
681 Ga0068870_10186090
682 Ga0068858_100332703
683 Ga0070717_10082234
684 Ga0070717_10094164
685 Ga0070717_10155388
686 Ga0075365_10237086
687 Ga0070712_100090356
688 Ga0070712_101000220
689 Ga0075367_10483616
690 Ga0075428_100165995
691 Ga0075428_100522854
692 Ga0075430_101438458
693 Ga0075431_100040786
694 Ga0075434_101420338
695 Ga0068865_102213102
696 Ga0075436_100371319
697 Ga0105250_10510846
698 Ga0105240_10227646
699 Ga0105240_10826530
700 Ga0111539_10009040
701 Ga0105245_10008435
702 Ga0105245_10050028
703 Ga0105245_10093694
704 Ga0105245_10244672
705 Ga0114129_10203894
706 Ga0114129_10316118
707 Ga0114129_10370645
708 Ga0114129_11640042
709 Ga0105243_10124367
710 Ga0105243_10822658
711 Ga0105243_11643286
712 Ga0105241_10615659
713 Ga0105241_11160161
714 Ga0105242_10655752
715 Ga0105248_10406763
716 Ga0105237_12071015
717 Ga0105237_12592175
718 Ga0105238_10347766
719 Ga0105238_12756190
720 Ga0105249_11296023
721 Ga0105239_10381040
722 Ga0105239_10647333
723 Ga0105239_11555823
724 Ga0105239_11896781
725 Ga0105246_10056193
726 Ga0157373_10102639
727 Ga0157373_10126113
728 Ga0157373_10268982
729 Ga0157371_11124580
730 Ga0157371_11248192
731 Ga0157370_10018694
732 Ga0157370_10109603
733 Ga0157370_10429379
734 Ga0157370_11602860
735 Ga0157369_10006178
736 Ga0157369_10030501
737 Ga0157369_10061676
738 Ga0157369_10348917
739 Ga0157369_11788410
740 Ga0157378_11694482
741 Ga0163162_11652993
742 Ga0157372_10635586
743 Ga0157372_11379033
744 Ga0157375_10796359
745 Ga0157375_12240825
746 Ga0163163_11792347
747 Ga0157380_11616085
748 Ga0157380_11920941
749 Ga0182008_10001010
750 Ga0182008_10150851
751 Ga0182008_10196585
752 Ga0182006_1016684
753 Ga0182007_10015408
754 Ga0182007_10169782
755 Ga0163161_10399156
756 Ga0197907_10371673
757 Ga0206356_10240272
758 Ga0206356_11704471
759 Ga0206354_10358543
760 Ga0206354_11360781
761 Ga0206353_10804099
762 Ga0206353_11969477
763 Ga0207688_10085658
764 Ga0207699_10208037
765 Ga0207699_10380642
766 Ga0207699_10747812
767 Ga0207645_10403456
768 Ga0207643_10106124
769 Ga0207705_10222330
770 Ga0207705_10290177
771 Ga0207705_10427540
772 Ga0207705_10691310
773 Ga0207684_11086967
774 Ga0207707_10080669
775 Ga0207707_10112059
776 Ga0207707_10341664
777 Ga0207707_10589534
778 Ga0207707_10708860
779 Ga0207707_11108455
780 Ga0207695_10579247
781 Ga0207693_10301263
782 Ga0207693_10359419
783 Ga0207660_10116430
784 Ga0207660_10254056
785 Ga0207660_10667286
786 Ga0207657_10000388
787 Ga0207657_10010339
788 Ga0207652_10007590
789 Ga0207652_10091565
790 Ga0207652_10097733
791 Ga0207652_10621089
792 Ga0207652_10714358
793 Ga0207652_11085973
794 Ga0207646_10011935
795 Ga0207646_10550340
796 Ga0207646_10660505
797 Ga0207646_10977459
798 Ga0207681_11093256
799 Ga0207694_10207330
800 Ga0207694_11515395
801 Ga0207694_11636433
802 Ga0207687_10005764
803 Ga0207687_10616312
804 Ga0207687_10834972
805 Ga0207700_10000012
806 Ga0207700_11018933
807 Ga0207700_11277680
808 Ga0207664_10058978
809 Ga0207664_10099886
810 Ga0207664_10169968
811 Ga0207664_10287848
812 Ga0207664_10642588
813 Ga0207664_11092743
814 Ga0207644_10539755
815 Ga0207690_10303491
816 Ga0207690_10401821
817 Ga0207690_11292081
818 Ga0207706_10065050
819 Ga0207709_11525121
820 Ga0207669_10708365
821 Ga0207665_10004044
822 Ga0207665_11010602
823 Ga0207691_10153028
824 Ga0207661_10030134
825 Ga0207661_10076157
826 Ga0207661_10188601
827 Ga0207661_10297458
828 Ga0207679_10738909
829 Ga0207667_10014195
830 Ga0207667_10504217
831 Ga0207667_10606503
832 Ga0207667_11414808
833 Ga0207712_10044145
834 Ga0207712_10134244
835 Ga0207712_11052071
836 Ga0207668_10173423
837 Ga0207640_10178824
838 Ga0207640_11589718
839 Ga0207677_11028610
840 Ga0207639_10063676
841 Ga0207678_10196840
842 Ga0207708_10004285
843 Ga0207708_10581414
844 Ga0207702_10193378
845 Ga0207648_10145311
846 Ga0207676_11003863
847 Ga0207676_11467860
848 Ga0207674_10007765
849 Ga0207674_10152194
850 Ga0207674_10402805
851 Ga0207674_10578602
852 Ga0207674_10717027
853 Ga0207675_100024563
854 Ga0207675_100855793
855 Ga0207683_10437193
856 Ga0207698_10212817
857 Ga0209974_10172801
858 Ga0207428_10008468
859 Ga0268265_11439767
860 Ga0265337_1039588
861 Ga0265326_10004775
862 Ga0265326_10218220
863 Ga0265319_1001269
864 Ga0265319_1005634
865 Ga0265319_1072331
866 Ga0265334_10002271
867 Ga0265334_10023620
868 Ga0265318_10002578
869 Ga0265318_10007841
870 Ga0265318_10171486
871 Ga0265323_10076354
872 Ga0265322_10032908
873 Ga0265322_10039522
874 Ga0265336_10022955
875 Ga0265338_10003691
876 Ga0265338_10007351
877 Ga0265338_10016386
878 Ga0265338_10237863
879 Ga0265324_10032475
880 Ga0265330_10001454
881 Ga0265332_10001859
882 Ga0265332_10102808
883 Ga0265328_10000553
884 Ga0265320_10003137
885 Ga0265320_10022368
886 Ga0265320_10189525
887 Ga0265325_10001515
888 Ga0265325_10057518
889 Ga0265329_10001572
890 Ga0265329_10320785
891 Ga0265340_10003259
892 Ga0265340_10044224
893 Ga0265339_10003002
894 Ga0265339_10105639
895 Ga0265331_10001988
896 Ga0265331_10298467
897 Ga0265327_10003921
898 Ga0265327_10013925
899 Ga0265327_10040184
900 Ga0265316_10004716
901 Ga0265316_10005504
902 Ga0265316_10124633
903 Ga0265316_10220772
904 Ga0307408_100025321
905 Ga0307408_100237638
906 Ga0265313_10003149
907 Ga0316575_10277909
908 Ga0265314_10003611
909 Ga0265314_10072160
910 Ga0265342_10001768
911 Ga0265342_10066700
912 Ga0307405_10132517
913 Ga0307405_11615618
914 Ga0307410_10047338
915 Ga0307410_10329930
916 Ga0307406_10023246
917 Ga0307406_10474587
918 Ga0307412_10038184
919 Ga0307412_12241993
920 Ga0307409_100020528
921 Ga0307416_100002750
922 Ga0307416_100439810
923 Ga0307414_10020232
924 Ga0307411_10045813
925 Ga0307415_100074927
926 Ga0307415_101956194
927 Ga0316583_10051282
928 Ga0316583_10175675
929 Ga0373934_0135735
930 Ga0373954_0251581
931 Ga0373956_0138072
932 Ga0373957_0394755
933 Ga0373955_0542812
934 Ga0373924_0068531
935 Ga0373937_0569778
936 Ga0395899_0002861
937 Ga0395899_0003419
938 Ga0395899_0006126
939 Ga0395899_0104355
940 Ga0395899_0271972
941 Ga0395899_0462699
942 Ga0395900_0091883
943 Ga0395900_0204082
944 Ga0395900_0254506
945 Ga0395900_0890566
946 Ga0395900_1023461
947 Ga0395900_1505207
948 Ga0395898_0001886
949 Ga0395898_0038076
950 Ga0395898_0044034
951 Ga0395898_0117144
952 Ga0395898_0147891
953 Ga0395898_0198660
954 Ga0395898_0232307
955 Ga0395898_0443978
956 Ga0395898_0486471
957 Ga0395898_0524571
958 Ga0395898_1609404
959 Ga0395898_1761652
960 Ga0395905_0006720
961 Ga0395905_0031126
962 Ga0395905_0127513
963 Ga0395905_0147876
964 Ga0395901_0020755
965 Ga0395901_0047926
966 Ga0395901_0062506
967 Ga0395901_0115634
968 Ga0395901_0174647
969 Ga0395901_0212852
970 Ga0395901_0441297
971 Ga0395901_0552295
972 Ga0395901_0845719
973 Ga0395901_1118512
974 Ga0395901_1847162
975 Ga0242420_032860
976 Ga0436360_0975496
977 Ga0436362_1260713
978 Ga0451798_0491999
979 Ga0451800_1563233
980 Ga0451853_3980493
981 Ga0450906_087238
982 Ga0450908_073946
983 Ga0439459_0075564
984 Ga0450916_042888
985 Ga0466972_0213033
986 Ga0466966_0028061
987 Ga0466961_0145035
988 Ga0466961_0842060
989 Ga0466963_0005592
990 Ga0466963_0025377
991 Ga0466963_0046731
992 Ga0466963_0102783
993 Ga0466963_0160614
994 Ga0466963_0203375
995 Ga0466963_0285925
996 Ga0466963_0432060
997 Ga0466963_0473237
998 Ga0466963_0498225
999 Ga0466964_0402801
1000 Ga0466971_0024818
1001 Ga0466970_0471290
1002 Ga0466957_0037927
1003 Ga0466957_0060644
1004 Ga0466957_0255344
1005 Ga0466957_0295586
1006 Ga0466960_0091410
1007 Ga0466960_0197453
1008 Ga0466959_0479906
1009 Ga0466959_0534814
1010 Ga0451576_0046462
1011 Ga0451576_0755929
1012 Ga0466958_0011649
1013 Ga0466958_0034402
1014 Ga0466958_0041096
1015 Ga0466967_0002328
1016 Ga0466967_0005509
1017 Ga0466967_0025009
1018 Ga0466967_0031365
1019 Ga0466967_0041018
1020 Ga0466967_0042655
1021 Ga0466967_0046656
1022 Ga0466967_0072351
1023 Ga0466967_0090183
1024 Ga0466967_0124924
1025 Ga0466967_0150944
1026 Ga0466967_0168812
1027 Ga0466967_0173177
1028 Ga0466967_0180002
1029 Ga0466967_0207959
1030 Ga0466967_0286870
1031 Ga0466967_0485236
1032 Ga0466967_0563109
1033 Ga0466967_0638276
1034 Ga0466967_0711892
1035 Ga0495629_0195540
1036 Ga0495641_0132948
1037 Ga0495651_0332843
1038 Ga0495653_0165326
1039 Ga0495653_0389752
1040 Ga0495605_0349652
1041 Ga0495639_0650911
1042 Ga0495664_0440966
1043 Ga0495584_0045370
1044 Ga0495585_0058778
1045 Ga0495596_0317284
1046 Ga0495608_0066869
1047 Ga0495618_0166022
1048 Ga0495628_0738294
1049 Ga0495637_0226961
1050 Ga0495644_0399718
1051 Ga0495663_0021110
1052 Ga0495652_0379253
1053 Ga0495652_0456681
1054 Ga0495654_0199577
1055 Ga0495640_0563697
1056 Ga0495587_0714120
1057 Ga0495598_0019821
1058 Ga0495609_0121645
1059 Ga0495621_0049382
1060 Ga0495597_0181456
1061 Ga0495633_0283242
1062 Ga0495656_0018102
1063 Ga0495656_0058907
1064 Ga0495668_0513089
1065 Ga0495634_0358727
1066 Ga0495634_0812769
1067 Ga0495611_0040578
1068 Ga0495635_0436861
1069 Ga0495635_0569976
1070 Ga0495657_0033172
1071 Ga0495613_0301089
1072 Ga0495613_0612226
1073 Ga0495670_0227750
1074 Ga0495671_0332822
1075 Ga0495589_0034458
1076 Ga0495600_0404962
1077 Ga0495674_1030248
1078 Ga0495680_0098320
1079 Ga0495680_0389558
1080 Ga0495677_0275511
1081 Ga0495677_0442224
1082 Ga0495684_0208608
1083 Ga0496100_1001740
1084 Ga0496101_0975213
1085 Ga0496101_1060810
1086 Ga0496102_0925521
1087 Ga0496102_1381709
1088 Ga0496103_0418678
1089 Ga0496104_0313705
1090 Ga0496104_1326777
1091 Ga0496106_0001856
1092 Ga0496106_0419288
1093 Ga0496106_0980419
1094 Ga0496107_0029123
1095 Ga0496107_0890619
1096 Ga0496108_0458672
1097 Ga0496108_0630274
1098 Ga0496109_0001953
1099 Ga0496109_0100769
1100 Ga0496109_0130074
1101 Ga0496110_0003586
1102 Ga0496110_0008300
1103 Ga0496110_0011237
1104 Ga0496111_0016313
1105 Ga0496111_0161001
1106 Ga0496111_0323827
1107 Ga0496111_1171394
1108 Ga0496112_0022546
1109 Ga0496112_0028506
1110 Ga0496112_0107315
1111 Ga0496112_0208500
1112 Ga0496112_0309667
1113 Ga0496112_1005770
1114 Ga0496112_1546476
1115 Ga0496113_0187245
1116 Ga0496113_0219254
1117 Ga0496113_0304137
1118 Ga0496113_0384306
1119 Ga0496115_0291423
1120 Ga0495678_151962
1121 Ga0501291_071328
1122 Ga0501031_0010035
1123 Ga0501034_0025130
1124 Ga0501037_0013435
1125 Ga0501038_0004512
1126 Ga0501039_0028620
1127 Ga0501040_0008979
1128 Ga0501040_0578208
1129 Ga0501041_0228921
1130 Ga0501042_0089431
1131 Ga0501043_0001258
1132 Ga0501046_0020345
1133 Ga0501048_0041983
1134 Ga0501067_0284530
1135 Ga0501068_0000695
1136 Ga0501069_0074203
1137 Ga0501069_0083244
1138 Ga0501069_0176083
1139 Ga0501070_0009516
1140 Ga0501072_0052114
1141 Ga0501073_0000769
1142 Ga0501074_0038752
1143 Ga0501075_0039944
1144 Ga0501076_0980282
1145 Ga0501251_012021
1146 Ga0501079_0010912
1147 Ga0501079_0382207
1148 Ga0501080_0071721
1149 Ga0501081_0008853
1150 Ga0501083_0011179
1151 Ga0501035_0065407
1152 Ga0501044_0004238
1153 Ga0501045_0048568
1154 nmdc:mga0yw44_633331_c1
1155 nmdc:mga05p37_1409197_c1
1156 nmdc:mga05p37_425867_c1
1157 nmdc:mga05p37_433661_c1
1158 nmdc:mga0qj67_359205_c1
1159 nmdc:mga06r32_845297_c1
1160 nmdc:mga08y16_14040_c1
1161 nmdc:mga0n895_1010823_c1
1162 nmdc:mga0rr50_497742_c1
1163 Ga0495601_0129798
1164 Ga0495601_0202730
1165 Ga0495655_0027026
1166 Ga0495655_0357710
1167 Ga0495595_0037190
1168 Ga0495619_0556052
1169 Ga0495619_0828973
1170 Ga0501084_0098854
1171 Ga0501082_0486542
1172 Ga0466962_0589931
1173 Ga0530510_0268395
1174 Ga0530510_0349355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

3

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y9h-assembly1.cif.gz_B crystal structure of diterpene synthase vena from streptomyces venezuelae atcc 15439 0.6093 2 57
7y9g-assembly1.cif.gz_A crystal structure of diterpene synthase vena from streptomyces venezuelae atcc 15439 in complex with pyrophosphate 0.5835 2 57
7y9g-assembly1.cif.gz_B crystal structure of diterpene synthase vena from streptomyces venezuelae atcc 15439 in complex with pyrophosphate 0.5816 2 57
7blz-assembly1.cif.gz_K red alga c.merolae photosystem i 0.5679 1 65
7blz-assembly1.cif.gz_K red alga c.merolae photosystem i 0.5587 1 65
ID Description Score Start End Superfamily
af_Q8T4I0_15_313_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8621 17 48 3.40.1190.20
1ddnD02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.7989 22 50 1.10.60.10
1ddnD02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.5533 22 50 1.10.60.10
af_P9WMS9_2_118_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4997 3 81 1.10.287.70
af_P77682_7_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4855 10 109 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A497L5V6-F1-model_v4 Probable membrane transporter protein 0.9276 3 111 GO:0005886
AF-A0A7Y8F6F7-F1-model_v4 Probable membrane transporter protein 0.9142 4 112 GO:0005886
AF-A0A7X4DNF4-F1-model_v4 Probable membrane transporter protein 0.8999 10 114 GO:0005886
AF-A0A7X7PR24-F1-model_v4 Probable membrane transporter protein 0.8929 3 82 GO:0005886
AF-A0A353DDT8-F1-model_v4 Probable membrane transporter protein 0.8908 2 84 GO:0005886

Map