F466686

General Info

Members Datasets Scaffolds Average Seq Length
587 338 586 160

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0114088|Ga0451577_0114088_214_810
Length 198
Sequence MKRPRADGGPPSQPHRAIFMARIDRPEFGNADLPSQEKTMTPKNTICLWYDGTALDAARFYAATFPDSAVGAIFHAPSDYPMGTAGDVLTVEFTVIGIPCLGLNGGPMFKHTEAFSFQVATDDQAETDRLWNSIIDSGGQASECGWCKDKWGLSWQITPRALTEALADPDRAAAKRAFDAMMQMGKIDIAKIEAARRG

Samples

Sample ID Description Type Environment
1 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
231 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
322 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
328 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.31
Nodule 0
Rhizoplane 4.77
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10056301 3300001990 Bacteria 1188
2 JGI25156J39149_1009741 3300002705 Bacteria 2311
3 JGI25152J39213_1013807 3300002773 Bacteria 1666
4 JGI25150J39212_1002186 3300002774 Bacteria 4998
5 JGI25159J45721_1000166 3300002987 Bacteria 30609
6 JGI25159J45721_1040528 3300002987 Bacteria 682
7 JGI25151J46595_10001854 3300003187 Bacteria 13602
8 JGI25151J46595_10029968 3300003187 Bacteria 2146
9 JGI25160J50197_1000352 3300003354 Bacteria 30609
10 JGI25161J50226_1000268 3300003374 Bacteria 30609
11 Ga0055539_1000521 3300003752 Bacteria 11784
12 Ga0055533_1000073 3300003756 Bacteria 142476
13 Ga0055533_1000805 3300003756 Bacteria 9761
14 Ga0055525_1002058 3300003759 Bacteria 2411
15 Ga0055526_1000015 3300003771 Bacteria 226543
16 Ga0055526_1000802 3300003771 Bacteria 23436
17 Ga0055537_1000053 3300003773 Bacteria 82599
18 Ga0055524_1000020 3300003775 Bacteria 227971
19 Ga0055524_1000059 3300003775 Bacteria 138562
20 Ga0055534_1000017 3300003784 Bacteria 138670
21 Ga0055534_1004910 3300003784 Bacteria 3738
22 Ga0055528_1000008 3300003790 Bacteria 226543
23 Ga0055543_1000361 3300004625 Bacteria 30407
24 Ga0065165_1004330 3300005262 Bacteria 8913
25 Ga0065714_10000625 3300005288 Bacteria 3371
26 Ga0065714_10004677 3300005288 Bacteria 4620
27 Ga0065714_10017235 3300005288 Bacteria 1826
28 Ga0065714_10106783 3300005288 Bacteria 1533
29 Ga0065714_10493790 3300005288 Bacteria 527
30 Ga0065704_10214136 3300005289 Bacteria 1097
31 Ga0065715_10059901 3300005293 Bacteria 784
32 Ga0065715_10111326 3300005293 Bacteria 2578
33 Ga0065715_10533244 3300005293 Bacteria 754
34 Ga0065707_10013027 3300005295 Bacteria 2497
35 Ga0065707_10095187 3300005295 Bacteria 3407
36 Ga0070658_10010248 3300005327 Bacteria 7515
37 Ga0070658_10029811 3300005327 Bacteria 4383
38 Ga0070658_10055328 3300005327 Bacteria 3223
39 Ga0070676_10132855 3300005328 Bacteria 1576
40 Ga0070683_100001582 3300005329 Bacteria 17608
41 Ga0070683_100091563 3300005329 Bacteria 2855
42 Ga0070690_100181988 3300005330 Bacteria 1453
43 Ga0070690_100427305 3300005330 Bacteria 978
44 Ga0070670_100045953 3300005331 Bacteria 3754
45 Ga0070670_100047703 3300005331 Bacteria 3686
46 Ga0070677_10467642 3300005333 Bacteria 678
47 Ga0068869_100010901 3300005334 Bacteria 5946
48 Ga0070666_10110394 3300005335 Bacteria 1901
49 Ga0070680_100000041 3300005336 Bacteria 66075
50 Ga0070680_100131720 3300005336 Bacteria 2092
51 Ga0068868_100004978 3300005338 Bacteria 9331
52 Ga0068868_101140604 3300005338 Bacteria 719
53 Ga0070660_100010221 3300005339 Bacteria 6623
54 Ga0070660_100165522 3300005339 Bacteria 1784
55 Ga0070660_100419115 3300005339 Bacteria 1108
56 Ga0070689_100023905 3300005340 Bacteria 4581
57 Ga0070661_100006146 3300005344 Bacteria 8272
58 Ga0070661_100435245 3300005344 Bacteria 1041
59 Ga0070661_100520883 3300005344 Bacteria 954
60 Ga0070661_100960164 3300005344 Bacteria 707
61 Ga0070668_100026333 3300005347 Bacteria 4413
62 Ga0070668_101330100 3300005347 Bacteria 654
63 Ga0070669_100016215 3300005353 Bacteria 5314
64 Ga0070669_100039483 3300005353 Bacteria 3430
65 Ga0070669_100429310 3300005353 Bacteria 1086
66 Ga0070675_100004394 3300005354 Bacteria 10754
67 Ga0070675_100007321 3300005354 Bacteria 8519
68 Ga0070675_100018914 3300005354 Bacteria 5487
69 Ga0070675_100028447 3300005354 Bacteria 4498
70 Ga0070675_100207935 3300005354 Bacteria 1700
71 Ga0070675_100704322 3300005354 Bacteria 920
72 Ga0070671_100007061 3300005355 Bacteria 8994
73 Ga0070674_100002771 3300005356 Bacteria 9684
74 Ga0070673_100008183 3300005364 Bacteria 6940
75 Ga0070673_100036119 3300005364 Bacteria 3753
76 Ga0070673_100164912 3300005364 Bacteria 1887
77 Ga0070673_100599499 3300005364 Bacteria 1005
78 Ga0070688_100006764 3300005365 Bacteria 6147
79 Ga0070659_100035370 3300005366 Bacteria 3890
80 Ga0070659_100049641 3300005366 Bacteria 3300
81 Ga0070659_100182942 3300005366 Bacteria 1720
82 Ga0070659_100612650 3300005366 Bacteria 936
83 Ga0070659_100790481 3300005366 Bacteria 825
84 Ga0070667_100014655 3300005367 Bacteria 6477
85 Ga0070667_100130592 3300005367 Bacteria 2192
86 Ga0070667_100214261 3300005367 Bacteria 1713
87 Ga0070667_100265847 3300005367 Bacteria 1537
88 Ga0070714_100007323 3300005435 Bacteria 8582
89 Ga0070711_100006250 3300005439 Bacteria 7172
90 Ga0070700_100038543 3300005441 Bacteria 2913
91 Ga0070700_100982256 3300005441 Bacteria 693
92 Ga0070663_100122120 3300005455 Bacteria 1969
93 Ga0070663_100485559 3300005455 Bacteria 1023
94 Ga0070678_100001706 3300005456 Bacteria 11799
95 Ga0070678_100446090 3300005456 Bacteria 1133
96 Ga0070662_100106107 3300005457 Bacteria 2133
97 Ga0068867_100004255 3300005459 Bacteria 10073
98 Ga0068867_100079565 3300005459 Bacteria 2467
99 Ga0068867_100987525 3300005459 Bacteria 763
100 Ga0070679_101126552 3300005530 Bacteria 729
101 Ga0070684_100005545 3300005535 Bacteria 9684
102 Ga0070684_100548730 3300005535 Bacteria 1072
103 Ga0068853_100282417 3300005539 Bacteria 1530
104 Ga0068853_100336097 3300005539 Bacteria 1403
105 Ga0068853_100482508 3300005539 Bacteria 1169
106 Ga0070672_100009342 3300005543 Bacteria 6754
107 Ga0070672_100010541 3300005543 Bacteria 6414
108 Ga0070672_100205615 3300005543 Bacteria 1647
109 Ga0070672_100409992 3300005543 Bacteria 1162
110 Ga0070695_100410240 3300005545 Bacteria 1029
111 Ga0070693_100100735 3300005547 Bacteria 1759
112 Ga0068855_100000557 3300005563 Bacteria 45786
113 Ga0068855_100009023 3300005563 Bacteria 12049
114 Ga0068855_100027441 3300005563 Bacteria 6810
115 Ga0068855_100827487 3300005563 Bacteria 982
116 Ga0070664_100020556 3300005564 Bacteria 5436
117 Ga0070664_100096849 3300005564 Bacteria 2561
118 Ga0070664_100111261 3300005564 Bacteria 2390
119 Ga0070664_100193987 3300005564 Bacteria 1810
120 Ga0068857_100013457 3300005577 Bacteria 7126
121 Ga0068857_101315633 3300005577 Bacteria 702
122 Ga0068854_100000054 3300005578 Bacteria 84435
123 Ga0068854_100235699 3300005578 Bacteria 1455
124 Ga0068856_100144590 3300005614 Bacteria 2385
125 Ga0068856_100902215 3300005614 Bacteria 903
126 Ga0070702_100928410 3300005615 Bacteria 683
127 Ga0070702_100969993 3300005615 Bacteria 671
128 Ga0068852_100566344 3300005616 Bacteria 1138
129 Ga0068859_100325510 3300005617 Bacteria 1631
130 Ga0068859_101103405 3300005617 Bacteria 873
131 Ga0068864_100059273 3300005618 Bacteria 3311
132 Ga0068864_100257580 3300005618 Bacteria 1622
133 Ga0068864_100806571 3300005618 Bacteria 923
134 Ga0068866_10010553 3300005718 Bacteria 3965
135 Ga0068866_10378732 3300005718 Bacteria 907
136 Ga0068861_100003049 3300005719 Bacteria 11062
137 Ga0068861_100006599 3300005719 Bacteria 7918
138 Ga0068851_10019685 3300005834 Bacteria 3263
139 Ga0068863_100074984 3300005841 Bacteria 3201
140 Ga0068863_100296172 3300005841 Bacteria 1569
141 Ga0068863_100693806 3300005841 Bacteria 1012
142 Ga0068863_101096238 3300005841 Bacteria 801
143 Ga0068858_100541377 3300005842 Bacteria 1127
144 Ga0068858_100949215 3300005842 Bacteria 842
145 Ga0068860_100004998 3300005843 Bacteria 13512
146 Ga0068860_100240302 3300005843 Bacteria 1761
147 Ga0068862_100072016 3300005844 Bacteria 2985
148 Ga0068862_100102941 3300005844 Bacteria 2500
149 Ga0075368_10254408 3300006042 Bacteria 751
150 Ga0075363_100051072 3300006048 Bacteria 2204
151 Ga0075364_10152316 3300006051 Bacteria 1558
152 Ga0075432_10062752 3300006058 Bacteria 1326
153 Ga0075362_10007518 3300006177 Bacteria 4130
154 Ga0075362_10112917 3300006177 Bacteria 1280
155 Ga0075369_10116449 3300006186 Bacteria 1207
156 Ga0075366_10011855 3300006195 Bacteria 4932
157 Ga0075366_10121666 3300006195 Bacteria 1573
158 Ga0075366_10417142 3300006195 Bacteria 827
159 Ga0097621_100019420 3300006237 Bacteria 5215
160 Ga0097621_100027470 3300006237 Bacteria 4475
161 Ga0075370_10002921 3300006353 Bacteria 8031
162 Ga0075370_10004114 3300006353 Bacteria 7009
163 Ga0075370_10009981 3300006353 Bacteria 4949
164 Ga0075370_10186863 3300006353 Bacteria 1220
165 Ga0075370_10312715 3300006353 Bacteria 935
166 Ga0068871_100040501 3300006358 Bacteria 3731
167 Ga0068871_100434357 3300006358 Bacteria 1174
168 Ga0075430_100543998 3300006846 Bacteria 958
169 Ga0068865_100004612 3300006881 Bacteria 8321
170 Ga0097620_100325483 3300006931 Bacteria 1631
171 Ga0097620_101103557 3300006931 Bacteria 873
172 Ga0105244_10022162 3300009036 Bacteria 3498
173 Ga0105240_10041264 3300009093 Bacteria 5892
174 Ga0105240_10176421 3300009093 Bacteria 2526
175 Ga0105240_10755085 3300009093 Bacteria 1057
176 Ga0111539_10078852 3300009094 Bacteria 3873
177 Ga0111539_10420615 3300009094 Bacteria 1556
178 Ga0105245_10071877 3300009098 Bacteria 3142
179 Ga0105245_12490765 3300009098 Bacteria 571
180 Ga0105247_10107539 3300009101 Bacteria 1791
181 Ga0105248_10142710 3300009177 Bacteria 2702
182 Ga0105248_10292627 3300009177 Bacteria 1834
183 Ga0105248_10378080 3300009177 Bacteria 1595
184 Ga0105248_10401178 3300009177 Bacteria 1544
185 Ga0105237_10028309 3300009545 Bacteria 5709
186 Ga0105237_10104756 3300009545 Bacteria 2820
187 Ga0105238_10074057 3300009551 Bacteria 3398
188 Ga0105238_10079054 3300009551 Bacteria 3278
189 Ga0105238_10550934 3300009551 Bacteria 1158
190 Ga0105239_10886089 3300010375 Bacteria 1024
191 Ga0157373_10323525 3300013100 Bacteria 1097
192 Ga0157371_10149126 3300013102 Bacteria 1667
193 Ga0157370_10024804 3300013104 Bacteria 5937
194 Ga0157370_10082622 3300013104 Bacteria 3021
195 Ga0157370_10816387 3300013104 Bacteria 848
196 Ga0157370_11091654 3300013104 Bacteria 721
197 Ga0157369_10269500 3300013105 Bacteria 1774
198 Ga0157374_10005044 3300013296 Bacteria 11075
199 Ga0157374_10014248 3300013296 Bacteria 6953
200 Ga0157374_10114617 3300013296 Bacteria 2595
201 Ga0157374_10152900 3300013296 Bacteria 2244
202 Ga0157378_10015098 3300013297 Bacteria 6760
203 Ga0157378_10633558 3300013297 Bacteria 1083
204 Ga0163162_10005279 3300013306 Bacteria 12465
205 Ga0163162_10160195 3300013306 Bacteria 2372
206 Ga0163162_10384544 3300013306 Bacteria 1537
207 Ga0163162_11682808 3300013306 Bacteria 724
208 Ga0163162_11916346 3300013306 Bacteria 678
209 Ga0157372_10038778 3300013307 Bacteria 5258
210 Ga0157372_10053836 3300013307 Bacteria 4487
211 Ga0157375_10001449 3300013308 Bacteria 20400
212 Ga0157375_10642021 3300013308 Bacteria 1218
213 Ga0157375_10918574 3300013308 Bacteria 1018
214 Ga0163163_10026023 3300014325 Bacteria 5587
215 Ga0163163_10612352 3300014325 Bacteria 1152
216 Ga0163163_11060730 3300014325 Bacteria 873
217 Ga0182008_10009806 3300014497 Bacteria 5153
218 Ga0157377_10020376 3300014745 Bacteria 3473
219 Ga0157377_10049289 3300014745 Bacteria 2367
220 Ga0157379_10039193 3300014968 Bacteria 4227
221 Ga0157379_10409677 3300014968 Bacteria 1247
222 Ga0157379_11046843 3300014968 Bacteria 780
223 Ga0157376_10062869 3300014969 Bacteria 3125
224 Ga0157376_10146612 3300014969 Bacteria 2124
225 Ga0157376_11474270 3300014969 Bacteria 713
226 Ga0182006_1101622 3300015261 Bacteria 1020
227 Ga0183360_10002 3300015689 Bacteria 953821
228 Ga0163161_10037395 3300017792 Bacteria 3480
229 Ga0163161_10104378 3300017792 Bacteria 2113
230 Ga0163161_10629547 3300017792 Bacteria 887
231 Ga0163161_10770943 3300017792 Bacteria 806
232 Ga0209436_103839 3300025208 Bacteria 3849
233 Ga0209674_100014 3300025226 Bacteria 704989
234 Ga0209674_100039 3300025226 Bacteria 402292
235 Ga0209563_100110 3300025230 Bacteria 142518
236 Ga0209563_113760 3300025230 Bacteria 1057
237 Ga0207427_102251 3300025231 Bacteria 5411
238 Ga0207425_1001058 3300025245 Bacteria 12702
239 Ga0209677_100151 3300025253 Bacteria 63642
240 Ga0209759_1002704 3300025256 Bacteria 7560
241 Ga0209129_1011522 3300025258 Bacteria 2103
242 Ga0209565_1000001 3300025263 Bacteria 2950419
243 Ga0209565_1000715 3300025263 Bacteria 20127
244 Ga0209565_1001682 3300025263 Bacteria 9177
245 Ga0209673_1000001 3300025273 Bacteria 3176258
246 Ga0209673_1031221 3300025273 Bacteria 1661
247 Ga0209673_1041159 3300025273 Bacteria 1315
248 Ga0209130_1000202 3300025284 Bacteria 80333
249 Ga0209130_1019365 3300025284 Bacteria 1579
250 Ga0209675_1000001 3300025291 Bacteria 2950293
251 Ga0209675_1001344 3300025291 Bacteria 14518
252 Ga0209675_1001827 3300025291 Bacteria 11609
253 Ga0209675_1009899 3300025291 Bacteria 3313
254 Ga0209676_1024661 3300025292 Bacteria 1942
255 Ga0209025_1000008 3300025294 Bacteria 1130876
256 Ga0209025_1002511 3300025294 Bacteria 19206
257 Ga0209025_1014325 3300025294 Bacteria 4889
258 Ga0209025_1047426 3300025294 Bacteria 1754
259 Ga0209564_1000001 3300025295 Bacteria 3176258
260 Ga0209564_1000049 3300025295 Bacteria 362075
261 Ga0209564_1041766 3300025295 Bacteria 1226
262 Ga0209758_1049721 3300025297 Bacteria 1477
263 Ga0209050_1004979 3300025298 Bacteria 8645
264 Ga0209256_1000006 3300025299 Bacteria 1250310
265 Ga0209256_1000014 3300025299 Bacteria 687409
266 Ga0207426_1000145 3300025302 Bacteria 191065
267 Ga0209257_1007844 3300025304 Bacteria 6303
268 Ga0207697_10029375 3300025315 Bacteria 2250
269 Ga0207656_10237648 3300025321 Bacteria 889
270 Ga0207656_10376132 3300025321 Bacteria 712
271 Ga0207696_1031516 3300025711 Bacteria 1603
272 Ga0207655_1026871 3300025728 Bacteria 2755
273 Ga0207713_1055262 3300025735 Bacteria 1551
274 Ga0207682_10011620 3300025893 Bacteria 3440
275 Ga0207688_10014298 3300025901 Bacteria 4319
276 Ga0207688_10265002 3300025901 Bacteria 1044
277 Ga0207688_10428542 3300025901 Bacteria 823
278 Ga0207645_10010376 3300025907 Bacteria 6394
279 Ga0207645_10210049 3300025907 Bacteria 1282
280 Ga0207643_10135149 3300025908 Bacteria 1470
281 Ga0207705_10018657 3300025909 Bacteria 4961
282 Ga0207705_10169706 3300025909 Bacteria 1642
283 Ga0207695_10781901 3300025913 Bacteria 835
284 Ga0207695_10798367 3300025913 Bacteria 824
285 Ga0207671_10132077 3300025914 Bacteria 1917
286 Ga0207671_10133942 3300025914 Bacteria 1904
287 Ga0207660_10008583 3300025917 Bacteria 6610
288 Ga0207660_10606994 3300025917 Bacteria 891
289 Ga0207657_10008125 3300025919 Bacteria 10700
290 Ga0207657_10015410 3300025919 Bacteria 7404
291 Ga0207657_10041456 3300025919 Bacteria 4070
292 Ga0207657_10063799 3300025919 Bacteria 3147
293 Ga0207657_10133216 3300025919 Bacteria 2035
294 Ga0207657_10321636 3300025919 Bacteria 1223
295 Ga0207649_10678676 3300025920 Bacteria 798
296 Ga0207649_11006988 3300025920 Bacteria 656
297 Ga0207681_10032402 3300025923 Bacteria 3421
298 Ga0207681_10042853 3300025923 Bacteria 3026
299 Ga0207681_10059547 3300025923 Bacteria 2618
300 Ga0207681_10193700 3300025923 Bacteria 1557
301 Ga0207694_10004583 3300025924 Bacteria 10769
302 Ga0207694_10401792 3300025924 Bacteria 1139
303 Ga0207650_10007016 3300025925 Bacteria 7685
304 Ga0207650_10011973 3300025925 Bacteria 5979
305 Ga0207650_10416344 3300025925 Bacteria 1114
306 Ga0207659_10007489 3300025926 Bacteria 6716
307 Ga0207659_10377058 3300025926 Bacteria 1182
308 Ga0207659_10649221 3300025926 Bacteria 902
309 Ga0207687_10532649 3300025927 Bacteria 984
310 Ga0207664_10025854 3300025929 Bacteria 4429
311 Ga0207644_10039506 3300025931 Bacteria 3331
312 Ga0207690_10023767 3300025932 Bacteria 3830
313 Ga0207690_10049880 3300025932 Bacteria 2792
314 Ga0207690_10110381 3300025932 Bacteria 1980
315 Ga0207690_10689691 3300025932 Bacteria 839
316 Ga0207706_10000377 3300025933 Bacteria 48494
317 Ga0207706_10271971 3300025933 Bacteria 1478
318 Ga0207706_10489415 3300025933 Bacteria 1062
319 Ga0207686_10163158 3300025934 Bacteria 1564
320 Ga0207670_10004663 3300025936 Bacteria 7430
321 Ga0207669_10006834 3300025937 Bacteria 5246
322 Ga0207704_10002130 3300025938 Bacteria 8874
323 Ga0207691_10001087 3300025940 Bacteria 27045
324 Ga0207691_10017913 3300025940 Bacteria 6712
325 Ga0207691_10066542 3300025940 Bacteria 3260
326 Ga0207691_10069635 3300025940 Bacteria 3178
327 Ga0207691_10173395 3300025940 Bacteria 1888
328 Ga0207691_10701883 3300025940 Bacteria 853
329 Ga0207711_10028975 3300025941 Bacteria 4665
330 Ga0207689_10000312 3300025942 Bacteria 44850
331 Ga0207661_10220419 3300025944 Bacteria 1676
332 Ga0207679_10118564 3300025945 Bacteria 2102
333 Ga0207679_10430411 3300025945 Bacteria 1166
334 Ga0207679_11140853 3300025945 Bacteria 715
335 Ga0207679_11467432 3300025945 Bacteria 626
336 Ga0207667_10000062 3300025949 Bacteria 190422
337 Ga0207667_10014452 3300025949 Bacteria 9000
338 Ga0207667_10124236 3300025949 Bacteria 2659
339 Ga0207667_10329064 3300025949 Bacteria 1560
340 Ga0207667_10459970 3300025949 Bacteria 1292
341 Ga0207667_11398262 3300025949 Bacteria 673
342 Ga0207651_10004049 3300025960 Bacteria 7300
343 Ga0207651_10006137 3300025960 Bacteria 6248
344 Ga0207651_10069966 3300025960 Bacteria 2480
345 Ga0207712_10211137 3300025961 Bacteria 1546
346 Ga0207668_10003807 3300025972 Bacteria 8889
347 Ga0207668_10025498 3300025972 Bacteria 3827
348 Ga0207640_10000022 3300025981 Bacteria 167526
349 Ga0207640_10417242 3300025981 Bacteria 1097
350 Ga0207658_10092952 3300025986 Bacteria 2344
351 Ga0207658_10585579 3300025986 Bacteria 1001
352 Ga0207658_11101495 3300025986 Bacteria 725
353 Ga0207677_10014689 3300026023 Bacteria 4582
354 Ga0207703_10316055 3300026035 Bacteria 1429
355 Ga0207703_10878048 3300026035 Bacteria 858
356 Ga0207639_10028948 3300026041 Bacteria 4050
357 Ga0207639_10236220 3300026041 Bacteria 1587
358 Ga0207639_10780721 3300026041 Bacteria 889
359 Ga0207678_10015906 3300026067 Bacteria 6610
360 Ga0207678_10068028 3300026067 Bacteria 3056
361 Ga0207678_10189412 3300026067 Bacteria 1758
362 Ga0207708_10047022 3300026075 Bacteria 3287
363 Ga0207702_10930754 3300026078 Bacteria 861
364 Ga0207641_10005319 3300026088 Bacteria 10991
365 Ga0207641_10223664 3300026088 Bacteria 1747
366 Ga0207648_10002883 3300026089 Bacteria 18211
367 Ga0207648_10105675 3300026089 Bacteria 2470
368 Ga0207648_10354638 3300026089 Bacteria 1323
369 Ga0207676_10015577 3300026095 Bacteria 5488
370 Ga0207676_10653995 3300026095 Bacteria 1014
371 Ga0207674_10004125 3300026116 Bacteria 17573
372 Ga0207674_10120585 3300026116 Bacteria 2591
373 Ga0207675_100000484 3300026118 Bacteria 38611
374 Ga0207675_100098057 3300026118 Bacteria 2760
375 Ga0207683_10028823 3300026121 Bacteria 4804
376 Ga0207683_10068898 3300026121 Bacteria 3124
377 Ga0207698_10135407 3300026142 Bacteria 2113
378 Ga0207698_10299062 3300026142 Bacteria 1497
379 Ga0207698_10476213 3300026142 Bacteria 1210
380 Ga0209813_10427011 3300027866 Bacteria 538
381 Ga0207428_10408270 3300027907 Bacteria 994
382 Ga0268266_10267412 3300028379 Bacteria 1586
383 Ga0268265_10005260 3300028380 Bacteria 8858
384 Ga0268264_10092018 3300028381 Bacteria 2617
385 Ga0265336_10000010 3300028666 Bacteria 277947
386 Ga0307517_10362783 3300028786 Bacteria 782
387 Ga0307515_10773987 3300028794 Bacteria 580
388 Ga0265324_10001918 3300029957 Bacteria 11166
389 Ga0265328_10023123 3300031239 Bacteria 2359
390 Ga0265331_10001794 3300031250 Bacteria 15294
391 Ga0265327_10000035 3300031251 Bacteria 314419
392 Ga0307513_10002924 3300031456 Bacteria 23356
393 Ga0307408_100001343 3300031548 Bacteria 18435
394 Ga0307408_101885909 3300031548 Bacteria 573
395 Ga0307516_10000414 3300031730 Bacteria 55918
396 Ga0307516_10098574 3300031730 Bacteria 2741
397 Ga0307413_10378574 3300031824 Bacteria 1102
398 Ga0307406_10126661 3300031901 Bacteria 1786
399 Ga0307407_10428405 3300031903 Bacteria 955
400 Ga0307412_10719979 3300031911 Bacteria 858
401 Ga0307416_102062651 3300032002 Bacteria 672
402 Ga0307414_10143666 3300032004 Bacteria 1872
403 Ga0307414_10316368 3300032004 Bacteria 1327
404 Ga0307411_10760013 3300032005 Bacteria 850
405 Ga0373934_0089134 3300035086 Bacteria 1243
406 Ga0373940_0178108 3300035088 Bacteria 690
407 Ga0373944_0011729 3300035089 Bacteria 2405
408 Ga0373960_0149668 3300035121 Bacteria 796
409 Ga0373931_0002297 3300035691 Bacteria 8449
410 Ga0373931_0069220 3300035691 Bacteria 1923
411 Ga0373931_0257880 3300035691 Bacteria 1063
412 Ga0373927_0015547 3300035695 Bacteria 5027
413 Ga0373925_0005471 3300037068 Bacteria 9455
414 Ga0373925_0523925 3300037068 Bacteria 974
415 Ga0395898_0100671 3300037466 Bacteria 2775
416 Ga0395905_0758475 3300037471 Bacteria 873
417 Ga0436364_0315105 3300037853 Bacteria 1139
418 Ga0436364_0513231 3300037853 Bacteria 893
419 Ga0395901_0006003 3300038443 Bacteria 12303
420 Ga0395901_0506109 3300038443 Bacteria 1229
421 Ga0439439_0067088 3300041406 Bacteria 958
422 Ga0439447_000358 3300041407 Bacteria 16566
423 Ga0439453_0016610 3300041408 Bacteria 1285
424 Ga0451787_603998 3300041441 Bacteria 563
425 Ga0451789_1110718 3300041443 Bacteria 833
426 Ga0451793_0837470 3300041452 Bacteria 2282
427 Ga0451800_0379387 3300041459 Bacteria 971
428 Ga0451804_0978710 3300041463 Bacteria 962
429 Ga0451807_0221148 3300041486 Bacteria 1049
430 Ga0451849_0693586 3300041505 Bacteria 1352
431 Ga0451853_2526807 3300041512 Bacteria 846
432 Ga0450898_008446 3300042134 Bacteria 1625
433 Ga0450903_000708 3300042138 Bacteria 6634
434 Ga0450893_0009900 3300042532 Bacteria 1560
435 Ga0451577_0114088 3300042876 Bacteria 2419
436 Ga0451577_0127603 3300042876 Bacteria 2280
437 Ga0466965_0070068 3300044683 Bacteria 1762
438 Ga0466963_0420326 3300044694 Bacteria 943
439 Ga0453684_0001907 3300044712 Bacteria 54115
440 Ga0451576_0155907 3300045051 Bacteria 2382
441 Ga0495617_002342 3300046452 Bacteria 7599
442 Ga0495592_0030903 3300046454 Bacteria 4051
443 Ga0495603_0005347 3300046455 Bacteria 7660
444 Ga0495590_0005444 3300046457 Bacteria 5053
445 Ga0495591_001925 3300046458 Bacteria 12176
446 Ga0495629_0083677 3300046459 Bacteria 2227
447 Ga0495629_0116301 3300046459 Bacteria 1864
448 Ga0495638_0208016 3300046460 Bacteria 1100
449 Ga0495653_0026095 3300046463 Bacteria 4689
450 Ga0495650_0003373 3300046471 Bacteria 11701
451 Ga0495605_0001792 3300046474 Bacteria 13780
452 Ga0495584_0021626 3300046491 Bacteria 3266
453 Ga0495585_0002387 3300046492 Bacteria 13468
454 Ga0495585_0003550 3300046492 Bacteria 10475
455 Ga0495607_0035702 3300046501 Bacteria 3004
456 Ga0495583_0048231 3300046506 Bacteria 1955
457 Ga0495610_0019865 3300046512 Bacteria 3745
458 Ga0495616_0088322 3300046513 Bacteria 1471
459 Ga0495616_0094174 3300046513 Bacteria 1413
460 Ga0495628_0063187 3300046516 Bacteria 2901
461 Ga0495631_0002606 3300046518 Bacteria 10080
462 Ga0495632_0001099 3300046519 Bacteria 23165
463 Ga0495632_0007523 3300046519 Bacteria 6825
464 Ga0495637_0007043 3300046520 Bacteria 5599
465 Ga0495643_0021242 3300046522 Bacteria 3727
466 Ga0495644_0047350 3300046523 Bacteria 1615
467 Ga0495644_0146595 3300046523 Bacteria 902
468 Ga0495648_0188691 3300046524 Bacteria 1041
469 Ga0495648_0188962 3300046524 Bacteria 1040
470 Ga0495642_0000415 3300046528 Bacteria 22842
471 Ga0495642_0022979 3300046528 Bacteria 2460
472 Ga0495654_0051871 3300046530 Bacteria 2000
473 Ga0495665_0380762 3300046531 Bacteria 717
474 Ga0495640_0027391 3300046533 Bacteria 4111
475 Ga0495586_0102952 3300046535 Bacteria 1585
476 Ga0495587_0000190 3300046536 Bacteria 45240
477 Ga0495609_0001763 3300046538 Bacteria 13897
478 Ga0495609_0093097 3300046538 Bacteria 1309
479 Ga0495597_0030641 3300046542 Bacteria 2450
480 Ga0495597_0124504 3300046542 Bacteria 1072
481 Ga0495622_0001288 3300046557 Bacteria 12869
482 Ga0495622_0027356 3300046557 Bacteria 2662
483 Ga0495622_0084328 3300046557 Bacteria 1461
484 Ga0495656_0030780 3300046615 Bacteria 2171
485 Ga0495656_0249341 3300046615 Bacteria 896
486 Ga0495668_0377480 3300046616 Bacteria 778
487 Ga0495634_0001714 3300046642 Bacteria 19026
488 Ga0495634_0283130 3300046642 Bacteria 1006
489 Ga0495611_0033499 3300046648 Bacteria 2267
490 Ga0495625_0087225 3300046660 Bacteria 2163
491 Ga0495625_0132768 3300046660 Bacteria 1685
492 Ga0495635_0000350 3300046663 Bacteria 29321
493 Ga0495661_0177388 3300046665 Bacteria 1131
494 Ga0495588_0015425 3300046674 Bacteria 3677
495 Ga0495588_0118185 3300046674 Bacteria 1397
496 Ga0495623_0000943 3300046679 Bacteria 19601
497 Ga0495646_0000790 3300046680 Bacteria 17703
498 Ga0495646_0003348 3300046680 Bacteria 9963
499 Ga0495647_0100292 3300046681 Bacteria 1198
500 Ga0495658_0057510 3300046683 Bacteria 2222
501 Ga0495669_0005909 3300046684 Bacteria 5101
502 Ga0495669_0154975 3300046684 Bacteria 1085
503 Ga0495613_0088680 3300046689 Bacteria 2241
504 Ga0495670_0030514 3300046691 Bacteria 2677
505 Ga0495670_0041789 3300046691 Bacteria 2288
506 Ga0495671_0002591 3300046692 Bacteria 11374
507 Ga0495671_0090853 3300046692 Bacteria 1494
508 Ga0495671_0404444 3300046692 Bacteria 653
509 Ga0495649_0035434 3300046694 Bacteria 2745
510 Ga0495589_0036578 3300046794 Bacteria 2460
511 Ga0495660_0060106 3300046810 Bacteria 2042
512 Ga0495660_0179410 3300046810 Bacteria 1025
513 Ga0495674_0013811 3300047319 Bacteria 7579
514 Ga0495672_0103464 3300047320 Bacteria 1540
515 Ga0495676_0095568 3300047321 Bacteria 2211
516 Ga0495680_0046363 3300047322 Bacteria 3427
517 Ga0495683_0144893 3300047323 Bacteria 1110
518 Ga0495675_0003809 3300047444 Bacteria 9133
519 Ga0495677_0001204 3300047445 Bacteria 10364
520 Ga0495677_0036075 3300047445 Bacteria 1805
521 Ga0495685_014601 3300047447 Bacteria 2670
522 Ga0495673_0001372 3300047469 Bacteria 19678
523 Ga0495673_0022361 3300047469 Bacteria 3101
524 Ga0495673_0120106 3300047469 Bacteria 1041
525 Ga0495681_0002913 3300047470 Bacteria 12093
526 Ga0495681_0121745 3300047470 Bacteria 1119
527 Ga0495593_0070663 3300047673 Bacteria 1813
528 Ga0495593_0098503 3300047673 Bacteria 1501
529 Ga0496100_0016146 3300048903 Bacteria 4378
530 Ga0496102_0000821 3300048905 Bacteria 30135
531 Ga0496102_0262216 3300048905 Bacteria 1629
532 Ga0496103_0001316 3300048906 Bacteria 16847
533 Ga0496104_0222530 3300048907 Bacteria 1800
534 Ga0496104_0748819 3300048907 Bacteria 884
535 Ga0496105_0020731 3300048908 Bacteria 5314
536 Ga0496105_0410507 3300048908 Bacteria 1074
537 Ga0496106_0107708 3300048909 Bacteria 2167
538 Ga0496107_0658980 3300048910 Bacteria 771
539 Ga0496108_0033870 3300048911 Bacteria 4243
540 Ga0496108_1171137 3300048911 Bacteria 651
541 Ga0496109_0067738 3300048912 Bacteria 3271
542 Ga0496110_0113356 3300048913 Bacteria 2438
543 Ga0496110_0175764 3300048913 Bacteria 1943
544 Ga0496110_0226727 3300048913 Bacteria 1699
545 Ga0496111_0063457 3300048914 Bacteria 2679
546 Ga0496113_0343318 3300048916 Bacteria 1197
547 Ga0496114_0146173 3300048917 Bacteria 2049
548 Ga0496115_0004304 3300048918 Bacteria 10306
549 Ga0496115_0321587 3300048918 Bacteria 1265
550 Ga0496115_0792429 3300048918 Bacteria 738
551 Ga0496116_0011895 3300048919 Bacteria 7159
552 Ga0496117_0013466 3300048920 Bacteria 7133
553 Ga0496117_0013650 3300048920 Bacteria 7068
554 Ga0496118_0003083 3300048921 Bacteria 21369
555 Ga0496118_0004488 3300048921 Bacteria 16523
556 Ga0496121_0001221 3300048924 Bacteria 44771
557 Ga0496121_0321052 3300048924 Bacteria 1042
558 Ga0496124_0241392 3300048927 Bacteria 1343
559 Ga0496125_0014795 3300048928 Bacteria 7579
560 Ga0496126_0000134 3300048929 Bacteria 169693
561 Ga0496126_0094223 3300048929 Bacteria 2628
562 Ga0495678_176468 3300049459 Bacteria 672
563 Ga0495682_0002634 3300049460 Bacteria 8392
564 Ga0495682_0110363 3300049460 Bacteria 985
565 Ga0501036_0011020 3300049572 Bacteria 7478
566 Ga0501037_0021408 3300049573 Bacteria 4778
567 Ga0501043_0005420 3300049579 Bacteria 10310
568 Ga0501046_0202587 3300049580 Bacteria 1476
569 Ga0501239_007749 3300049672 Bacteria 1132
570 Ga0501241_017980 3300049758 Bacteria 1294
571 Ga0501044_0009893 3300049823 Bacteria 10363
572 nmdc:mga03683_141319_c1 3300050489 Bacteria 1082
573 nmdc:mga0k408_104369_c1 3300050493 Bacteria 1673
574 nmdc:mga0k408_127377_c1 3300050493 Bacteria 1510
575 nmdc:mga0k408_1391_c2 3300050493 Bacteria 12211
576 nmdc:mga0k408_258090_c1 3300050493 Bacteria 1041
577 nmdc:mga06z11_25701_c1 3300050494 Bacteria 2794
578 nmdc:mga07m45_1397_c1 3300050496 Bacteria 11030
579 nmdc:mga07m45_218_c2 3300050496 Bacteria 22025
580 nmdc:mga07m45_228436_c1 3300050496 Bacteria 1083
581 nmdc:mga07m45_5866_c1 3300050496 Bacteria 6164
582 nmdc:mga09592_736429_c1 3300050508 Bacteria 837
583 nmdc:mga0qj67_314293_c1 3300050509 Bacteria 1268
584 nmdc:mga0n895_680479_c1 3300050512 Bacteria 1026
585 nmdc:mga0sz30_7459_c1 3300050516 Bacteria 4102
586 Ga0500555_140833 3300053103 Bacteria 594

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10007518 Ga0075362_100075185 157
2 3300006186 Ga0075369_10116449 Ga0075369_101164491 157
3 3300006353 Ga0075370_10002921 Ga0075370_100029214 157
4 3300050493 nmdc:mga0k408_104369_c1 nmdc:mga0k408_104369_c1_887_1366 157
5 3300050494 nmdc:mga06z11_25701_c1 nmdc:mga06z11_25701_c1_155_634 157
6 3300050496 nmdc:mga07m45_5866_c1 nmdc:mga07m45_5866_c1_2363_2842 157
7 3300050516 nmdc:mga0sz30_7459_c1 nmdc:mga0sz30_7459_c1_2465_2944 157
8 3300002987 JGI25159J45721_1040528 JGI25159J45721_10405282 158
9 3300003784 Ga0055534_1004910 Ga0055534_10049102 158
10 3300009101 Ga0105247_10107539 Ga0105247_101075393 158
11 3300014325 Ga0163163_10612352 Ga0163163_106123522 158
12 3300014968 Ga0157379_10409677 Ga0157379_104096771 158
13 3300014969 Ga0157376_10146612 Ga0157376_101466122 158
14 3300025273 Ga0209673_1041159 Ga0209673_10411591 158
15 3300025291 Ga0209675_1001827 Ga0209675_10018278 158
16 3300025292 Ga0209676_1024661 Ga0209676_10246613 158
17 3300025294 Ga0209025_1047426 Ga0209025_10474263 158
18 3300025295 Ga0209564_1041766 Ga0209564_10417661 158
19 3300025304 Ga0209257_1007844 Ga0209257_10078445 158
20 3300041512 Ga0451853_2526807 Ga0451853_2526807_34_525 158
21 3300002705 JGI25156J39149_1009741 JGI25156J39149_10097411 159
22 3300002773 JGI25152J39213_1013807 JGI25152J39213_10138072 159
23 3300002774 JGI25150J39212_1002186 JGI25150J39212_10021866 159
24 3300002987 JGI25159J45721_1000166 JGI25159J45721_100016627 159
25 3300003187 JGI25151J46595_10001854 JGI25151J46595_100018544 159
26 3300003187 JGI25151J46595_10029968 JGI25151J46595_100299684 159
27 3300003354 JGI25160J50197_1000352 JGI25160J50197_100035227 159
28 3300003374 JGI25161J50226_1000268 JGI25161J50226_100026827 159
29 3300003752 Ga0055539_1000521 Ga0055539_100052112 159
30 3300003756 Ga0055533_1000073 Ga0055533_1000073106 159
31 3300003759 Ga0055525_1002058 Ga0055525_10020582 159
32 3300003771 Ga0055526_1000015 Ga0055526_100001593 159
33 3300003771 Ga0055526_1000802 Ga0055526_100080213 159
34 3300003773 Ga0055537_1000053 Ga0055537_100005331 159
35 3300003775 Ga0055524_1000020 Ga0055524_1000020216 159
36 3300003775 Ga0055524_1000059 Ga0055524_100005950 159
37 3300003784 Ga0055534_1000017 Ga0055534_100001794 159
38 3300003790 Ga0055528_1000008 Ga0055528_100000893 159
39 3300004625 Ga0055543_1000361 Ga0055543_100036127 159
40 3300005262 Ga0065165_1004330 Ga0065165_100433010 159
41 3300005288 Ga0065714_10000625 Ga0065714_100006253 159
42 3300005288 Ga0065714_10004677 Ga0065714_100046774 159
43 3300005288 Ga0065714_10017235 Ga0065714_100172353 159
44 3300005288 Ga0065714_10106783 Ga0065714_101067832 159
45 3300005288 Ga0065714_10493790 Ga0065714_104937901 159
46 3300005289 Ga0065704_10214136 Ga0065704_102141361 159
47 3300005293 Ga0065715_10059901 Ga0065715_100599012 159
48 3300005293 Ga0065715_10111326 Ga0065715_101113262 159
49 3300005295 Ga0065707_10095187 Ga0065707_100951872 159
50 3300005327 Ga0070658_10010248 Ga0070658_100102485 159
51 3300005327 Ga0070658_10055328 Ga0070658_100553282 159
52 3300005328 Ga0070676_10132855 Ga0070676_101328552 159
53 3300005329 Ga0070683_100091563 Ga0070683_1000915633 159
54 3300005330 Ga0070690_100181988 Ga0070690_1001819882 159
55 3300005333 Ga0070677_10467642 Ga0070677_104676421 159
56 3300005334 Ga0068869_100010901 Ga0068869_1000109014 159
57 3300005338 Ga0068868_100004978 Ga0068868_1000049784 159
58 3300005338 Ga0068868_101140604 Ga0068868_1011406042 159
59 3300005339 Ga0070660_100419115 Ga0070660_1004191151 159
60 3300005344 Ga0070661_100520883 Ga0070661_1005208831 159
61 3300005344 Ga0070661_100960164 Ga0070661_1009601642 159
62 3300005347 Ga0070668_100026333 Ga0070668_1000263334 159
63 3300005347 Ga0070668_101330100 Ga0070668_1013301002 159
64 3300005353 Ga0070669_100016215 Ga0070669_1000162154 159
65 3300005353 Ga0070669_100429310 Ga0070669_1004293101 159
66 3300005354 Ga0070675_100018914 Ga0070675_1000189141 159
67 3300005354 Ga0070675_100207935 Ga0070675_1002079352 159
68 3300005354 Ga0070675_100704322 Ga0070675_1007043221 159
69 3300005364 Ga0070673_100164912 Ga0070673_1001649122 159
70 3300005366 Ga0070659_100049641 Ga0070659_1000496412 159
71 3300005366 Ga0070659_100612650 Ga0070659_1006126501 159
72 3300005366 Ga0070659_100790481 Ga0070659_1007904811 159
73 3300005367 Ga0070667_100214261 Ga0070667_1002142612 159
74 3300005367 Ga0070667_100265847 Ga0070667_1002658472 159
75 3300005441 Ga0070700_100038543 Ga0070700_1000385433 159
76 3300005455 Ga0070663_100122120 Ga0070663_1001221202 159
77 3300005455 Ga0070663_100485559 Ga0070663_1004855592 159
78 3300005456 Ga0070678_100446090 Ga0070678_1004460902 159
79 3300005457 Ga0070662_100106107 Ga0070662_1001061071 159
80 3300005459 Ga0068867_100004255 Ga0068867_10000425510 159
81 3300005535 Ga0070684_100548730 Ga0070684_1005487301 159
82 3300005539 Ga0068853_100336097 Ga0068853_1003360972 159
83 3300005543 Ga0070672_100010541 Ga0070672_1000105412 159
84 3300005543 Ga0070672_100409992 Ga0070672_1004099922 159
85 3300005545 Ga0070695_100410240 Ga0070695_1004102402 159
86 3300005547 Ga0070693_100100735 Ga0070693_1001007352 159
87 3300005563 Ga0068855_100000557 Ga0068855_10000055730 159
88 3300005563 Ga0068855_100009023 Ga0068855_1000090237 159
89 3300005563 Ga0068855_100027441 Ga0068855_1000274415 159
90 3300005564 Ga0070664_100111261 Ga0070664_1001112611 159
91 3300005564 Ga0070664_100193987 Ga0070664_1001939872 159
92 3300005577 Ga0068857_101315633 Ga0068857_1013156331 159
93 3300005578 Ga0068854_100000054 Ga0068854_10000005417 159
94 3300005578 Ga0068854_100235699 Ga0068854_1002356992 159
95 3300005614 Ga0068856_100144590 Ga0068856_1001445902 159
96 3300005615 Ga0070702_100928410 Ga0070702_1009284101 159
97 3300005616 Ga0068852_100566344 Ga0068852_1005663442 159
98 3300005718 Ga0068866_10378732 Ga0068866_103787322 159
99 3300005719 Ga0068861_100003049 Ga0068861_1000030494 159
100 3300005719 Ga0068861_100006599 Ga0068861_1000065992 159
101 3300005841 Ga0068863_100693806 Ga0068863_1006938062 159
102 3300005841 Ga0068863_101096238 Ga0068863_1010962381 159
103 3300005842 Ga0068858_100541377 Ga0068858_1005413772 159
104 3300005842 Ga0068858_100949215 Ga0068858_1009492151 159
105 3300005843 Ga0068860_100004998 Ga0068860_10000499813 159
106 3300005843 Ga0068860_100240302 Ga0068860_1002403022 159
107 3300005844 Ga0068862_100072016 Ga0068862_1000720163 159
108 3300005844 Ga0068862_100102941 Ga0068862_1001029412 159
109 3300006042 Ga0075368_10254408 Ga0075368_102544082 159
110 3300006048 Ga0075363_100051072 Ga0075363_1000510722 159
111 3300006051 Ga0075364_10152316 Ga0075364_101523162 159
112 3300006058 Ga0075432_10062752 Ga0075432_100627522 159
113 3300006177 Ga0075362_10112917 Ga0075362_101129172 159
114 3300006195 Ga0075366_10011855 Ga0075366_100118553 159
115 3300006195 Ga0075366_10121666 Ga0075366_101216661 159
116 3300006195 Ga0075366_10417142 Ga0075366_104171422 159
117 3300006237 Ga0097621_100019420 Ga0097621_1000194204 159
118 3300006353 Ga0075370_10004114 Ga0075370_100041148 159
119 3300006353 Ga0075370_10186863 Ga0075370_101868632 159
120 3300006353 Ga0075370_10312715 Ga0075370_103127152 159
121 3300006358 Ga0068871_100040501 Ga0068871_1000405013 159
122 3300006846 Ga0075430_100543998 Ga0075430_1005439981 159
123 3300006881 Ga0068865_100004612 Ga0068865_1000046126 159
124 3300009036 Ga0105244_10022162 Ga0105244_100221624 159
125 3300009093 Ga0105240_10041264 Ga0105240_100412644 159
126 3300009094 Ga0111539_10078852 Ga0111539_100788525 159
127 3300009098 Ga0105245_10071877 Ga0105245_100718773 159
128 3300009098 Ga0105245_12490765 Ga0105245_124907651 159
129 3300009177 Ga0105248_10142710 Ga0105248_101427103 159
130 3300009545 Ga0105237_10028309 Ga0105237_100283092 159
131 3300009545 Ga0105237_10104756 Ga0105237_101047563 159
132 3300009551 Ga0105238_10074057 Ga0105238_100740574 159
133 3300009551 Ga0105238_10079054 Ga0105238_100790542 159
134 3300010375 Ga0105239_10886089 Ga0105239_108860892 159
135 3300013100 Ga0157373_10323525 Ga0157373_103235251 159
136 3300013102 Ga0157371_10149126 Ga0157371_101491262 159
137 3300013104 Ga0157370_10024804 Ga0157370_100248043 159
138 3300013104 Ga0157370_10082622 Ga0157370_100826225 159
139 3300013104 Ga0157370_10816387 Ga0157370_108163871 159
140 3300013105 Ga0157369_10269500 Ga0157369_102695004 159
141 3300013296 Ga0157374_10005044 Ga0157374_100050443 159
142 3300013296 Ga0157374_10114617 Ga0157374_101146172 159
143 3300013296 Ga0157374_10152900 Ga0157374_101529002 159
144 3300013297 Ga0157378_10633558 Ga0157378_106335582 159
145 3300013306 Ga0163162_10005279 Ga0163162_100052796 159
146 3300013306 Ga0163162_10384544 Ga0163162_103845442 159
147 3300013306 Ga0163162_11682808 Ga0163162_116828081 159
148 3300013308 Ga0157375_10918574 Ga0157375_109185741 159
149 3300014745 Ga0157377_10020376 Ga0157377_100203764 159
150 3300014968 Ga0157379_10039193 Ga0157379_100391932 159
151 3300014969 Ga0157376_10062869 Ga0157376_100628691 159
152 3300015261 Ga0182006_1101622 Ga0182006_11016222 159
153 3300015689 Ga0183360_10002 Ga0183360_10002543 159
154 3300017792 Ga0163161_10104378 Ga0163161_101043782 159
155 3300025208 Ga0209436_103839 Ga0209436_1038396 159
156 3300025226 Ga0209674_100039 Ga0209674_100039298 159
157 3300025230 Ga0209563_100110 Ga0209563_10011032 159
158 3300025230 Ga0209563_113760 Ga0209563_1137602 159
159 3300025231 Ga0207427_102251 Ga0207427_1022517 159
160 3300025245 Ga0207425_1001058 Ga0207425_10010586 159
161 3300025253 Ga0209677_100151 Ga0209677_1001519 159
162 3300025256 Ga0209759_1002704 Ga0209759_10027043 159
163 3300025258 Ga0209129_1011522 Ga0209129_10115222 159
164 3300025263 Ga0209565_1000001 Ga0209565_1000001155 159
165 3300025263 Ga0209565_1000715 Ga0209565_10007155 159
166 3300025263 Ga0209565_1001682 Ga0209565_10016822 159
167 3300025273 Ga0209673_1000001 Ga0209673_1000001155 159
168 3300025273 Ga0209673_1031221 Ga0209673_10312212 159
169 3300025284 Ga0209130_1000202 Ga0209130_100020220 159
170 3300025284 Ga0209130_1019365 Ga0209130_10193651 159
171 3300025291 Ga0209675_1000001 Ga0209675_10000012377 159
172 3300025291 Ga0209675_1001344 Ga0209675_10013442 159
173 3300025291 Ga0209675_1009899 Ga0209675_10098994 159
174 3300025294 Ga0209025_1000008 Ga0209025_1000008771 159
175 3300025294 Ga0209025_1002511 Ga0209025_10025116 159
176 3300025294 Ga0209025_1014325 Ga0209025_10143255 159
177 3300025295 Ga0209564_1000001 Ga0209564_10000012539 159
178 3300025295 Ga0209564_1000049 Ga0209564_1000049340 159
179 3300025297 Ga0209758_1049721 Ga0209758_10497212 159
180 3300025298 Ga0209050_1004979 Ga0209050_10049792 159
181 3300025299 Ga0209256_1000006 Ga0209256_1000006975 159
182 3300025299 Ga0209256_1000014 Ga0209256_1000014299 159
183 3300025302 Ga0207426_1000145 Ga0207426_1000145127 159
184 3300025321 Ga0207656_10237648 Ga0207656_102376482 159
185 3300025711 Ga0207696_1031516 Ga0207696_10315162 159
186 3300025728 Ga0207655_1026871 Ga0207655_10268712 159
187 3300025735 Ga0207713_1055262 Ga0207713_10552622 159
188 3300025893 Ga0207682_10011620 Ga0207682_100116202 159
189 3300025901 Ga0207688_10014298 Ga0207688_100142983 159
190 3300025901 Ga0207688_10265002 Ga0207688_102650022 159
191 3300025907 Ga0207645_10010376 Ga0207645_100103764 159
192 3300025908 Ga0207643_10135149 Ga0207643_101351492 159
193 3300025909 Ga0207705_10018657 Ga0207705_100186574 159
194 3300025909 Ga0207705_10169706 Ga0207705_101697062 159
195 3300025914 Ga0207671_10132077 Ga0207671_101320773 159
196 3300025914 Ga0207671_10133942 Ga0207671_101339422 159
197 3300025919 Ga0207657_10008125 Ga0207657_100081256 159
198 3300025919 Ga0207657_10041456 Ga0207657_100414563 159
199 3300025919 Ga0207657_10133216 Ga0207657_101332164 159
200 3300025923 Ga0207681_10042853 Ga0207681_100428532 159
201 3300025923 Ga0207681_10059547 Ga0207681_100595472 159
202 3300025924 Ga0207694_10401792 Ga0207694_104017922 159
203 3300025926 Ga0207659_10649221 Ga0207659_106492212 159
204 3300025927 Ga0207687_10532649 Ga0207687_105326492 159
205 3300025932 Ga0207690_10023767 Ga0207690_100237674 159
206 3300025932 Ga0207690_10049880 Ga0207690_100498803 159
207 3300025932 Ga0207690_10110381 Ga0207690_101103811 159
208 3300025933 Ga0207706_10000377 Ga0207706_1000037728 159
209 3300025933 Ga0207706_10489415 Ga0207706_104894152 159
210 3300025934 Ga0207686_10163158 Ga0207686_101631583 159
211 3300025938 Ga0207704_10002130 Ga0207704_100021303 159
212 3300025940 Ga0207691_10069635 Ga0207691_100696355 159
213 3300025940 Ga0207691_10173395 Ga0207691_101733952 159
214 3300025941 Ga0207711_10028975 Ga0207711_100289754 159
215 3300025942 Ga0207689_10000312 Ga0207689_1000031217 159
216 3300025945 Ga0207679_10430411 Ga0207679_104304112 159
217 3300025949 Ga0207667_10000062 Ga0207667_1000006282 159
218 3300025949 Ga0207667_10014452 Ga0207667_100144528 159
219 3300025949 Ga0207667_10124236 Ga0207667_101242363 159
220 3300025960 Ga0207651_10069966 Ga0207651_100699662 159
221 3300025961 Ga0207712_10211137 Ga0207712_102111372 159
222 3300025972 Ga0207668_10003807 Ga0207668_100038075 159
223 3300025981 Ga0207640_10000022 Ga0207640_1000002230 159
224 3300025981 Ga0207640_10417242 Ga0207640_104172421 159
225 3300025986 Ga0207658_10585579 Ga0207658_105855792 159
226 3300025986 Ga0207658_11101495 Ga0207658_111014952 159
227 3300026035 Ga0207703_10316055 Ga0207703_103160552 159
228 3300026035 Ga0207703_10878048 Ga0207703_108780482 159
229 3300026041 Ga0207639_10236220 Ga0207639_102362202 159
230 3300026067 Ga0207678_10015906 Ga0207678_100159063 159
231 3300026067 Ga0207678_10189412 Ga0207678_101894122 159
232 3300026075 Ga0207708_10047022 Ga0207708_100470223 159
233 3300026088 Ga0207641_10223664 Ga0207641_102236642 159
234 3300026089 Ga0207648_10002883 Ga0207648_1000288315 159
235 3300026095 Ga0207676_10653995 Ga0207676_106539951 159
236 3300026118 Ga0207675_100000484 Ga0207675_10000048417 159
237 3300026121 Ga0207683_10068898 Ga0207683_100688983 159
238 3300026142 Ga0207698_10299062 Ga0207698_102990622 159
239 3300027866 Ga0209813_10427011 Ga0209813_104270111 159
240 3300027907 Ga0207428_10408270 Ga0207428_104082701 159
241 3300028379 Ga0268266_10267412 Ga0268266_102674121 159
242 3300028380 Ga0268265_10005260 Ga0268265_100052606 159
243 3300028381 Ga0268264_10092018 Ga0268264_100920183 159
244 3300028666 Ga0265336_10000010 Ga0265336_1000001037 159
245 3300028786 Ga0307517_10362783 Ga0307517_103627831 159
246 3300029957 Ga0265324_10001918 Ga0265324_100019184 159
247 3300031456 Ga0307513_10002924 Ga0307513_100029243 159
248 3300031548 Ga0307408_100001343 Ga0307408_10000134316 159
249 3300031548 Ga0307408_101885909 Ga0307408_1018859091 159
250 3300031730 Ga0307516_10000414 Ga0307516_1000041444 159
251 3300031730 Ga0307516_10098574 Ga0307516_100985742 159
252 3300031824 Ga0307413_10378574 Ga0307413_103785742 159
253 3300031901 Ga0307406_10126661 Ga0307406_101266613 159
254 3300031903 Ga0307407_10428405 Ga0307407_104284052 159
255 3300031911 Ga0307412_10719979 Ga0307412_107199791 159
256 3300032002 Ga0307416_102062651 Ga0307416_1020626512 159
257 3300032004 Ga0307414_10143666 Ga0307414_101436662 159
258 3300035088 Ga0373940_0178108 Ga0373940_0178108_64_543 159
259 3300035089 Ga0373944_0011729 Ga0373944_0011729_1587_2078 159
260 3300035121 Ga0373960_0149668 Ga0373960_0149668_63_542 159
261 3300035691 Ga0373931_0002297 Ga0373931_0002297_679_1158 159
262 3300035691 Ga0373931_0069220 Ga0373931_0069220_172_651 159
263 3300035691 Ga0373931_0257880 Ga0373931_0257880_115_594 159
264 3300035695 Ga0373927_0015547 Ga0373927_0015547_73_564 159
265 3300037068 Ga0373925_0005471 Ga0373925_0005471_2632_3123 159
266 3300037068 Ga0373925_0523925 Ga0373925_0523925_371_907 159
267 3300037466 Ga0395898_0100671 Ga0395898_0100671_550_1029 159
268 3300038443 Ga0395901_0006003 Ga0395901_0006003_1942_2421 159
269 3300038443 Ga0395901_0506109 Ga0395901_0506109_345_824 159
270 3300041407 Ga0439447_000358 Ga0439447_000358_7262_7741 159
271 3300041408 Ga0439453_0016610 Ga0439453_0016610_520_999 159
272 3300041441 Ga0451787_603998 Ga0451787_603998_62_541 159
273 3300041452 Ga0451793_0837470 Ga0451793_0837470_273_752 159
274 3300041463 Ga0451804_0978710 Ga0451804_0978710_416_901 159
275 3300041486 Ga0451807_0221148 Ga0451807_0221148_210_689 159
276 3300041505 Ga0451849_0693586 Ga0451849_0693586_32_511 159
277 3300042134 Ga0450898_008446 Ga0450898_008446_147_626 159
278 3300042138 Ga0450903_000708 Ga0450903_000708_5812_6291 159
279 3300042532 Ga0450893_0009900 Ga0450893_0009900_603_1082 159
280 3300042876 Ga0451577_0114088 Ga0451577_0114088_214_810 159
281 3300042876 Ga0451577_0127603 Ga0451577_0127603_976_1470 159
282 3300044683 Ga0466965_0070068 Ga0466965_0070068_720_1199 159
283 3300044694 Ga0466963_0420326 Ga0466963_0420326_24_503 159
284 3300045051 Ga0451576_0155907 Ga0451576_0155907_1603_2082 159
285 3300046452 Ga0495617_002342 Ga0495617_002342_2089_2568 159
286 3300046455 Ga0495603_0005347 Ga0495603_0005347_3843_4322 159
287 3300046457 Ga0495590_0005444 Ga0495590_0005444_78_557 159
288 3300046458 Ga0495591_001925 Ga0495591_001925_9385_9864 159
289 3300046459 Ga0495629_0083677 Ga0495629_0083677_194_679 159
290 3300046459 Ga0495629_0116301 Ga0495629_0116301_245_724 159
291 3300046460 Ga0495638_0208016 Ga0495638_0208016_425_904 159
292 3300046463 Ga0495653_0026095 Ga0495653_0026095_3816_4295 159
293 3300046471 Ga0495650_0003373 Ga0495650_0003373_9073_9552 159
294 3300046474 Ga0495605_0001792 Ga0495605_0001792_7356_7835 159
295 3300046491 Ga0495584_0021626 Ga0495584_0021626_2470_2949 159
296 3300046492 Ga0495585_0002387 Ga0495585_0002387_12463_12942 159
297 3300046492 Ga0495585_0003550 Ga0495585_0003550_2356_2835 159
298 3300046501 Ga0495607_0035702 Ga0495607_0035702_1967_2446 159
299 3300046506 Ga0495583_0048231 Ga0495583_0048231_960_1439 159
300 3300046512 Ga0495610_0019865 Ga0495610_0019865_1912_2391 159
301 3300046513 Ga0495616_0088322 Ga0495616_0088322_463_942 159
302 3300046513 Ga0495616_0094174 Ga0495616_0094174_680_1159 159
303 3300046516 Ga0495628_0063187 Ga0495628_0063187_2110_2589 159
304 3300046518 Ga0495631_0002606 Ga0495631_0002606_9178_9657 159
305 3300046519 Ga0495632_0001099 Ga0495632_0001099_18739_19218 159
306 3300046519 Ga0495632_0007523 Ga0495632_0007523_3191_3670 159
307 3300046520 Ga0495637_0007043 Ga0495637_0007043_2127_2606 159
308 3300046522 Ga0495643_0021242 Ga0495643_0021242_2889_3368 159
309 3300046523 Ga0495644_0047350 Ga0495644_0047350_1031_1510 159
310 3300046523 Ga0495644_0146595 Ga0495644_0146595_390_869 159
311 3300046524 Ga0495648_0188691 Ga0495648_0188691_33_512 159
312 3300046524 Ga0495648_0188962 Ga0495648_0188962_529_1008 159
313 3300046528 Ga0495642_0000415 Ga0495642_0000415_20021_20500 159
314 3300046528 Ga0495642_0022979 Ga0495642_0022979_225_704 159
315 3300046530 Ga0495654_0051871 Ga0495654_0051871_1260_1739 159
316 3300046531 Ga0495665_0380762 Ga0495665_0380762_112_591 159
317 3300046536 Ga0495587_0000190 Ga0495587_0000190_16539_17018 159
318 3300046538 Ga0495609_0001763 Ga0495609_0001763_3230_3709 159
319 3300046538 Ga0495609_0093097 Ga0495609_0093097_426_905 159
320 3300046542 Ga0495597_0030641 Ga0495597_0030641_649_1128 159
321 3300046542 Ga0495597_0124504 Ga0495597_0124504_168_647 159
322 3300046557 Ga0495622_0001288 Ga0495622_0001288_9848_10327 159
323 3300046557 Ga0495622_0027356 Ga0495622_0027356_1022_1501 159
324 3300046557 Ga0495622_0084328 Ga0495622_0084328_261_740 159
325 3300046615 Ga0495656_0030780 Ga0495656_0030780_159_638 159
326 3300046615 Ga0495656_0249341 Ga0495656_0249341_145_624 159
327 3300046616 Ga0495668_0377480 Ga0495668_0377480_82_561 159
328 3300046642 Ga0495634_0001714 Ga0495634_0001714_11057_11569 159
329 3300046648 Ga0495611_0033499 Ga0495611_0033499_1222_1701 159
330 3300046660 Ga0495625_0087225 Ga0495625_0087225_529_1008 159
331 3300046660 Ga0495625_0132768 Ga0495625_0132768_682_1161 159
332 3300046663 Ga0495635_0000350 Ga0495635_0000350_13202_13681 159
333 3300046665 Ga0495661_0177388 Ga0495661_0177388_345_824 159
334 3300046674 Ga0495588_0015425 Ga0495588_0015425_1261_1740 159
335 3300046674 Ga0495588_0118185 Ga0495588_0118185_736_1215 159
336 3300046679 Ga0495623_0000943 Ga0495623_0000943_8610_9089 159
337 3300046680 Ga0495646_0000790 Ga0495646_0000790_11099_11611 159
338 3300046680 Ga0495646_0003348 Ga0495646_0003348_663_1142 159
339 3300046683 Ga0495658_0057510 Ga0495658_0057510_591_1070 159
340 3300046684 Ga0495669_0005909 Ga0495669_0005909_2306_2785 159
341 3300046684 Ga0495669_0154975 Ga0495669_0154975_289_768 159
342 3300046689 Ga0495613_0088680 Ga0495613_0088680_594_1073 159
343 3300046691 Ga0495670_0030514 Ga0495670_0030514_766_1245 159
344 3300046691 Ga0495670_0041789 Ga0495670_0041789_1228_1707 159
345 3300046692 Ga0495671_0002591 Ga0495671_0002591_4091_4570 159
346 3300046692 Ga0495671_0090853 Ga0495671_0090853_979_1458 159
347 3300046692 Ga0495671_0404444 Ga0495671_0404444_16_495 159
348 3300046694 Ga0495649_0035434 Ga0495649_0035434_2242_2721 159
349 3300046794 Ga0495589_0036578 Ga0495589_0036578_1437_1916 159
350 3300046810 Ga0495660_0060106 Ga0495660_0060106_1189_1668 159
351 3300046810 Ga0495660_0179410 Ga0495660_0179410_463_942 159
352 3300047319 Ga0495674_0013811 Ga0495674_0013811_6980_7459 159
353 3300047320 Ga0495672_0103464 Ga0495672_0103464_530_1009 159
354 3300047322 Ga0495680_0046363 Ga0495680_0046363_86_565 159
355 3300047323 Ga0495683_0144893 Ga0495683_0144893_255_734 159
356 3300047444 Ga0495675_0003809 Ga0495675_0003809_1409_1888 159
357 3300047445 Ga0495677_0001204 Ga0495677_0001204_9097_9576 159
358 3300047445 Ga0495677_0036075 Ga0495677_0036075_234_713 159
359 3300047447 Ga0495685_014601 Ga0495685_014601_1188_1667 159
360 3300047469 Ga0495673_0001372 Ga0495673_0001372_5236_5715 159
361 3300047469 Ga0495673_0022361 Ga0495673_0022361_1558_2037 159
362 3300047469 Ga0495673_0120106 Ga0495673_0120106_530_1009 159
363 3300047470 Ga0495681_0002913 Ga0495681_0002913_10178_10657 159
364 3300047470 Ga0495681_0121745 Ga0495681_0121745_22_501 159
365 3300047673 Ga0495593_0070663 Ga0495593_0070663_601_1080 159
366 3300047673 Ga0495593_0098503 Ga0495593_0098503_874_1353 159
367 3300048903 Ga0496100_0016146 Ga0496100_0016146_626_1105 159
368 3300048905 Ga0496102_0000821 Ga0496102_0000821_13248_13727 159
369 3300048905 Ga0496102_0262216 Ga0496102_0262216_272_751 159
370 3300048906 Ga0496103_0001316 Ga0496103_0001316_13330_13809 159
371 3300048908 Ga0496105_0020731 Ga0496105_0020731_722_1201 159
372 3300048908 Ga0496105_0410507 Ga0496105_0410507_490_969 159
373 3300048909 Ga0496106_0107708 Ga0496106_0107708_1321_1800 159
374 3300048910 Ga0496107_0658980 Ga0496107_0658980_38_517 159
375 3300048913 Ga0496110_0113356 Ga0496110_0113356_1601_2080 159
376 3300048913 Ga0496110_0175764 Ga0496110_0175764_566_1045 159
377 3300048914 Ga0496111_0063457 Ga0496111_0063457_103_582 159
378 3300048918 Ga0496115_0004304 Ga0496115_0004304_5250_5729 159
379 3300048918 Ga0496115_0792429 Ga0496115_0792429_43_522 159
380 3300048919 Ga0496116_0011895 Ga0496116_0011895_1031_1510 159
381 3300048920 Ga0496117_0013466 Ga0496117_0013466_4497_4976 159
382 3300048920 Ga0496117_0013650 Ga0496117_0013650_1797_2276 159
383 3300048921 Ga0496118_0003083 Ga0496118_0003083_16250_16729 159
384 3300048921 Ga0496118_0004488 Ga0496118_0004488_3531_4010 159
385 3300048924 Ga0496121_0001221 Ga0496121_0001221_25253_25732 159
386 3300048924 Ga0496121_0321052 Ga0496121_0321052_137_616 159
387 3300048927 Ga0496124_0241392 Ga0496124_0241392_375_854 159
388 3300048928 Ga0496125_0014795 Ga0496125_0014795_6915_7394 159
389 3300048929 Ga0496126_0000134 Ga0496126_0000134_109591_110070 159
390 3300048929 Ga0496126_0094223 Ga0496126_0094223_1168_1647 159
391 3300049459 Ga0495678_176468 Ga0495678_176468_177_656 159
392 3300049460 Ga0495682_0002634 Ga0495682_0002634_3294_3773 159
393 3300049460 Ga0495682_0110363 Ga0495682_0110363_255_734 159
394 3300049572 Ga0501036_0011020 Ga0501036_0011020_6358_6837 159
395 3300049573 Ga0501037_0021408 Ga0501037_0021408_4258_4737 159
396 3300049579 Ga0501043_0005420 Ga0501043_0005420_3844_4335 159
397 3300049580 Ga0501046_0202587 Ga0501046_0202587_790_1269 159
398 3300049672 Ga0501239_007749 Ga0501239_007749_50_529 159
399 3300049758 Ga0501241_017980 Ga0501241_017980_669_1148 159
400 3300049823 Ga0501044_0009893 Ga0501044_0009893_6234_6713 159
401 3300050489 nmdc:mga03683_141319_c1 nmdc:mga03683_141319_c1_547_1026 159
402 3300050493 nmdc:mga0k408_127377_c1 nmdc:mga0k408_127377_c1_383_862 159
403 3300050493 nmdc:mga0k408_1391_c2 nmdc:mga0k408_1391_c2_8159_8638 159
404 3300050493 nmdc:mga0k408_258090_c1 nmdc:mga0k408_258090_c1_359_838 159
405 3300050496 nmdc:mga07m45_1397_c1 nmdc:mga07m45_1397_c1_438_917 159
406 3300050496 nmdc:mga07m45_228436_c1 nmdc:mga07m45_228436_c1_87_566 159
407 3300050508 nmdc:mga09592_736429_c1 nmdc:mga09592_736429_c1_239_718 159
408 3300050509 nmdc:mga0qj67_314293_c1 nmdc:mga0qj67_314293_c1_406_885 159
409 3300050512 nmdc:mga0n895_680479_c1 nmdc:mga0n895_680479_c1_288_767 159
410 3300053103 Ga0500555_140833 Ga0500555_140833_58_546 159
411 iso_pu_bacteria 2588253510 2588291836 159
412 3300005331 Ga0070670_100045953 Ga0070670_1000459535 160
413 3300005336 Ga0070680_100131720 Ga0070680_1001317202 160
414 3300005339 Ga0070660_100010221 Ga0070660_1000102216 160
415 3300005344 Ga0070661_100435245 Ga0070661_1004352451 160
416 3300005366 Ga0070659_100035370 Ga0070659_1000353701 160
417 3300005435 Ga0070714_100007323 Ga0070714_1000073239 160
418 3300005530 Ga0070679_101126552 Ga0070679_1011265521 160
419 3300005539 Ga0068853_100282417 Ga0068853_1002824172 160
420 3300005563 Ga0068855_100827487 Ga0068855_1008274871 160
421 3300005614 Ga0068856_100902215 Ga0068856_1009022152 160
422 3300005618 Ga0068864_100059273 Ga0068864_1000592734 160
423 3300005841 Ga0068863_100074984 Ga0068863_1000749842 160
424 3300009093 Ga0105240_10176421 Ga0105240_101764212 160
425 3300009093 Ga0105240_10755085 Ga0105240_107550852 160
426 3300009094 Ga0111539_10420615 Ga0111539_104206152 160
427 3300009551 Ga0105238_10550934 Ga0105238_105509342 160
428 3300013104 Ga0157370_11091654 Ga0157370_110916541 160
429 3300013307 Ga0157372_10038778 Ga0157372_100387784 160
430 3300014325 Ga0163163_10026023 Ga0163163_100260235 160
431 3300014497 Ga0182008_10009806 Ga0182008_100098062 160
432 3300014969 Ga0157376_11474270 Ga0157376_114742701 160
433 3300025913 Ga0207695_10781901 Ga0207695_107819012 160
434 3300025913 Ga0207695_10798367 Ga0207695_107983671 160
435 3300025917 Ga0207660_10606994 Ga0207660_106069942 160
436 3300025919 Ga0207657_10015410 Ga0207657_100154102 160
437 3300025924 Ga0207694_10004583 Ga0207694_100045835 160
438 3300025925 Ga0207650_10007016 Ga0207650_100070168 160
439 3300025929 Ga0207664_10025854 Ga0207664_100258545 160
440 3300025949 Ga0207667_10329064 Ga0207667_103290642 160
441 3300025949 Ga0207667_10459970 Ga0207667_104599702 160
442 3300026041 Ga0207639_10028948 Ga0207639_100289482 160
443 3300026067 Ga0207678_10068028 Ga0207678_100680282 160
444 3300026078 Ga0207702_10930754 Ga0207702_109307542 160
445 3300026088 Ga0207641_10005319 Ga0207641_100053198 160
446 3300026095 Ga0207676_10015577 Ga0207676_100155774 160
447 3300026142 Ga0207698_10476213 Ga0207698_104762132 160
448 3300031239 Ga0265328_10023123 Ga0265328_100231232 160
449 3300031250 Ga0265331_10001794 Ga0265331_100017949 160
450 3300031251 Ga0265327_10000035 Ga0265327_10000035279 160
451 3300035086 Ga0373934_0089134 Ga0373934_0089134_362_898 160
452 3300041459 Ga0451800_0379387 Ga0451800_0379387_383_868 160
453 3300046454 Ga0495592_0030903 Ga0495592_0030903_1434_1916 160
454 3300046533 Ga0495640_0027391 Ga0495640_0027391_918_1400 160
455 3300046535 Ga0495586_0102952 Ga0495586_0102952_309_791 160
456 3300046642 Ga0495634_0283130 Ga0495634_0283130_84_566 160
457 3300046681 Ga0495647_0100292 Ga0495647_0100292_147_629 160
458 3300047321 Ga0495676_0095568 Ga0495676_0095568_402_884 160
459 3300001990 JGI24737J22298_10056301 JGI24737J22298_100563012 161
460 3300003756 Ga0055533_1000805 Ga0055533_10008058 161
461 3300005293 Ga0065715_10533244 Ga0065715_105332442 161
462 3300005295 Ga0065707_10013027 Ga0065707_100130273 161
463 3300005327 Ga0070658_10029811 Ga0070658_100298114 161
464 3300005329 Ga0070683_100001582 Ga0070683_1000015824 161
465 3300005330 Ga0070690_100427305 Ga0070690_1004273052 161
466 3300005331 Ga0070670_100047703 Ga0070670_1000477034 161
467 3300005335 Ga0070666_10110394 Ga0070666_101103944 161
468 3300005336 Ga0070680_100000041 Ga0070680_1000000413 161
469 3300005339 Ga0070660_100165522 Ga0070660_1001655222 161
470 3300005340 Ga0070689_100023905 Ga0070689_1000239055 161
471 3300005344 Ga0070661_100006146 Ga0070661_1000061462 161
472 3300005353 Ga0070669_100039483 Ga0070669_1000394832 161
473 3300005354 Ga0070675_100004394 Ga0070675_10000439410 161
474 3300005354 Ga0070675_100007321 Ga0070675_10000732116 161
475 3300005354 Ga0070675_100028447 Ga0070675_1000284472 161
476 3300005355 Ga0070671_100007061 Ga0070671_1000070612 161
477 3300005356 Ga0070674_100002771 Ga0070674_10000277113 161
478 3300005364 Ga0070673_100008183 Ga0070673_1000081832 161
479 3300005364 Ga0070673_100036119 Ga0070673_1000361194 161
480 3300005364 Ga0070673_100599499 Ga0070673_1005994991 161
481 3300005365 Ga0070688_100006764 Ga0070688_1000067645 161
482 3300005366 Ga0070659_100182942 Ga0070659_1001829423 161
483 3300005367 Ga0070667_100014655 Ga0070667_1000146551 161
484 3300005367 Ga0070667_100130592 Ga0070667_1001305923 161
485 3300005439 Ga0070711_100006250 Ga0070711_1000062503 161
486 3300005441 Ga0070700_100982256 Ga0070700_1009822561 161
487 3300005456 Ga0070678_100001706 Ga0070678_10000170613 161
488 3300005459 Ga0068867_100079565 Ga0068867_1000795654 161
489 3300005459 Ga0068867_100987525 Ga0068867_1009875251 161
490 3300005535 Ga0070684_100005545 Ga0070684_10000554511 161
491 3300005539 Ga0068853_100482508 Ga0068853_1004825082 161
492 3300005543 Ga0070672_100009342 Ga0070672_1000093422 161
493 3300005543 Ga0070672_100205615 Ga0070672_1002056152 161
494 3300005564 Ga0070664_100020556 Ga0070664_1000205564 161
495 3300005564 Ga0070664_100096849 Ga0070664_1000968493 161
496 3300005577 Ga0068857_100013457 Ga0068857_1000134573 161
497 3300005615 Ga0070702_100969993 Ga0070702_1009699931 161
498 3300005617 Ga0068859_100325510 Ga0068859_1003255103 161
499 3300005617 Ga0068859_101103405 Ga0068859_1011034052 161
500 3300005618 Ga0068864_100257580 Ga0068864_1002575802 161
501 3300005618 Ga0068864_100806571 Ga0068864_1008065712 161
502 3300005718 Ga0068866_10010553 Ga0068866_100105537 161
503 3300005834 Ga0068851_10019685 Ga0068851_100196854 161
504 3300005841 Ga0068863_100296172 Ga0068863_1002961722 161
505 3300006237 Ga0097621_100027470 Ga0097621_1000274706 161
506 3300006353 Ga0075370_10009981 Ga0075370_100099815 161
507 3300006358 Ga0068871_100434357 Ga0068871_1004343571 161
508 3300006931 Ga0097620_100325483 Ga0097620_1003254833 161
509 3300006931 Ga0097620_101103557 Ga0097620_1011035572 161
510 3300009177 Ga0105248_10292627 Ga0105248_102926272 161
511 3300009177 Ga0105248_10378080 Ga0105248_103780802 161
512 3300009177 Ga0105248_10401178 Ga0105248_104011781 161
513 3300013296 Ga0157374_10014248 Ga0157374_100142482 161
514 3300013297 Ga0157378_10015098 Ga0157378_1001509812 161
515 3300013306 Ga0163162_10160195 Ga0163162_101601954 161
516 3300013306 Ga0163162_11916346 Ga0163162_119163461 161
517 3300013307 Ga0157372_10053836 Ga0157372_100538364 161
518 3300013308 Ga0157375_10001449 Ga0157375_1000144911 161
519 3300013308 Ga0157375_10642021 Ga0157375_106420212 161
520 3300014325 Ga0163163_11060730 Ga0163163_110607302 161
521 3300014745 Ga0157377_10049289 Ga0157377_100492891 161
522 3300014968 Ga0157379_11046843 Ga0157379_110468432 161
523 3300017792 Ga0163161_10037395 Ga0163161_100373955 161
524 3300017792 Ga0163161_10629547 Ga0163161_106295472 161
525 3300017792 Ga0163161_10770943 Ga0163161_107709431 161
526 3300025226 Ga0209674_100014 Ga0209674_10001469 161
527 3300025315 Ga0207697_10029375 Ga0207697_100293754 161
528 3300025321 Ga0207656_10376132 Ga0207656_103761322 161
529 3300025901 Ga0207688_10428542 Ga0207688_104285422 161
530 3300025907 Ga0207645_10210049 Ga0207645_102100491 161
531 3300025917 Ga0207660_10008583 Ga0207660_100085833 161
532 3300025919 Ga0207657_10063799 Ga0207657_100637992 161
533 3300025919 Ga0207657_10321636 Ga0207657_103216362 161
534 3300025920 Ga0207649_10678676 Ga0207649_106786762 161
535 3300025920 Ga0207649_11006988 Ga0207649_110069881 161
536 3300025923 Ga0207681_10032402 Ga0207681_100324022 161
537 3300025923 Ga0207681_10193700 Ga0207681_101937002 161
538 3300025925 Ga0207650_10011973 Ga0207650_100119737 161
539 3300025925 Ga0207650_10416344 Ga0207650_104163442 161
540 3300025926 Ga0207659_10007489 Ga0207659_100074892 161
541 3300025926 Ga0207659_10377058 Ga0207659_103770582 161
542 3300025931 Ga0207644_10039506 Ga0207644_100395062 161
543 3300025932 Ga0207690_10689691 Ga0207690_106896911 161
544 3300025933 Ga0207706_10271971 Ga0207706_102719713 161
545 3300025936 Ga0207670_10004663 Ga0207670_100046636 161
546 3300025937 Ga0207669_10006834 Ga0207669_100068349 161
547 3300025940 Ga0207691_10001087 Ga0207691_1000108711 161
548 3300025940 Ga0207691_10017913 Ga0207691_1001791312 161
549 3300025940 Ga0207691_10066542 Ga0207691_100665424 161
550 3300025940 Ga0207691_10701883 Ga0207691_107018832 161
551 3300025944 Ga0207661_10220419 Ga0207661_102204192 161
552 3300025945 Ga0207679_10118564 Ga0207679_101185643 161
553 3300025945 Ga0207679_11140853 Ga0207679_111408531 161
554 3300025945 Ga0207679_11467432 Ga0207679_114674321 161
555 3300025949 Ga0207667_11398262 Ga0207667_113982621 161
556 3300025960 Ga0207651_10004049 Ga0207651_100040492 161
557 3300025960 Ga0207651_10006137 Ga0207651_100061376 161
558 3300025972 Ga0207668_10025498 Ga0207668_100254981 161
559 3300025986 Ga0207658_10092952 Ga0207658_100929523 161
560 3300026023 Ga0207677_10014689 Ga0207677_100146894 161
561 3300026041 Ga0207639_10780721 Ga0207639_107807212 161
562 3300026089 Ga0207648_10105675 Ga0207648_101056751 161
563 3300026089 Ga0207648_10354638 Ga0207648_103546384 161
564 3300026116 Ga0207674_10004125 Ga0207674_1000412516 161
565 3300026116 Ga0207674_10120585 Ga0207674_101205852 161
566 3300026118 Ga0207675_100098057 Ga0207675_1000980573 161
567 3300026121 Ga0207683_10028823 Ga0207683_100288232 161
568 3300026142 Ga0207698_10135407 Ga0207698_101354072 161
569 3300028794 Ga0307515_10773987 Ga0307515_107739871 161
570 3300032004 Ga0307414_10316368 Ga0307414_103163682 161
571 3300032005 Ga0307411_10760013 Ga0307411_107600131 161
572 3300037471 Ga0395905_0758475 Ga0395905_0758475_163_660 161
573 3300037853 Ga0436364_0315105 Ga0436364_0315105_631_1116 161
574 3300037853 Ga0436364_0513231 Ga0436364_0513231_295_780 161
575 3300041406 Ga0439439_0067088 Ga0439439_0067088_346_831 161
576 3300041443 Ga0451789_1110718 Ga0451789_1110718_124_612 161
577 3300044712 Ga0453684_0001907 Ga0453684_0001907_52656_53141 161
578 3300048907 Ga0496104_0222530 Ga0496104_0222530_357_842 161
579 3300048907 Ga0496104_0748819 Ga0496104_0748819_241_735 161
580 3300048911 Ga0496108_0033870 Ga0496108_0033870_3101_3595 161
581 3300048911 Ga0496108_1171137 Ga0496108_1171137_34_519 161
582 3300048912 Ga0496109_0067738 Ga0496109_0067738_2446_2940 161
583 3300048913 Ga0496110_0226727 Ga0496110_0226727_465_959 161
584 3300048916 Ga0496113_0343318 Ga0496113_0343318_212_697 161
585 3300048917 Ga0496114_0146173 Ga0496114_0146173_1155_1649 161
586 3300048918 Ga0496115_0321587 Ga0496115_0321587_636_1130 161
587 3300050496 nmdc:mga07m45_218_c2 nmdc:mga07m45_218_c2_19412_19903 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

42

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7887 1 120
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7575 1 120
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.6726 7 122
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.6533 7 122
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.6437 5 122
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8777 81 122 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8542 81 122 3.30.720.110
af_P0AG24_192_325_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7164 76 122 3.30.460.10
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7108 1 120 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.6864 10 76 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A4Q6GFM2-F1-model_v4 deleted 1.008 84 161
AF-A0A534H6Z1-F1-model_v4 VOC family protein 1.007 81 161
AF-A0A4Q3P670-F1-model_v4 deleted 0.9995 86 161
AF-A0A6J7U880-F1-model_v4 Unannotated protein 0.9957 81 159
AF-A0A3D3I036-F1-model_v4 PhnB-like domain-containing protein 0.9939 107 161

Feature Viewer

pLDDT pTM Quality
86.99 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map