F466686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 338 | 586 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0114088|Ga0451577_0114088_214_810 |
| Length | 198 |
| Sequence | MKRPRADGGPPSQPHRAIFMARIDRPEFGNADLPSQEKTMTPKNTICLWYDGTALDAARFYAATFPDSAVGAIFHAPSDYPMGTAGDVLTVEFTVIGIPCLGLNGGPMFKHTEAFSFQVATDDQAETDRLWNSIIDSGGQASECGWCKDKWGLSWQITPRALTEALADPDRAAAKRAFDAMMQMGKIDIAKIEAARRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 221 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 222 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 231 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 232 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.31 |
| Nodule | 0 |
| Rhizoplane | 4.77 |
| Rhizosphere | 77.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10056301 | 3300001990 | Bacteria | 1188 |
| 2 | JGI25156J39149_1009741 | 3300002705 | Bacteria | 2311 |
| 3 | JGI25152J39213_1013807 | 3300002773 | Bacteria | 1666 |
| 4 | JGI25150J39212_1002186 | 3300002774 | Bacteria | 4998 |
| 5 | JGI25159J45721_1000166 | 3300002987 | Bacteria | 30609 |
| 6 | JGI25159J45721_1040528 | 3300002987 | Bacteria | 682 |
| 7 | JGI25151J46595_10001854 | 3300003187 | Bacteria | 13602 |
| 8 | JGI25151J46595_10029968 | 3300003187 | Bacteria | 2146 |
| 9 | JGI25160J50197_1000352 | 3300003354 | Bacteria | 30609 |
| 10 | JGI25161J50226_1000268 | 3300003374 | Bacteria | 30609 |
| 11 | Ga0055539_1000521 | 3300003752 | Bacteria | 11784 |
| 12 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 13 | Ga0055533_1000805 | 3300003756 | Bacteria | 9761 |
| 14 | Ga0055525_1002058 | 3300003759 | Bacteria | 2411 |
| 15 | Ga0055526_1000015 | 3300003771 | Bacteria | 226543 |
| 16 | Ga0055526_1000802 | 3300003771 | Bacteria | 23436 |
| 17 | Ga0055537_1000053 | 3300003773 | Bacteria | 82599 |
| 18 | Ga0055524_1000020 | 3300003775 | Bacteria | 227971 |
| 19 | Ga0055524_1000059 | 3300003775 | Bacteria | 138562 |
| 20 | Ga0055534_1000017 | 3300003784 | Bacteria | 138670 |
| 21 | Ga0055534_1004910 | 3300003784 | Bacteria | 3738 |
| 22 | Ga0055528_1000008 | 3300003790 | Bacteria | 226543 |
| 23 | Ga0055543_1000361 | 3300004625 | Bacteria | 30407 |
| 24 | Ga0065165_1004330 | 3300005262 | Bacteria | 8913 |
| 25 | Ga0065714_10000625 | 3300005288 | Bacteria | 3371 |
| 26 | Ga0065714_10004677 | 3300005288 | Bacteria | 4620 |
| 27 | Ga0065714_10017235 | 3300005288 | Bacteria | 1826 |
| 28 | Ga0065714_10106783 | 3300005288 | Bacteria | 1533 |
| 29 | Ga0065714_10493790 | 3300005288 | Bacteria | 527 |
| 30 | Ga0065704_10214136 | 3300005289 | Bacteria | 1097 |
| 31 | Ga0065715_10059901 | 3300005293 | Bacteria | 784 |
| 32 | Ga0065715_10111326 | 3300005293 | Bacteria | 2578 |
| 33 | Ga0065715_10533244 | 3300005293 | Bacteria | 754 |
| 34 | Ga0065707_10013027 | 3300005295 | Bacteria | 2497 |
| 35 | Ga0065707_10095187 | 3300005295 | Bacteria | 3407 |
| 36 | Ga0070658_10010248 | 3300005327 | Bacteria | 7515 |
| 37 | Ga0070658_10029811 | 3300005327 | Bacteria | 4383 |
| 38 | Ga0070658_10055328 | 3300005327 | Bacteria | 3223 |
| 39 | Ga0070676_10132855 | 3300005328 | Bacteria | 1576 |
| 40 | Ga0070683_100001582 | 3300005329 | Bacteria | 17608 |
| 41 | Ga0070683_100091563 | 3300005329 | Bacteria | 2855 |
| 42 | Ga0070690_100181988 | 3300005330 | Bacteria | 1453 |
| 43 | Ga0070690_100427305 | 3300005330 | Bacteria | 978 |
| 44 | Ga0070670_100045953 | 3300005331 | Bacteria | 3754 |
| 45 | Ga0070670_100047703 | 3300005331 | Bacteria | 3686 |
| 46 | Ga0070677_10467642 | 3300005333 | Bacteria | 678 |
| 47 | Ga0068869_100010901 | 3300005334 | Bacteria | 5946 |
| 48 | Ga0070666_10110394 | 3300005335 | Bacteria | 1901 |
| 49 | Ga0070680_100000041 | 3300005336 | Bacteria | 66075 |
| 50 | Ga0070680_100131720 | 3300005336 | Bacteria | 2092 |
| 51 | Ga0068868_100004978 | 3300005338 | Bacteria | 9331 |
| 52 | Ga0068868_101140604 | 3300005338 | Bacteria | 719 |
| 53 | Ga0070660_100010221 | 3300005339 | Bacteria | 6623 |
| 54 | Ga0070660_100165522 | 3300005339 | Bacteria | 1784 |
| 55 | Ga0070660_100419115 | 3300005339 | Bacteria | 1108 |
| 56 | Ga0070689_100023905 | 3300005340 | Bacteria | 4581 |
| 57 | Ga0070661_100006146 | 3300005344 | Bacteria | 8272 |
| 58 | Ga0070661_100435245 | 3300005344 | Bacteria | 1041 |
| 59 | Ga0070661_100520883 | 3300005344 | Bacteria | 954 |
| 60 | Ga0070661_100960164 | 3300005344 | Bacteria | 707 |
| 61 | Ga0070668_100026333 | 3300005347 | Bacteria | 4413 |
| 62 | Ga0070668_101330100 | 3300005347 | Bacteria | 654 |
| 63 | Ga0070669_100016215 | 3300005353 | Bacteria | 5314 |
| 64 | Ga0070669_100039483 | 3300005353 | Bacteria | 3430 |
| 65 | Ga0070669_100429310 | 3300005353 | Bacteria | 1086 |
| 66 | Ga0070675_100004394 | 3300005354 | Bacteria | 10754 |
| 67 | Ga0070675_100007321 | 3300005354 | Bacteria | 8519 |
| 68 | Ga0070675_100018914 | 3300005354 | Bacteria | 5487 |
| 69 | Ga0070675_100028447 | 3300005354 | Bacteria | 4498 |
| 70 | Ga0070675_100207935 | 3300005354 | Bacteria | 1700 |
| 71 | Ga0070675_100704322 | 3300005354 | Bacteria | 920 |
| 72 | Ga0070671_100007061 | 3300005355 | Bacteria | 8994 |
| 73 | Ga0070674_100002771 | 3300005356 | Bacteria | 9684 |
| 74 | Ga0070673_100008183 | 3300005364 | Bacteria | 6940 |
| 75 | Ga0070673_100036119 | 3300005364 | Bacteria | 3753 |
| 76 | Ga0070673_100164912 | 3300005364 | Bacteria | 1887 |
| 77 | Ga0070673_100599499 | 3300005364 | Bacteria | 1005 |
| 78 | Ga0070688_100006764 | 3300005365 | Bacteria | 6147 |
| 79 | Ga0070659_100035370 | 3300005366 | Bacteria | 3890 |
| 80 | Ga0070659_100049641 | 3300005366 | Bacteria | 3300 |
| 81 | Ga0070659_100182942 | 3300005366 | Bacteria | 1720 |
| 82 | Ga0070659_100612650 | 3300005366 | Bacteria | 936 |
| 83 | Ga0070659_100790481 | 3300005366 | Bacteria | 825 |
| 84 | Ga0070667_100014655 | 3300005367 | Bacteria | 6477 |
| 85 | Ga0070667_100130592 | 3300005367 | Bacteria | 2192 |
| 86 | Ga0070667_100214261 | 3300005367 | Bacteria | 1713 |
| 87 | Ga0070667_100265847 | 3300005367 | Bacteria | 1537 |
| 88 | Ga0070714_100007323 | 3300005435 | Bacteria | 8582 |
| 89 | Ga0070711_100006250 | 3300005439 | Bacteria | 7172 |
| 90 | Ga0070700_100038543 | 3300005441 | Bacteria | 2913 |
| 91 | Ga0070700_100982256 | 3300005441 | Bacteria | 693 |
| 92 | Ga0070663_100122120 | 3300005455 | Bacteria | 1969 |
| 93 | Ga0070663_100485559 | 3300005455 | Bacteria | 1023 |
| 94 | Ga0070678_100001706 | 3300005456 | Bacteria | 11799 |
| 95 | Ga0070678_100446090 | 3300005456 | Bacteria | 1133 |
| 96 | Ga0070662_100106107 | 3300005457 | Bacteria | 2133 |
| 97 | Ga0068867_100004255 | 3300005459 | Bacteria | 10073 |
| 98 | Ga0068867_100079565 | 3300005459 | Bacteria | 2467 |
| 99 | Ga0068867_100987525 | 3300005459 | Bacteria | 763 |
| 100 | Ga0070679_101126552 | 3300005530 | Bacteria | 729 |
| 101 | Ga0070684_100005545 | 3300005535 | Bacteria | 9684 |
| 102 | Ga0070684_100548730 | 3300005535 | Bacteria | 1072 |
| 103 | Ga0068853_100282417 | 3300005539 | Bacteria | 1530 |
| 104 | Ga0068853_100336097 | 3300005539 | Bacteria | 1403 |
| 105 | Ga0068853_100482508 | 3300005539 | Bacteria | 1169 |
| 106 | Ga0070672_100009342 | 3300005543 | Bacteria | 6754 |
| 107 | Ga0070672_100010541 | 3300005543 | Bacteria | 6414 |
| 108 | Ga0070672_100205615 | 3300005543 | Bacteria | 1647 |
| 109 | Ga0070672_100409992 | 3300005543 | Bacteria | 1162 |
| 110 | Ga0070695_100410240 | 3300005545 | Bacteria | 1029 |
| 111 | Ga0070693_100100735 | 3300005547 | Bacteria | 1759 |
| 112 | Ga0068855_100000557 | 3300005563 | Bacteria | 45786 |
| 113 | Ga0068855_100009023 | 3300005563 | Bacteria | 12049 |
| 114 | Ga0068855_100027441 | 3300005563 | Bacteria | 6810 |
| 115 | Ga0068855_100827487 | 3300005563 | Bacteria | 982 |
| 116 | Ga0070664_100020556 | 3300005564 | Bacteria | 5436 |
| 117 | Ga0070664_100096849 | 3300005564 | Bacteria | 2561 |
| 118 | Ga0070664_100111261 | 3300005564 | Bacteria | 2390 |
| 119 | Ga0070664_100193987 | 3300005564 | Bacteria | 1810 |
| 120 | Ga0068857_100013457 | 3300005577 | Bacteria | 7126 |
| 121 | Ga0068857_101315633 | 3300005577 | Bacteria | 702 |
| 122 | Ga0068854_100000054 | 3300005578 | Bacteria | 84435 |
| 123 | Ga0068854_100235699 | 3300005578 | Bacteria | 1455 |
| 124 | Ga0068856_100144590 | 3300005614 | Bacteria | 2385 |
| 125 | Ga0068856_100902215 | 3300005614 | Bacteria | 903 |
| 126 | Ga0070702_100928410 | 3300005615 | Bacteria | 683 |
| 127 | Ga0070702_100969993 | 3300005615 | Bacteria | 671 |
| 128 | Ga0068852_100566344 | 3300005616 | Bacteria | 1138 |
| 129 | Ga0068859_100325510 | 3300005617 | Bacteria | 1631 |
| 130 | Ga0068859_101103405 | 3300005617 | Bacteria | 873 |
| 131 | Ga0068864_100059273 | 3300005618 | Bacteria | 3311 |
| 132 | Ga0068864_100257580 | 3300005618 | Bacteria | 1622 |
| 133 | Ga0068864_100806571 | 3300005618 | Bacteria | 923 |
| 134 | Ga0068866_10010553 | 3300005718 | Bacteria | 3965 |
| 135 | Ga0068866_10378732 | 3300005718 | Bacteria | 907 |
| 136 | Ga0068861_100003049 | 3300005719 | Bacteria | 11062 |
| 137 | Ga0068861_100006599 | 3300005719 | Bacteria | 7918 |
| 138 | Ga0068851_10019685 | 3300005834 | Bacteria | 3263 |
| 139 | Ga0068863_100074984 | 3300005841 | Bacteria | 3201 |
| 140 | Ga0068863_100296172 | 3300005841 | Bacteria | 1569 |
| 141 | Ga0068863_100693806 | 3300005841 | Bacteria | 1012 |
| 142 | Ga0068863_101096238 | 3300005841 | Bacteria | 801 |
| 143 | Ga0068858_100541377 | 3300005842 | Bacteria | 1127 |
| 144 | Ga0068858_100949215 | 3300005842 | Bacteria | 842 |
| 145 | Ga0068860_100004998 | 3300005843 | Bacteria | 13512 |
| 146 | Ga0068860_100240302 | 3300005843 | Bacteria | 1761 |
| 147 | Ga0068862_100072016 | 3300005844 | Bacteria | 2985 |
| 148 | Ga0068862_100102941 | 3300005844 | Bacteria | 2500 |
| 149 | Ga0075368_10254408 | 3300006042 | Bacteria | 751 |
| 150 | Ga0075363_100051072 | 3300006048 | Bacteria | 2204 |
| 151 | Ga0075364_10152316 | 3300006051 | Bacteria | 1558 |
| 152 | Ga0075432_10062752 | 3300006058 | Bacteria | 1326 |
| 153 | Ga0075362_10007518 | 3300006177 | Bacteria | 4130 |
| 154 | Ga0075362_10112917 | 3300006177 | Bacteria | 1280 |
| 155 | Ga0075369_10116449 | 3300006186 | Bacteria | 1207 |
| 156 | Ga0075366_10011855 | 3300006195 | Bacteria | 4932 |
| 157 | Ga0075366_10121666 | 3300006195 | Bacteria | 1573 |
| 158 | Ga0075366_10417142 | 3300006195 | Bacteria | 827 |
| 159 | Ga0097621_100019420 | 3300006237 | Bacteria | 5215 |
| 160 | Ga0097621_100027470 | 3300006237 | Bacteria | 4475 |
| 161 | Ga0075370_10002921 | 3300006353 | Bacteria | 8031 |
| 162 | Ga0075370_10004114 | 3300006353 | Bacteria | 7009 |
| 163 | Ga0075370_10009981 | 3300006353 | Bacteria | 4949 |
| 164 | Ga0075370_10186863 | 3300006353 | Bacteria | 1220 |
| 165 | Ga0075370_10312715 | 3300006353 | Bacteria | 935 |
| 166 | Ga0068871_100040501 | 3300006358 | Bacteria | 3731 |
| 167 | Ga0068871_100434357 | 3300006358 | Bacteria | 1174 |
| 168 | Ga0075430_100543998 | 3300006846 | Bacteria | 958 |
| 169 | Ga0068865_100004612 | 3300006881 | Bacteria | 8321 |
| 170 | Ga0097620_100325483 | 3300006931 | Bacteria | 1631 |
| 171 | Ga0097620_101103557 | 3300006931 | Bacteria | 873 |
| 172 | Ga0105244_10022162 | 3300009036 | Bacteria | 3498 |
| 173 | Ga0105240_10041264 | 3300009093 | Bacteria | 5892 |
| 174 | Ga0105240_10176421 | 3300009093 | Bacteria | 2526 |
| 175 | Ga0105240_10755085 | 3300009093 | Bacteria | 1057 |
| 176 | Ga0111539_10078852 | 3300009094 | Bacteria | 3873 |
| 177 | Ga0111539_10420615 | 3300009094 | Bacteria | 1556 |
| 178 | Ga0105245_10071877 | 3300009098 | Bacteria | 3142 |
| 179 | Ga0105245_12490765 | 3300009098 | Bacteria | 571 |
| 180 | Ga0105247_10107539 | 3300009101 | Bacteria | 1791 |
| 181 | Ga0105248_10142710 | 3300009177 | Bacteria | 2702 |
| 182 | Ga0105248_10292627 | 3300009177 | Bacteria | 1834 |
| 183 | Ga0105248_10378080 | 3300009177 | Bacteria | 1595 |
| 184 | Ga0105248_10401178 | 3300009177 | Bacteria | 1544 |
| 185 | Ga0105237_10028309 | 3300009545 | Bacteria | 5709 |
| 186 | Ga0105237_10104756 | 3300009545 | Bacteria | 2820 |
| 187 | Ga0105238_10074057 | 3300009551 | Bacteria | 3398 |
| 188 | Ga0105238_10079054 | 3300009551 | Bacteria | 3278 |
| 189 | Ga0105238_10550934 | 3300009551 | Bacteria | 1158 |
| 190 | Ga0105239_10886089 | 3300010375 | Bacteria | 1024 |
| 191 | Ga0157373_10323525 | 3300013100 | Bacteria | 1097 |
| 192 | Ga0157371_10149126 | 3300013102 | Bacteria | 1667 |
| 193 | Ga0157370_10024804 | 3300013104 | Bacteria | 5937 |
| 194 | Ga0157370_10082622 | 3300013104 | Bacteria | 3021 |
| 195 | Ga0157370_10816387 | 3300013104 | Bacteria | 848 |
| 196 | Ga0157370_11091654 | 3300013104 | Bacteria | 721 |
| 197 | Ga0157369_10269500 | 3300013105 | Bacteria | 1774 |
| 198 | Ga0157374_10005044 | 3300013296 | Bacteria | 11075 |
| 199 | Ga0157374_10014248 | 3300013296 | Bacteria | 6953 |
| 200 | Ga0157374_10114617 | 3300013296 | Bacteria | 2595 |
| 201 | Ga0157374_10152900 | 3300013296 | Bacteria | 2244 |
| 202 | Ga0157378_10015098 | 3300013297 | Bacteria | 6760 |
| 203 | Ga0157378_10633558 | 3300013297 | Bacteria | 1083 |
| 204 | Ga0163162_10005279 | 3300013306 | Bacteria | 12465 |
| 205 | Ga0163162_10160195 | 3300013306 | Bacteria | 2372 |
| 206 | Ga0163162_10384544 | 3300013306 | Bacteria | 1537 |
| 207 | Ga0163162_11682808 | 3300013306 | Bacteria | 724 |
| 208 | Ga0163162_11916346 | 3300013306 | Bacteria | 678 |
| 209 | Ga0157372_10038778 | 3300013307 | Bacteria | 5258 |
| 210 | Ga0157372_10053836 | 3300013307 | Bacteria | 4487 |
| 211 | Ga0157375_10001449 | 3300013308 | Bacteria | 20400 |
| 212 | Ga0157375_10642021 | 3300013308 | Bacteria | 1218 |
| 213 | Ga0157375_10918574 | 3300013308 | Bacteria | 1018 |
| 214 | Ga0163163_10026023 | 3300014325 | Bacteria | 5587 |
| 215 | Ga0163163_10612352 | 3300014325 | Bacteria | 1152 |
| 216 | Ga0163163_11060730 | 3300014325 | Bacteria | 873 |
| 217 | Ga0182008_10009806 | 3300014497 | Bacteria | 5153 |
| 218 | Ga0157377_10020376 | 3300014745 | Bacteria | 3473 |
| 219 | Ga0157377_10049289 | 3300014745 | Bacteria | 2367 |
| 220 | Ga0157379_10039193 | 3300014968 | Bacteria | 4227 |
| 221 | Ga0157379_10409677 | 3300014968 | Bacteria | 1247 |
| 222 | Ga0157379_11046843 | 3300014968 | Bacteria | 780 |
| 223 | Ga0157376_10062869 | 3300014969 | Bacteria | 3125 |
| 224 | Ga0157376_10146612 | 3300014969 | Bacteria | 2124 |
| 225 | Ga0157376_11474270 | 3300014969 | Bacteria | 713 |
| 226 | Ga0182006_1101622 | 3300015261 | Bacteria | 1020 |
| 227 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 228 | Ga0163161_10037395 | 3300017792 | Bacteria | 3480 |
| 229 | Ga0163161_10104378 | 3300017792 | Bacteria | 2113 |
| 230 | Ga0163161_10629547 | 3300017792 | Bacteria | 887 |
| 231 | Ga0163161_10770943 | 3300017792 | Bacteria | 806 |
| 232 | Ga0209436_103839 | 3300025208 | Bacteria | 3849 |
| 233 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 234 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 235 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 236 | Ga0209563_113760 | 3300025230 | Bacteria | 1057 |
| 237 | Ga0207427_102251 | 3300025231 | Bacteria | 5411 |
| 238 | Ga0207425_1001058 | 3300025245 | Bacteria | 12702 |
| 239 | Ga0209677_100151 | 3300025253 | Bacteria | 63642 |
| 240 | Ga0209759_1002704 | 3300025256 | Bacteria | 7560 |
| 241 | Ga0209129_1011522 | 3300025258 | Bacteria | 2103 |
| 242 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 243 | Ga0209565_1000715 | 3300025263 | Bacteria | 20127 |
| 244 | Ga0209565_1001682 | 3300025263 | Bacteria | 9177 |
| 245 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 246 | Ga0209673_1031221 | 3300025273 | Bacteria | 1661 |
| 247 | Ga0209673_1041159 | 3300025273 | Bacteria | 1315 |
| 248 | Ga0209130_1000202 | 3300025284 | Bacteria | 80333 |
| 249 | Ga0209130_1019365 | 3300025284 | Bacteria | 1579 |
| 250 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 251 | Ga0209675_1001344 | 3300025291 | Bacteria | 14518 |
| 252 | Ga0209675_1001827 | 3300025291 | Bacteria | 11609 |
| 253 | Ga0209675_1009899 | 3300025291 | Bacteria | 3313 |
| 254 | Ga0209676_1024661 | 3300025292 | Bacteria | 1942 |
| 255 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 256 | Ga0209025_1002511 | 3300025294 | Bacteria | 19206 |
| 257 | Ga0209025_1014325 | 3300025294 | Bacteria | 4889 |
| 258 | Ga0209025_1047426 | 3300025294 | Bacteria | 1754 |
| 259 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 260 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 261 | Ga0209564_1041766 | 3300025295 | Bacteria | 1226 |
| 262 | Ga0209758_1049721 | 3300025297 | Bacteria | 1477 |
| 263 | Ga0209050_1004979 | 3300025298 | Bacteria | 8645 |
| 264 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 265 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 266 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 267 | Ga0209257_1007844 | 3300025304 | Bacteria | 6303 |
| 268 | Ga0207697_10029375 | 3300025315 | Bacteria | 2250 |
| 269 | Ga0207656_10237648 | 3300025321 | Bacteria | 889 |
| 270 | Ga0207656_10376132 | 3300025321 | Bacteria | 712 |
| 271 | Ga0207696_1031516 | 3300025711 | Bacteria | 1603 |
| 272 | Ga0207655_1026871 | 3300025728 | Bacteria | 2755 |
| 273 | Ga0207713_1055262 | 3300025735 | Bacteria | 1551 |
| 274 | Ga0207682_10011620 | 3300025893 | Bacteria | 3440 |
| 275 | Ga0207688_10014298 | 3300025901 | Bacteria | 4319 |
| 276 | Ga0207688_10265002 | 3300025901 | Bacteria | 1044 |
| 277 | Ga0207688_10428542 | 3300025901 | Bacteria | 823 |
| 278 | Ga0207645_10010376 | 3300025907 | Bacteria | 6394 |
| 279 | Ga0207645_10210049 | 3300025907 | Bacteria | 1282 |
| 280 | Ga0207643_10135149 | 3300025908 | Bacteria | 1470 |
| 281 | Ga0207705_10018657 | 3300025909 | Bacteria | 4961 |
| 282 | Ga0207705_10169706 | 3300025909 | Bacteria | 1642 |
| 283 | Ga0207695_10781901 | 3300025913 | Bacteria | 835 |
| 284 | Ga0207695_10798367 | 3300025913 | Bacteria | 824 |
| 285 | Ga0207671_10132077 | 3300025914 | Bacteria | 1917 |
| 286 | Ga0207671_10133942 | 3300025914 | Bacteria | 1904 |
| 287 | Ga0207660_10008583 | 3300025917 | Bacteria | 6610 |
| 288 | Ga0207660_10606994 | 3300025917 | Bacteria | 891 |
| 289 | Ga0207657_10008125 | 3300025919 | Bacteria | 10700 |
| 290 | Ga0207657_10015410 | 3300025919 | Bacteria | 7404 |
| 291 | Ga0207657_10041456 | 3300025919 | Bacteria | 4070 |
| 292 | Ga0207657_10063799 | 3300025919 | Bacteria | 3147 |
| 293 | Ga0207657_10133216 | 3300025919 | Bacteria | 2035 |
| 294 | Ga0207657_10321636 | 3300025919 | Bacteria | 1223 |
| 295 | Ga0207649_10678676 | 3300025920 | Bacteria | 798 |
| 296 | Ga0207649_11006988 | 3300025920 | Bacteria | 656 |
| 297 | Ga0207681_10032402 | 3300025923 | Bacteria | 3421 |
| 298 | Ga0207681_10042853 | 3300025923 | Bacteria | 3026 |
| 299 | Ga0207681_10059547 | 3300025923 | Bacteria | 2618 |
| 300 | Ga0207681_10193700 | 3300025923 | Bacteria | 1557 |
| 301 | Ga0207694_10004583 | 3300025924 | Bacteria | 10769 |
| 302 | Ga0207694_10401792 | 3300025924 | Bacteria | 1139 |
| 303 | Ga0207650_10007016 | 3300025925 | Bacteria | 7685 |
| 304 | Ga0207650_10011973 | 3300025925 | Bacteria | 5979 |
| 305 | Ga0207650_10416344 | 3300025925 | Bacteria | 1114 |
| 306 | Ga0207659_10007489 | 3300025926 | Bacteria | 6716 |
| 307 | Ga0207659_10377058 | 3300025926 | Bacteria | 1182 |
| 308 | Ga0207659_10649221 | 3300025926 | Bacteria | 902 |
| 309 | Ga0207687_10532649 | 3300025927 | Bacteria | 984 |
| 310 | Ga0207664_10025854 | 3300025929 | Bacteria | 4429 |
| 311 | Ga0207644_10039506 | 3300025931 | Bacteria | 3331 |
| 312 | Ga0207690_10023767 | 3300025932 | Bacteria | 3830 |
| 313 | Ga0207690_10049880 | 3300025932 | Bacteria | 2792 |
| 314 | Ga0207690_10110381 | 3300025932 | Bacteria | 1980 |
| 315 | Ga0207690_10689691 | 3300025932 | Bacteria | 839 |
| 316 | Ga0207706_10000377 | 3300025933 | Bacteria | 48494 |
| 317 | Ga0207706_10271971 | 3300025933 | Bacteria | 1478 |
| 318 | Ga0207706_10489415 | 3300025933 | Bacteria | 1062 |
| 319 | Ga0207686_10163158 | 3300025934 | Bacteria | 1564 |
| 320 | Ga0207670_10004663 | 3300025936 | Bacteria | 7430 |
| 321 | Ga0207669_10006834 | 3300025937 | Bacteria | 5246 |
| 322 | Ga0207704_10002130 | 3300025938 | Bacteria | 8874 |
| 323 | Ga0207691_10001087 | 3300025940 | Bacteria | 27045 |
| 324 | Ga0207691_10017913 | 3300025940 | Bacteria | 6712 |
| 325 | Ga0207691_10066542 | 3300025940 | Bacteria | 3260 |
| 326 | Ga0207691_10069635 | 3300025940 | Bacteria | 3178 |
| 327 | Ga0207691_10173395 | 3300025940 | Bacteria | 1888 |
| 328 | Ga0207691_10701883 | 3300025940 | Bacteria | 853 |
| 329 | Ga0207711_10028975 | 3300025941 | Bacteria | 4665 |
| 330 | Ga0207689_10000312 | 3300025942 | Bacteria | 44850 |
| 331 | Ga0207661_10220419 | 3300025944 | Bacteria | 1676 |
| 332 | Ga0207679_10118564 | 3300025945 | Bacteria | 2102 |
| 333 | Ga0207679_10430411 | 3300025945 | Bacteria | 1166 |
| 334 | Ga0207679_11140853 | 3300025945 | Bacteria | 715 |
| 335 | Ga0207679_11467432 | 3300025945 | Bacteria | 626 |
| 336 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 337 | Ga0207667_10014452 | 3300025949 | Bacteria | 9000 |
| 338 | Ga0207667_10124236 | 3300025949 | Bacteria | 2659 |
| 339 | Ga0207667_10329064 | 3300025949 | Bacteria | 1560 |
| 340 | Ga0207667_10459970 | 3300025949 | Bacteria | 1292 |
| 341 | Ga0207667_11398262 | 3300025949 | Bacteria | 673 |
| 342 | Ga0207651_10004049 | 3300025960 | Bacteria | 7300 |
| 343 | Ga0207651_10006137 | 3300025960 | Bacteria | 6248 |
| 344 | Ga0207651_10069966 | 3300025960 | Bacteria | 2480 |
| 345 | Ga0207712_10211137 | 3300025961 | Bacteria | 1546 |
| 346 | Ga0207668_10003807 | 3300025972 | Bacteria | 8889 |
| 347 | Ga0207668_10025498 | 3300025972 | Bacteria | 3827 |
| 348 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 349 | Ga0207640_10417242 | 3300025981 | Bacteria | 1097 |
| 350 | Ga0207658_10092952 | 3300025986 | Bacteria | 2344 |
| 351 | Ga0207658_10585579 | 3300025986 | Bacteria | 1001 |
| 352 | Ga0207658_11101495 | 3300025986 | Bacteria | 725 |
| 353 | Ga0207677_10014689 | 3300026023 | Bacteria | 4582 |
| 354 | Ga0207703_10316055 | 3300026035 | Bacteria | 1429 |
| 355 | Ga0207703_10878048 | 3300026035 | Bacteria | 858 |
| 356 | Ga0207639_10028948 | 3300026041 | Bacteria | 4050 |
| 357 | Ga0207639_10236220 | 3300026041 | Bacteria | 1587 |
| 358 | Ga0207639_10780721 | 3300026041 | Bacteria | 889 |
| 359 | Ga0207678_10015906 | 3300026067 | Bacteria | 6610 |
| 360 | Ga0207678_10068028 | 3300026067 | Bacteria | 3056 |
| 361 | Ga0207678_10189412 | 3300026067 | Bacteria | 1758 |
| 362 | Ga0207708_10047022 | 3300026075 | Bacteria | 3287 |
| 363 | Ga0207702_10930754 | 3300026078 | Bacteria | 861 |
| 364 | Ga0207641_10005319 | 3300026088 | Bacteria | 10991 |
| 365 | Ga0207641_10223664 | 3300026088 | Bacteria | 1747 |
| 366 | Ga0207648_10002883 | 3300026089 | Bacteria | 18211 |
| 367 | Ga0207648_10105675 | 3300026089 | Bacteria | 2470 |
| 368 | Ga0207648_10354638 | 3300026089 | Bacteria | 1323 |
| 369 | Ga0207676_10015577 | 3300026095 | Bacteria | 5488 |
| 370 | Ga0207676_10653995 | 3300026095 | Bacteria | 1014 |
| 371 | Ga0207674_10004125 | 3300026116 | Bacteria | 17573 |
| 372 | Ga0207674_10120585 | 3300026116 | Bacteria | 2591 |
| 373 | Ga0207675_100000484 | 3300026118 | Bacteria | 38611 |
| 374 | Ga0207675_100098057 | 3300026118 | Bacteria | 2760 |
| 375 | Ga0207683_10028823 | 3300026121 | Bacteria | 4804 |
| 376 | Ga0207683_10068898 | 3300026121 | Bacteria | 3124 |
| 377 | Ga0207698_10135407 | 3300026142 | Bacteria | 2113 |
| 378 | Ga0207698_10299062 | 3300026142 | Bacteria | 1497 |
| 379 | Ga0207698_10476213 | 3300026142 | Bacteria | 1210 |
| 380 | Ga0209813_10427011 | 3300027866 | Bacteria | 538 |
| 381 | Ga0207428_10408270 | 3300027907 | Bacteria | 994 |
| 382 | Ga0268266_10267412 | 3300028379 | Bacteria | 1586 |
| 383 | Ga0268265_10005260 | 3300028380 | Bacteria | 8858 |
| 384 | Ga0268264_10092018 | 3300028381 | Bacteria | 2617 |
| 385 | Ga0265336_10000010 | 3300028666 | Bacteria | 277947 |
| 386 | Ga0307517_10362783 | 3300028786 | Bacteria | 782 |
| 387 | Ga0307515_10773987 | 3300028794 | Bacteria | 580 |
| 388 | Ga0265324_10001918 | 3300029957 | Bacteria | 11166 |
| 389 | Ga0265328_10023123 | 3300031239 | Bacteria | 2359 |
| 390 | Ga0265331_10001794 | 3300031250 | Bacteria | 15294 |
| 391 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 392 | Ga0307513_10002924 | 3300031456 | Bacteria | 23356 |
| 393 | Ga0307408_100001343 | 3300031548 | Bacteria | 18435 |
| 394 | Ga0307408_101885909 | 3300031548 | Bacteria | 573 |
| 395 | Ga0307516_10000414 | 3300031730 | Bacteria | 55918 |
| 396 | Ga0307516_10098574 | 3300031730 | Bacteria | 2741 |
| 397 | Ga0307413_10378574 | 3300031824 | Bacteria | 1102 |
| 398 | Ga0307406_10126661 | 3300031901 | Bacteria | 1786 |
| 399 | Ga0307407_10428405 | 3300031903 | Bacteria | 955 |
| 400 | Ga0307412_10719979 | 3300031911 | Bacteria | 858 |
| 401 | Ga0307416_102062651 | 3300032002 | Bacteria | 672 |
| 402 | Ga0307414_10143666 | 3300032004 | Bacteria | 1872 |
| 403 | Ga0307414_10316368 | 3300032004 | Bacteria | 1327 |
| 404 | Ga0307411_10760013 | 3300032005 | Bacteria | 850 |
| 405 | Ga0373934_0089134 | 3300035086 | Bacteria | 1243 |
| 406 | Ga0373940_0178108 | 3300035088 | Bacteria | 690 |
| 407 | Ga0373944_0011729 | 3300035089 | Bacteria | 2405 |
| 408 | Ga0373960_0149668 | 3300035121 | Bacteria | 796 |
| 409 | Ga0373931_0002297 | 3300035691 | Bacteria | 8449 |
| 410 | Ga0373931_0069220 | 3300035691 | Bacteria | 1923 |
| 411 | Ga0373931_0257880 | 3300035691 | Bacteria | 1063 |
| 412 | Ga0373927_0015547 | 3300035695 | Bacteria | 5027 |
| 413 | Ga0373925_0005471 | 3300037068 | Bacteria | 9455 |
| 414 | Ga0373925_0523925 | 3300037068 | Bacteria | 974 |
| 415 | Ga0395898_0100671 | 3300037466 | Bacteria | 2775 |
| 416 | Ga0395905_0758475 | 3300037471 | Bacteria | 873 |
| 417 | Ga0436364_0315105 | 3300037853 | Bacteria | 1139 |
| 418 | Ga0436364_0513231 | 3300037853 | Bacteria | 893 |
| 419 | Ga0395901_0006003 | 3300038443 | Bacteria | 12303 |
| 420 | Ga0395901_0506109 | 3300038443 | Bacteria | 1229 |
| 421 | Ga0439439_0067088 | 3300041406 | Bacteria | 958 |
| 422 | Ga0439447_000358 | 3300041407 | Bacteria | 16566 |
| 423 | Ga0439453_0016610 | 3300041408 | Bacteria | 1285 |
| 424 | Ga0451787_603998 | 3300041441 | Bacteria | 563 |
| 425 | Ga0451789_1110718 | 3300041443 | Bacteria | 833 |
| 426 | Ga0451793_0837470 | 3300041452 | Bacteria | 2282 |
| 427 | Ga0451800_0379387 | 3300041459 | Bacteria | 971 |
| 428 | Ga0451804_0978710 | 3300041463 | Bacteria | 962 |
| 429 | Ga0451807_0221148 | 3300041486 | Bacteria | 1049 |
| 430 | Ga0451849_0693586 | 3300041505 | Bacteria | 1352 |
| 431 | Ga0451853_2526807 | 3300041512 | Bacteria | 846 |
| 432 | Ga0450898_008446 | 3300042134 | Bacteria | 1625 |
| 433 | Ga0450903_000708 | 3300042138 | Bacteria | 6634 |
| 434 | Ga0450893_0009900 | 3300042532 | Bacteria | 1560 |
| 435 | Ga0451577_0114088 | 3300042876 | Bacteria | 2419 |
| 436 | Ga0451577_0127603 | 3300042876 | Bacteria | 2280 |
| 437 | Ga0466965_0070068 | 3300044683 | Bacteria | 1762 |
| 438 | Ga0466963_0420326 | 3300044694 | Bacteria | 943 |
| 439 | Ga0453684_0001907 | 3300044712 | Bacteria | 54115 |
| 440 | Ga0451576_0155907 | 3300045051 | Bacteria | 2382 |
| 441 | Ga0495617_002342 | 3300046452 | Bacteria | 7599 |
| 442 | Ga0495592_0030903 | 3300046454 | Bacteria | 4051 |
| 443 | Ga0495603_0005347 | 3300046455 | Bacteria | 7660 |
| 444 | Ga0495590_0005444 | 3300046457 | Bacteria | 5053 |
| 445 | Ga0495591_001925 | 3300046458 | Bacteria | 12176 |
| 446 | Ga0495629_0083677 | 3300046459 | Bacteria | 2227 |
| 447 | Ga0495629_0116301 | 3300046459 | Bacteria | 1864 |
| 448 | Ga0495638_0208016 | 3300046460 | Bacteria | 1100 |
| 449 | Ga0495653_0026095 | 3300046463 | Bacteria | 4689 |
| 450 | Ga0495650_0003373 | 3300046471 | Bacteria | 11701 |
| 451 | Ga0495605_0001792 | 3300046474 | Bacteria | 13780 |
| 452 | Ga0495584_0021626 | 3300046491 | Bacteria | 3266 |
| 453 | Ga0495585_0002387 | 3300046492 | Bacteria | 13468 |
| 454 | Ga0495585_0003550 | 3300046492 | Bacteria | 10475 |
| 455 | Ga0495607_0035702 | 3300046501 | Bacteria | 3004 |
| 456 | Ga0495583_0048231 | 3300046506 | Bacteria | 1955 |
| 457 | Ga0495610_0019865 | 3300046512 | Bacteria | 3745 |
| 458 | Ga0495616_0088322 | 3300046513 | Bacteria | 1471 |
| 459 | Ga0495616_0094174 | 3300046513 | Bacteria | 1413 |
| 460 | Ga0495628_0063187 | 3300046516 | Bacteria | 2901 |
| 461 | Ga0495631_0002606 | 3300046518 | Bacteria | 10080 |
| 462 | Ga0495632_0001099 | 3300046519 | Bacteria | 23165 |
| 463 | Ga0495632_0007523 | 3300046519 | Bacteria | 6825 |
| 464 | Ga0495637_0007043 | 3300046520 | Bacteria | 5599 |
| 465 | Ga0495643_0021242 | 3300046522 | Bacteria | 3727 |
| 466 | Ga0495644_0047350 | 3300046523 | Bacteria | 1615 |
| 467 | Ga0495644_0146595 | 3300046523 | Bacteria | 902 |
| 468 | Ga0495648_0188691 | 3300046524 | Bacteria | 1041 |
| 469 | Ga0495648_0188962 | 3300046524 | Bacteria | 1040 |
| 470 | Ga0495642_0000415 | 3300046528 | Bacteria | 22842 |
| 471 | Ga0495642_0022979 | 3300046528 | Bacteria | 2460 |
| 472 | Ga0495654_0051871 | 3300046530 | Bacteria | 2000 |
| 473 | Ga0495665_0380762 | 3300046531 | Bacteria | 717 |
| 474 | Ga0495640_0027391 | 3300046533 | Bacteria | 4111 |
| 475 | Ga0495586_0102952 | 3300046535 | Bacteria | 1585 |
| 476 | Ga0495587_0000190 | 3300046536 | Bacteria | 45240 |
| 477 | Ga0495609_0001763 | 3300046538 | Bacteria | 13897 |
| 478 | Ga0495609_0093097 | 3300046538 | Bacteria | 1309 |
| 479 | Ga0495597_0030641 | 3300046542 | Bacteria | 2450 |
| 480 | Ga0495597_0124504 | 3300046542 | Bacteria | 1072 |
| 481 | Ga0495622_0001288 | 3300046557 | Bacteria | 12869 |
| 482 | Ga0495622_0027356 | 3300046557 | Bacteria | 2662 |
| 483 | Ga0495622_0084328 | 3300046557 | Bacteria | 1461 |
| 484 | Ga0495656_0030780 | 3300046615 | Bacteria | 2171 |
| 485 | Ga0495656_0249341 | 3300046615 | Bacteria | 896 |
| 486 | Ga0495668_0377480 | 3300046616 | Bacteria | 778 |
| 487 | Ga0495634_0001714 | 3300046642 | Bacteria | 19026 |
| 488 | Ga0495634_0283130 | 3300046642 | Bacteria | 1006 |
| 489 | Ga0495611_0033499 | 3300046648 | Bacteria | 2267 |
| 490 | Ga0495625_0087225 | 3300046660 | Bacteria | 2163 |
| 491 | Ga0495625_0132768 | 3300046660 | Bacteria | 1685 |
| 492 | Ga0495635_0000350 | 3300046663 | Bacteria | 29321 |
| 493 | Ga0495661_0177388 | 3300046665 | Bacteria | 1131 |
| 494 | Ga0495588_0015425 | 3300046674 | Bacteria | 3677 |
| 495 | Ga0495588_0118185 | 3300046674 | Bacteria | 1397 |
| 496 | Ga0495623_0000943 | 3300046679 | Bacteria | 19601 |
| 497 | Ga0495646_0000790 | 3300046680 | Bacteria | 17703 |
| 498 | Ga0495646_0003348 | 3300046680 | Bacteria | 9963 |
| 499 | Ga0495647_0100292 | 3300046681 | Bacteria | 1198 |
| 500 | Ga0495658_0057510 | 3300046683 | Bacteria | 2222 |
| 501 | Ga0495669_0005909 | 3300046684 | Bacteria | 5101 |
| 502 | Ga0495669_0154975 | 3300046684 | Bacteria | 1085 |
| 503 | Ga0495613_0088680 | 3300046689 | Bacteria | 2241 |
| 504 | Ga0495670_0030514 | 3300046691 | Bacteria | 2677 |
| 505 | Ga0495670_0041789 | 3300046691 | Bacteria | 2288 |
| 506 | Ga0495671_0002591 | 3300046692 | Bacteria | 11374 |
| 507 | Ga0495671_0090853 | 3300046692 | Bacteria | 1494 |
| 508 | Ga0495671_0404444 | 3300046692 | Bacteria | 653 |
| 509 | Ga0495649_0035434 | 3300046694 | Bacteria | 2745 |
| 510 | Ga0495589_0036578 | 3300046794 | Bacteria | 2460 |
| 511 | Ga0495660_0060106 | 3300046810 | Bacteria | 2042 |
| 512 | Ga0495660_0179410 | 3300046810 | Bacteria | 1025 |
| 513 | Ga0495674_0013811 | 3300047319 | Bacteria | 7579 |
| 514 | Ga0495672_0103464 | 3300047320 | Bacteria | 1540 |
| 515 | Ga0495676_0095568 | 3300047321 | Bacteria | 2211 |
| 516 | Ga0495680_0046363 | 3300047322 | Bacteria | 3427 |
| 517 | Ga0495683_0144893 | 3300047323 | Bacteria | 1110 |
| 518 | Ga0495675_0003809 | 3300047444 | Bacteria | 9133 |
| 519 | Ga0495677_0001204 | 3300047445 | Bacteria | 10364 |
| 520 | Ga0495677_0036075 | 3300047445 | Bacteria | 1805 |
| 521 | Ga0495685_014601 | 3300047447 | Bacteria | 2670 |
| 522 | Ga0495673_0001372 | 3300047469 | Bacteria | 19678 |
| 523 | Ga0495673_0022361 | 3300047469 | Bacteria | 3101 |
| 524 | Ga0495673_0120106 | 3300047469 | Bacteria | 1041 |
| 525 | Ga0495681_0002913 | 3300047470 | Bacteria | 12093 |
| 526 | Ga0495681_0121745 | 3300047470 | Bacteria | 1119 |
| 527 | Ga0495593_0070663 | 3300047673 | Bacteria | 1813 |
| 528 | Ga0495593_0098503 | 3300047673 | Bacteria | 1501 |
| 529 | Ga0496100_0016146 | 3300048903 | Bacteria | 4378 |
| 530 | Ga0496102_0000821 | 3300048905 | Bacteria | 30135 |
| 531 | Ga0496102_0262216 | 3300048905 | Bacteria | 1629 |
| 532 | Ga0496103_0001316 | 3300048906 | Bacteria | 16847 |
| 533 | Ga0496104_0222530 | 3300048907 | Bacteria | 1800 |
| 534 | Ga0496104_0748819 | 3300048907 | Bacteria | 884 |
| 535 | Ga0496105_0020731 | 3300048908 | Bacteria | 5314 |
| 536 | Ga0496105_0410507 | 3300048908 | Bacteria | 1074 |
| 537 | Ga0496106_0107708 | 3300048909 | Bacteria | 2167 |
| 538 | Ga0496107_0658980 | 3300048910 | Bacteria | 771 |
| 539 | Ga0496108_0033870 | 3300048911 | Bacteria | 4243 |
| 540 | Ga0496108_1171137 | 3300048911 | Bacteria | 651 |
| 541 | Ga0496109_0067738 | 3300048912 | Bacteria | 3271 |
| 542 | Ga0496110_0113356 | 3300048913 | Bacteria | 2438 |
| 543 | Ga0496110_0175764 | 3300048913 | Bacteria | 1943 |
| 544 | Ga0496110_0226727 | 3300048913 | Bacteria | 1699 |
| 545 | Ga0496111_0063457 | 3300048914 | Bacteria | 2679 |
| 546 | Ga0496113_0343318 | 3300048916 | Bacteria | 1197 |
| 547 | Ga0496114_0146173 | 3300048917 | Bacteria | 2049 |
| 548 | Ga0496115_0004304 | 3300048918 | Bacteria | 10306 |
| 549 | Ga0496115_0321587 | 3300048918 | Bacteria | 1265 |
| 550 | Ga0496115_0792429 | 3300048918 | Bacteria | 738 |
| 551 | Ga0496116_0011895 | 3300048919 | Bacteria | 7159 |
| 552 | Ga0496117_0013466 | 3300048920 | Bacteria | 7133 |
| 553 | Ga0496117_0013650 | 3300048920 | Bacteria | 7068 |
| 554 | Ga0496118_0003083 | 3300048921 | Bacteria | 21369 |
| 555 | Ga0496118_0004488 | 3300048921 | Bacteria | 16523 |
| 556 | Ga0496121_0001221 | 3300048924 | Bacteria | 44771 |
| 557 | Ga0496121_0321052 | 3300048924 | Bacteria | 1042 |
| 558 | Ga0496124_0241392 | 3300048927 | Bacteria | 1343 |
| 559 | Ga0496125_0014795 | 3300048928 | Bacteria | 7579 |
| 560 | Ga0496126_0000134 | 3300048929 | Bacteria | 169693 |
| 561 | Ga0496126_0094223 | 3300048929 | Bacteria | 2628 |
| 562 | Ga0495678_176468 | 3300049459 | Bacteria | 672 |
| 563 | Ga0495682_0002634 | 3300049460 | Bacteria | 8392 |
| 564 | Ga0495682_0110363 | 3300049460 | Bacteria | 985 |
| 565 | Ga0501036_0011020 | 3300049572 | Bacteria | 7478 |
| 566 | Ga0501037_0021408 | 3300049573 | Bacteria | 4778 |
| 567 | Ga0501043_0005420 | 3300049579 | Bacteria | 10310 |
| 568 | Ga0501046_0202587 | 3300049580 | Bacteria | 1476 |
| 569 | Ga0501239_007749 | 3300049672 | Bacteria | 1132 |
| 570 | Ga0501241_017980 | 3300049758 | Bacteria | 1294 |
| 571 | Ga0501044_0009893 | 3300049823 | Bacteria | 10363 |
| 572 | nmdc:mga03683_141319_c1 | 3300050489 | Bacteria | 1082 |
| 573 | nmdc:mga0k408_104369_c1 | 3300050493 | Bacteria | 1673 |
| 574 | nmdc:mga0k408_127377_c1 | 3300050493 | Bacteria | 1510 |
| 575 | nmdc:mga0k408_1391_c2 | 3300050493 | Bacteria | 12211 |
| 576 | nmdc:mga0k408_258090_c1 | 3300050493 | Bacteria | 1041 |
| 577 | nmdc:mga06z11_25701_c1 | 3300050494 | Bacteria | 2794 |
| 578 | nmdc:mga07m45_1397_c1 | 3300050496 | Bacteria | 11030 |
| 579 | nmdc:mga07m45_218_c2 | 3300050496 | Bacteria | 22025 |
| 580 | nmdc:mga07m45_228436_c1 | 3300050496 | Bacteria | 1083 |
| 581 | nmdc:mga07m45_5866_c1 | 3300050496 | Bacteria | 6164 |
| 582 | nmdc:mga09592_736429_c1 | 3300050508 | Bacteria | 837 |
| 583 | nmdc:mga0qj67_314293_c1 | 3300050509 | Bacteria | 1268 |
| 584 | nmdc:mga0n895_680479_c1 | 3300050512 | Bacteria | 1026 |
| 585 | nmdc:mga0sz30_7459_c1 | 3300050516 | Bacteria | 4102 |
| 586 | Ga0500555_140833 | 3300053103 | Bacteria | 594 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006177 | Ga0075362_10007518 | Ga0075362_100075185 | 157 |
| 2 | 3300006186 | Ga0075369_10116449 | Ga0075369_101164491 | 157 |
| 3 | 3300006353 | Ga0075370_10002921 | Ga0075370_100029214 | 157 |
| 4 | 3300050493 | nmdc:mga0k408_104369_c1 | nmdc:mga0k408_104369_c1_887_1366 | 157 |
| 5 | 3300050494 | nmdc:mga06z11_25701_c1 | nmdc:mga06z11_25701_c1_155_634 | 157 |
| 6 | 3300050496 | nmdc:mga07m45_5866_c1 | nmdc:mga07m45_5866_c1_2363_2842 | 157 |
| 7 | 3300050516 | nmdc:mga0sz30_7459_c1 | nmdc:mga0sz30_7459_c1_2465_2944 | 157 |
| 8 | 3300002987 | JGI25159J45721_1040528 | JGI25159J45721_10405282 | 158 |
| 9 | 3300003784 | Ga0055534_1004910 | Ga0055534_10049102 | 158 |
| 10 | 3300009101 | Ga0105247_10107539 | Ga0105247_101075393 | 158 |
| 11 | 3300014325 | Ga0163163_10612352 | Ga0163163_106123522 | 158 |
| 12 | 3300014968 | Ga0157379_10409677 | Ga0157379_104096771 | 158 |
| 13 | 3300014969 | Ga0157376_10146612 | Ga0157376_101466122 | 158 |
| 14 | 3300025273 | Ga0209673_1041159 | Ga0209673_10411591 | 158 |
| 15 | 3300025291 | Ga0209675_1001827 | Ga0209675_10018278 | 158 |
| 16 | 3300025292 | Ga0209676_1024661 | Ga0209676_10246613 | 158 |
| 17 | 3300025294 | Ga0209025_1047426 | Ga0209025_10474263 | 158 |
| 18 | 3300025295 | Ga0209564_1041766 | Ga0209564_10417661 | 158 |
| 19 | 3300025304 | Ga0209257_1007844 | Ga0209257_10078445 | 158 |
| 20 | 3300041512 | Ga0451853_2526807 | Ga0451853_2526807_34_525 | 158 |
| 21 | 3300002705 | JGI25156J39149_1009741 | JGI25156J39149_10097411 | 159 |
| 22 | 3300002773 | JGI25152J39213_1013807 | JGI25152J39213_10138072 | 159 |
| 23 | 3300002774 | JGI25150J39212_1002186 | JGI25150J39212_10021866 | 159 |
| 24 | 3300002987 | JGI25159J45721_1000166 | JGI25159J45721_100016627 | 159 |
| 25 | 3300003187 | JGI25151J46595_10001854 | JGI25151J46595_100018544 | 159 |
| 26 | 3300003187 | JGI25151J46595_10029968 | JGI25151J46595_100299684 | 159 |
| 27 | 3300003354 | JGI25160J50197_1000352 | JGI25160J50197_100035227 | 159 |
| 28 | 3300003374 | JGI25161J50226_1000268 | JGI25161J50226_100026827 | 159 |
| 29 | 3300003752 | Ga0055539_1000521 | Ga0055539_100052112 | 159 |
| 30 | 3300003756 | Ga0055533_1000073 | Ga0055533_1000073106 | 159 |
| 31 | 3300003759 | Ga0055525_1002058 | Ga0055525_10020582 | 159 |
| 32 | 3300003771 | Ga0055526_1000015 | Ga0055526_100001593 | 159 |
| 33 | 3300003771 | Ga0055526_1000802 | Ga0055526_100080213 | 159 |
| 34 | 3300003773 | Ga0055537_1000053 | Ga0055537_100005331 | 159 |
| 35 | 3300003775 | Ga0055524_1000020 | Ga0055524_1000020216 | 159 |
| 36 | 3300003775 | Ga0055524_1000059 | Ga0055524_100005950 | 159 |
| 37 | 3300003784 | Ga0055534_1000017 | Ga0055534_100001794 | 159 |
| 38 | 3300003790 | Ga0055528_1000008 | Ga0055528_100000893 | 159 |
| 39 | 3300004625 | Ga0055543_1000361 | Ga0055543_100036127 | 159 |
| 40 | 3300005262 | Ga0065165_1004330 | Ga0065165_100433010 | 159 |
| 41 | 3300005288 | Ga0065714_10000625 | Ga0065714_100006253 | 159 |
| 42 | 3300005288 | Ga0065714_10004677 | Ga0065714_100046774 | 159 |
| 43 | 3300005288 | Ga0065714_10017235 | Ga0065714_100172353 | 159 |
| 44 | 3300005288 | Ga0065714_10106783 | Ga0065714_101067832 | 159 |
| 45 | 3300005288 | Ga0065714_10493790 | Ga0065714_104937901 | 159 |
| 46 | 3300005289 | Ga0065704_10214136 | Ga0065704_102141361 | 159 |
| 47 | 3300005293 | Ga0065715_10059901 | Ga0065715_100599012 | 159 |
| 48 | 3300005293 | Ga0065715_10111326 | Ga0065715_101113262 | 159 |
| 49 | 3300005295 | Ga0065707_10095187 | Ga0065707_100951872 | 159 |
| 50 | 3300005327 | Ga0070658_10010248 | Ga0070658_100102485 | 159 |
| 51 | 3300005327 | Ga0070658_10055328 | Ga0070658_100553282 | 159 |
| 52 | 3300005328 | Ga0070676_10132855 | Ga0070676_101328552 | 159 |
| 53 | 3300005329 | Ga0070683_100091563 | Ga0070683_1000915633 | 159 |
| 54 | 3300005330 | Ga0070690_100181988 | Ga0070690_1001819882 | 159 |
| 55 | 3300005333 | Ga0070677_10467642 | Ga0070677_104676421 | 159 |
| 56 | 3300005334 | Ga0068869_100010901 | Ga0068869_1000109014 | 159 |
| 57 | 3300005338 | Ga0068868_100004978 | Ga0068868_1000049784 | 159 |
| 58 | 3300005338 | Ga0068868_101140604 | Ga0068868_1011406042 | 159 |
| 59 | 3300005339 | Ga0070660_100419115 | Ga0070660_1004191151 | 159 |
| 60 | 3300005344 | Ga0070661_100520883 | Ga0070661_1005208831 | 159 |
| 61 | 3300005344 | Ga0070661_100960164 | Ga0070661_1009601642 | 159 |
| 62 | 3300005347 | Ga0070668_100026333 | Ga0070668_1000263334 | 159 |
| 63 | 3300005347 | Ga0070668_101330100 | Ga0070668_1013301002 | 159 |
| 64 | 3300005353 | Ga0070669_100016215 | Ga0070669_1000162154 | 159 |
| 65 | 3300005353 | Ga0070669_100429310 | Ga0070669_1004293101 | 159 |
| 66 | 3300005354 | Ga0070675_100018914 | Ga0070675_1000189141 | 159 |
| 67 | 3300005354 | Ga0070675_100207935 | Ga0070675_1002079352 | 159 |
| 68 | 3300005354 | Ga0070675_100704322 | Ga0070675_1007043221 | 159 |
| 69 | 3300005364 | Ga0070673_100164912 | Ga0070673_1001649122 | 159 |
| 70 | 3300005366 | Ga0070659_100049641 | Ga0070659_1000496412 | 159 |
| 71 | 3300005366 | Ga0070659_100612650 | Ga0070659_1006126501 | 159 |
| 72 | 3300005366 | Ga0070659_100790481 | Ga0070659_1007904811 | 159 |
| 73 | 3300005367 | Ga0070667_100214261 | Ga0070667_1002142612 | 159 |
| 74 | 3300005367 | Ga0070667_100265847 | Ga0070667_1002658472 | 159 |
| 75 | 3300005441 | Ga0070700_100038543 | Ga0070700_1000385433 | 159 |
| 76 | 3300005455 | Ga0070663_100122120 | Ga0070663_1001221202 | 159 |
| 77 | 3300005455 | Ga0070663_100485559 | Ga0070663_1004855592 | 159 |
| 78 | 3300005456 | Ga0070678_100446090 | Ga0070678_1004460902 | 159 |
| 79 | 3300005457 | Ga0070662_100106107 | Ga0070662_1001061071 | 159 |
| 80 | 3300005459 | Ga0068867_100004255 | Ga0068867_10000425510 | 159 |
| 81 | 3300005535 | Ga0070684_100548730 | Ga0070684_1005487301 | 159 |
| 82 | 3300005539 | Ga0068853_100336097 | Ga0068853_1003360972 | 159 |
| 83 | 3300005543 | Ga0070672_100010541 | Ga0070672_1000105412 | 159 |
| 84 | 3300005543 | Ga0070672_100409992 | Ga0070672_1004099922 | 159 |
| 85 | 3300005545 | Ga0070695_100410240 | Ga0070695_1004102402 | 159 |
| 86 | 3300005547 | Ga0070693_100100735 | Ga0070693_1001007352 | 159 |
| 87 | 3300005563 | Ga0068855_100000557 | Ga0068855_10000055730 | 159 |
| 88 | 3300005563 | Ga0068855_100009023 | Ga0068855_1000090237 | 159 |
| 89 | 3300005563 | Ga0068855_100027441 | Ga0068855_1000274415 | 159 |
| 90 | 3300005564 | Ga0070664_100111261 | Ga0070664_1001112611 | 159 |
| 91 | 3300005564 | Ga0070664_100193987 | Ga0070664_1001939872 | 159 |
| 92 | 3300005577 | Ga0068857_101315633 | Ga0068857_1013156331 | 159 |
| 93 | 3300005578 | Ga0068854_100000054 | Ga0068854_10000005417 | 159 |
| 94 | 3300005578 | Ga0068854_100235699 | Ga0068854_1002356992 | 159 |
| 95 | 3300005614 | Ga0068856_100144590 | Ga0068856_1001445902 | 159 |
| 96 | 3300005615 | Ga0070702_100928410 | Ga0070702_1009284101 | 159 |
| 97 | 3300005616 | Ga0068852_100566344 | Ga0068852_1005663442 | 159 |
| 98 | 3300005718 | Ga0068866_10378732 | Ga0068866_103787322 | 159 |
| 99 | 3300005719 | Ga0068861_100003049 | Ga0068861_1000030494 | 159 |
| 100 | 3300005719 | Ga0068861_100006599 | Ga0068861_1000065992 | 159 |
| 101 | 3300005841 | Ga0068863_100693806 | Ga0068863_1006938062 | 159 |
| 102 | 3300005841 | Ga0068863_101096238 | Ga0068863_1010962381 | 159 |
| 103 | 3300005842 | Ga0068858_100541377 | Ga0068858_1005413772 | 159 |
| 104 | 3300005842 | Ga0068858_100949215 | Ga0068858_1009492151 | 159 |
| 105 | 3300005843 | Ga0068860_100004998 | Ga0068860_10000499813 | 159 |
| 106 | 3300005843 | Ga0068860_100240302 | Ga0068860_1002403022 | 159 |
| 107 | 3300005844 | Ga0068862_100072016 | Ga0068862_1000720163 | 159 |
| 108 | 3300005844 | Ga0068862_100102941 | Ga0068862_1001029412 | 159 |
| 109 | 3300006042 | Ga0075368_10254408 | Ga0075368_102544082 | 159 |
| 110 | 3300006048 | Ga0075363_100051072 | Ga0075363_1000510722 | 159 |
| 111 | 3300006051 | Ga0075364_10152316 | Ga0075364_101523162 | 159 |
| 112 | 3300006058 | Ga0075432_10062752 | Ga0075432_100627522 | 159 |
| 113 | 3300006177 | Ga0075362_10112917 | Ga0075362_101129172 | 159 |
| 114 | 3300006195 | Ga0075366_10011855 | Ga0075366_100118553 | 159 |
| 115 | 3300006195 | Ga0075366_10121666 | Ga0075366_101216661 | 159 |
| 116 | 3300006195 | Ga0075366_10417142 | Ga0075366_104171422 | 159 |
| 117 | 3300006237 | Ga0097621_100019420 | Ga0097621_1000194204 | 159 |
| 118 | 3300006353 | Ga0075370_10004114 | Ga0075370_100041148 | 159 |
| 119 | 3300006353 | Ga0075370_10186863 | Ga0075370_101868632 | 159 |
| 120 | 3300006353 | Ga0075370_10312715 | Ga0075370_103127152 | 159 |
| 121 | 3300006358 | Ga0068871_100040501 | Ga0068871_1000405013 | 159 |
| 122 | 3300006846 | Ga0075430_100543998 | Ga0075430_1005439981 | 159 |
| 123 | 3300006881 | Ga0068865_100004612 | Ga0068865_1000046126 | 159 |
| 124 | 3300009036 | Ga0105244_10022162 | Ga0105244_100221624 | 159 |
| 125 | 3300009093 | Ga0105240_10041264 | Ga0105240_100412644 | 159 |
| 126 | 3300009094 | Ga0111539_10078852 | Ga0111539_100788525 | 159 |
| 127 | 3300009098 | Ga0105245_10071877 | Ga0105245_100718773 | 159 |
| 128 | 3300009098 | Ga0105245_12490765 | Ga0105245_124907651 | 159 |
| 129 | 3300009177 | Ga0105248_10142710 | Ga0105248_101427103 | 159 |
| 130 | 3300009545 | Ga0105237_10028309 | Ga0105237_100283092 | 159 |
| 131 | 3300009545 | Ga0105237_10104756 | Ga0105237_101047563 | 159 |
| 132 | 3300009551 | Ga0105238_10074057 | Ga0105238_100740574 | 159 |
| 133 | 3300009551 | Ga0105238_10079054 | Ga0105238_100790542 | 159 |
| 134 | 3300010375 | Ga0105239_10886089 | Ga0105239_108860892 | 159 |
| 135 | 3300013100 | Ga0157373_10323525 | Ga0157373_103235251 | 159 |
| 136 | 3300013102 | Ga0157371_10149126 | Ga0157371_101491262 | 159 |
| 137 | 3300013104 | Ga0157370_10024804 | Ga0157370_100248043 | 159 |
| 138 | 3300013104 | Ga0157370_10082622 | Ga0157370_100826225 | 159 |
| 139 | 3300013104 | Ga0157370_10816387 | Ga0157370_108163871 | 159 |
| 140 | 3300013105 | Ga0157369_10269500 | Ga0157369_102695004 | 159 |
| 141 | 3300013296 | Ga0157374_10005044 | Ga0157374_100050443 | 159 |
| 142 | 3300013296 | Ga0157374_10114617 | Ga0157374_101146172 | 159 |
| 143 | 3300013296 | Ga0157374_10152900 | Ga0157374_101529002 | 159 |
| 144 | 3300013297 | Ga0157378_10633558 | Ga0157378_106335582 | 159 |
| 145 | 3300013306 | Ga0163162_10005279 | Ga0163162_100052796 | 159 |
| 146 | 3300013306 | Ga0163162_10384544 | Ga0163162_103845442 | 159 |
| 147 | 3300013306 | Ga0163162_11682808 | Ga0163162_116828081 | 159 |
| 148 | 3300013308 | Ga0157375_10918574 | Ga0157375_109185741 | 159 |
| 149 | 3300014745 | Ga0157377_10020376 | Ga0157377_100203764 | 159 |
| 150 | 3300014968 | Ga0157379_10039193 | Ga0157379_100391932 | 159 |
| 151 | 3300014969 | Ga0157376_10062869 | Ga0157376_100628691 | 159 |
| 152 | 3300015261 | Ga0182006_1101622 | Ga0182006_11016222 | 159 |
| 153 | 3300015689 | Ga0183360_10002 | Ga0183360_10002543 | 159 |
| 154 | 3300017792 | Ga0163161_10104378 | Ga0163161_101043782 | 159 |
| 155 | 3300025208 | Ga0209436_103839 | Ga0209436_1038396 | 159 |
| 156 | 3300025226 | Ga0209674_100039 | Ga0209674_100039298 | 159 |
| 157 | 3300025230 | Ga0209563_100110 | Ga0209563_10011032 | 159 |
| 158 | 3300025230 | Ga0209563_113760 | Ga0209563_1137602 | 159 |
| 159 | 3300025231 | Ga0207427_102251 | Ga0207427_1022517 | 159 |
| 160 | 3300025245 | Ga0207425_1001058 | Ga0207425_10010586 | 159 |
| 161 | 3300025253 | Ga0209677_100151 | Ga0209677_1001519 | 159 |
| 162 | 3300025256 | Ga0209759_1002704 | Ga0209759_10027043 | 159 |
| 163 | 3300025258 | Ga0209129_1011522 | Ga0209129_10115222 | 159 |
| 164 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001155 | 159 |
| 165 | 3300025263 | Ga0209565_1000715 | Ga0209565_10007155 | 159 |
| 166 | 3300025263 | Ga0209565_1001682 | Ga0209565_10016822 | 159 |
| 167 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001155 | 159 |
| 168 | 3300025273 | Ga0209673_1031221 | Ga0209673_10312212 | 159 |
| 169 | 3300025284 | Ga0209130_1000202 | Ga0209130_100020220 | 159 |
| 170 | 3300025284 | Ga0209130_1019365 | Ga0209130_10193651 | 159 |
| 171 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000012377 | 159 |
| 172 | 3300025291 | Ga0209675_1001344 | Ga0209675_10013442 | 159 |
| 173 | 3300025291 | Ga0209675_1009899 | Ga0209675_10098994 | 159 |
| 174 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008771 | 159 |
| 175 | 3300025294 | Ga0209025_1002511 | Ga0209025_10025116 | 159 |
| 176 | 3300025294 | Ga0209025_1014325 | Ga0209025_10143255 | 159 |
| 177 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012539 | 159 |
| 178 | 3300025295 | Ga0209564_1000049 | Ga0209564_1000049340 | 159 |
| 179 | 3300025297 | Ga0209758_1049721 | Ga0209758_10497212 | 159 |
| 180 | 3300025298 | Ga0209050_1004979 | Ga0209050_10049792 | 159 |
| 181 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006975 | 159 |
| 182 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014299 | 159 |
| 183 | 3300025302 | Ga0207426_1000145 | Ga0207426_1000145127 | 159 |
| 184 | 3300025321 | Ga0207656_10237648 | Ga0207656_102376482 | 159 |
| 185 | 3300025711 | Ga0207696_1031516 | Ga0207696_10315162 | 159 |
| 186 | 3300025728 | Ga0207655_1026871 | Ga0207655_10268712 | 159 |
| 187 | 3300025735 | Ga0207713_1055262 | Ga0207713_10552622 | 159 |
| 188 | 3300025893 | Ga0207682_10011620 | Ga0207682_100116202 | 159 |
| 189 | 3300025901 | Ga0207688_10014298 | Ga0207688_100142983 | 159 |
| 190 | 3300025901 | Ga0207688_10265002 | Ga0207688_102650022 | 159 |
| 191 | 3300025907 | Ga0207645_10010376 | Ga0207645_100103764 | 159 |
| 192 | 3300025908 | Ga0207643_10135149 | Ga0207643_101351492 | 159 |
| 193 | 3300025909 | Ga0207705_10018657 | Ga0207705_100186574 | 159 |
| 194 | 3300025909 | Ga0207705_10169706 | Ga0207705_101697062 | 159 |
| 195 | 3300025914 | Ga0207671_10132077 | Ga0207671_101320773 | 159 |
| 196 | 3300025914 | Ga0207671_10133942 | Ga0207671_101339422 | 159 |
| 197 | 3300025919 | Ga0207657_10008125 | Ga0207657_100081256 | 159 |
| 198 | 3300025919 | Ga0207657_10041456 | Ga0207657_100414563 | 159 |
| 199 | 3300025919 | Ga0207657_10133216 | Ga0207657_101332164 | 159 |
| 200 | 3300025923 | Ga0207681_10042853 | Ga0207681_100428532 | 159 |
| 201 | 3300025923 | Ga0207681_10059547 | Ga0207681_100595472 | 159 |
| 202 | 3300025924 | Ga0207694_10401792 | Ga0207694_104017922 | 159 |
| 203 | 3300025926 | Ga0207659_10649221 | Ga0207659_106492212 | 159 |
| 204 | 3300025927 | Ga0207687_10532649 | Ga0207687_105326492 | 159 |
| 205 | 3300025932 | Ga0207690_10023767 | Ga0207690_100237674 | 159 |
| 206 | 3300025932 | Ga0207690_10049880 | Ga0207690_100498803 | 159 |
| 207 | 3300025932 | Ga0207690_10110381 | Ga0207690_101103811 | 159 |
| 208 | 3300025933 | Ga0207706_10000377 | Ga0207706_1000037728 | 159 |
| 209 | 3300025933 | Ga0207706_10489415 | Ga0207706_104894152 | 159 |
| 210 | 3300025934 | Ga0207686_10163158 | Ga0207686_101631583 | 159 |
| 211 | 3300025938 | Ga0207704_10002130 | Ga0207704_100021303 | 159 |
| 212 | 3300025940 | Ga0207691_10069635 | Ga0207691_100696355 | 159 |
| 213 | 3300025940 | Ga0207691_10173395 | Ga0207691_101733952 | 159 |
| 214 | 3300025941 | Ga0207711_10028975 | Ga0207711_100289754 | 159 |
| 215 | 3300025942 | Ga0207689_10000312 | Ga0207689_1000031217 | 159 |
| 216 | 3300025945 | Ga0207679_10430411 | Ga0207679_104304112 | 159 |
| 217 | 3300025949 | Ga0207667_10000062 | Ga0207667_1000006282 | 159 |
| 218 | 3300025949 | Ga0207667_10014452 | Ga0207667_100144528 | 159 |
| 219 | 3300025949 | Ga0207667_10124236 | Ga0207667_101242363 | 159 |
| 220 | 3300025960 | Ga0207651_10069966 | Ga0207651_100699662 | 159 |
| 221 | 3300025961 | Ga0207712_10211137 | Ga0207712_102111372 | 159 |
| 222 | 3300025972 | Ga0207668_10003807 | Ga0207668_100038075 | 159 |
| 223 | 3300025981 | Ga0207640_10000022 | Ga0207640_1000002230 | 159 |
| 224 | 3300025981 | Ga0207640_10417242 | Ga0207640_104172421 | 159 |
| 225 | 3300025986 | Ga0207658_10585579 | Ga0207658_105855792 | 159 |
| 226 | 3300025986 | Ga0207658_11101495 | Ga0207658_111014952 | 159 |
| 227 | 3300026035 | Ga0207703_10316055 | Ga0207703_103160552 | 159 |
| 228 | 3300026035 | Ga0207703_10878048 | Ga0207703_108780482 | 159 |
| 229 | 3300026041 | Ga0207639_10236220 | Ga0207639_102362202 | 159 |
| 230 | 3300026067 | Ga0207678_10015906 | Ga0207678_100159063 | 159 |
| 231 | 3300026067 | Ga0207678_10189412 | Ga0207678_101894122 | 159 |
| 232 | 3300026075 | Ga0207708_10047022 | Ga0207708_100470223 | 159 |
| 233 | 3300026088 | Ga0207641_10223664 | Ga0207641_102236642 | 159 |
| 234 | 3300026089 | Ga0207648_10002883 | Ga0207648_1000288315 | 159 |
| 235 | 3300026095 | Ga0207676_10653995 | Ga0207676_106539951 | 159 |
| 236 | 3300026118 | Ga0207675_100000484 | Ga0207675_10000048417 | 159 |
| 237 | 3300026121 | Ga0207683_10068898 | Ga0207683_100688983 | 159 |
| 238 | 3300026142 | Ga0207698_10299062 | Ga0207698_102990622 | 159 |
| 239 | 3300027866 | Ga0209813_10427011 | Ga0209813_104270111 | 159 |
| 240 | 3300027907 | Ga0207428_10408270 | Ga0207428_104082701 | 159 |
| 241 | 3300028379 | Ga0268266_10267412 | Ga0268266_102674121 | 159 |
| 242 | 3300028380 | Ga0268265_10005260 | Ga0268265_100052606 | 159 |
| 243 | 3300028381 | Ga0268264_10092018 | Ga0268264_100920183 | 159 |
| 244 | 3300028666 | Ga0265336_10000010 | Ga0265336_1000001037 | 159 |
| 245 | 3300028786 | Ga0307517_10362783 | Ga0307517_103627831 | 159 |
| 246 | 3300029957 | Ga0265324_10001918 | Ga0265324_100019184 | 159 |
| 247 | 3300031456 | Ga0307513_10002924 | Ga0307513_100029243 | 159 |
| 248 | 3300031548 | Ga0307408_100001343 | Ga0307408_10000134316 | 159 |
| 249 | 3300031548 | Ga0307408_101885909 | Ga0307408_1018859091 | 159 |
| 250 | 3300031730 | Ga0307516_10000414 | Ga0307516_1000041444 | 159 |
| 251 | 3300031730 | Ga0307516_10098574 | Ga0307516_100985742 | 159 |
| 252 | 3300031824 | Ga0307413_10378574 | Ga0307413_103785742 | 159 |
| 253 | 3300031901 | Ga0307406_10126661 | Ga0307406_101266613 | 159 |
| 254 | 3300031903 | Ga0307407_10428405 | Ga0307407_104284052 | 159 |
| 255 | 3300031911 | Ga0307412_10719979 | Ga0307412_107199791 | 159 |
| 256 | 3300032002 | Ga0307416_102062651 | Ga0307416_1020626512 | 159 |
| 257 | 3300032004 | Ga0307414_10143666 | Ga0307414_101436662 | 159 |
| 258 | 3300035088 | Ga0373940_0178108 | Ga0373940_0178108_64_543 | 159 |
| 259 | 3300035089 | Ga0373944_0011729 | Ga0373944_0011729_1587_2078 | 159 |
| 260 | 3300035121 | Ga0373960_0149668 | Ga0373960_0149668_63_542 | 159 |
| 261 | 3300035691 | Ga0373931_0002297 | Ga0373931_0002297_679_1158 | 159 |
| 262 | 3300035691 | Ga0373931_0069220 | Ga0373931_0069220_172_651 | 159 |
| 263 | 3300035691 | Ga0373931_0257880 | Ga0373931_0257880_115_594 | 159 |
| 264 | 3300035695 | Ga0373927_0015547 | Ga0373927_0015547_73_564 | 159 |
| 265 | 3300037068 | Ga0373925_0005471 | Ga0373925_0005471_2632_3123 | 159 |
| 266 | 3300037068 | Ga0373925_0523925 | Ga0373925_0523925_371_907 | 159 |
| 267 | 3300037466 | Ga0395898_0100671 | Ga0395898_0100671_550_1029 | 159 |
| 268 | 3300038443 | Ga0395901_0006003 | Ga0395901_0006003_1942_2421 | 159 |
| 269 | 3300038443 | Ga0395901_0506109 | Ga0395901_0506109_345_824 | 159 |
| 270 | 3300041407 | Ga0439447_000358 | Ga0439447_000358_7262_7741 | 159 |
| 271 | 3300041408 | Ga0439453_0016610 | Ga0439453_0016610_520_999 | 159 |
| 272 | 3300041441 | Ga0451787_603998 | Ga0451787_603998_62_541 | 159 |
| 273 | 3300041452 | Ga0451793_0837470 | Ga0451793_0837470_273_752 | 159 |
| 274 | 3300041463 | Ga0451804_0978710 | Ga0451804_0978710_416_901 | 159 |
| 275 | 3300041486 | Ga0451807_0221148 | Ga0451807_0221148_210_689 | 159 |
| 276 | 3300041505 | Ga0451849_0693586 | Ga0451849_0693586_32_511 | 159 |
| 277 | 3300042134 | Ga0450898_008446 | Ga0450898_008446_147_626 | 159 |
| 278 | 3300042138 | Ga0450903_000708 | Ga0450903_000708_5812_6291 | 159 |
| 279 | 3300042532 | Ga0450893_0009900 | Ga0450893_0009900_603_1082 | 159 |
| 280 | 3300042876 | Ga0451577_0114088 | Ga0451577_0114088_214_810 | 159 |
| 281 | 3300042876 | Ga0451577_0127603 | Ga0451577_0127603_976_1470 | 159 |
| 282 | 3300044683 | Ga0466965_0070068 | Ga0466965_0070068_720_1199 | 159 |
| 283 | 3300044694 | Ga0466963_0420326 | Ga0466963_0420326_24_503 | 159 |
| 284 | 3300045051 | Ga0451576_0155907 | Ga0451576_0155907_1603_2082 | 159 |
| 285 | 3300046452 | Ga0495617_002342 | Ga0495617_002342_2089_2568 | 159 |
| 286 | 3300046455 | Ga0495603_0005347 | Ga0495603_0005347_3843_4322 | 159 |
| 287 | 3300046457 | Ga0495590_0005444 | Ga0495590_0005444_78_557 | 159 |
| 288 | 3300046458 | Ga0495591_001925 | Ga0495591_001925_9385_9864 | 159 |
| 289 | 3300046459 | Ga0495629_0083677 | Ga0495629_0083677_194_679 | 159 |
| 290 | 3300046459 | Ga0495629_0116301 | Ga0495629_0116301_245_724 | 159 |
| 291 | 3300046460 | Ga0495638_0208016 | Ga0495638_0208016_425_904 | 159 |
| 292 | 3300046463 | Ga0495653_0026095 | Ga0495653_0026095_3816_4295 | 159 |
| 293 | 3300046471 | Ga0495650_0003373 | Ga0495650_0003373_9073_9552 | 159 |
| 294 | 3300046474 | Ga0495605_0001792 | Ga0495605_0001792_7356_7835 | 159 |
| 295 | 3300046491 | Ga0495584_0021626 | Ga0495584_0021626_2470_2949 | 159 |
| 296 | 3300046492 | Ga0495585_0002387 | Ga0495585_0002387_12463_12942 | 159 |
| 297 | 3300046492 | Ga0495585_0003550 | Ga0495585_0003550_2356_2835 | 159 |
| 298 | 3300046501 | Ga0495607_0035702 | Ga0495607_0035702_1967_2446 | 159 |
| 299 | 3300046506 | Ga0495583_0048231 | Ga0495583_0048231_960_1439 | 159 |
| 300 | 3300046512 | Ga0495610_0019865 | Ga0495610_0019865_1912_2391 | 159 |
| 301 | 3300046513 | Ga0495616_0088322 | Ga0495616_0088322_463_942 | 159 |
| 302 | 3300046513 | Ga0495616_0094174 | Ga0495616_0094174_680_1159 | 159 |
| 303 | 3300046516 | Ga0495628_0063187 | Ga0495628_0063187_2110_2589 | 159 |
| 304 | 3300046518 | Ga0495631_0002606 | Ga0495631_0002606_9178_9657 | 159 |
| 305 | 3300046519 | Ga0495632_0001099 | Ga0495632_0001099_18739_19218 | 159 |
| 306 | 3300046519 | Ga0495632_0007523 | Ga0495632_0007523_3191_3670 | 159 |
| 307 | 3300046520 | Ga0495637_0007043 | Ga0495637_0007043_2127_2606 | 159 |
| 308 | 3300046522 | Ga0495643_0021242 | Ga0495643_0021242_2889_3368 | 159 |
| 309 | 3300046523 | Ga0495644_0047350 | Ga0495644_0047350_1031_1510 | 159 |
| 310 | 3300046523 | Ga0495644_0146595 | Ga0495644_0146595_390_869 | 159 |
| 311 | 3300046524 | Ga0495648_0188691 | Ga0495648_0188691_33_512 | 159 |
| 312 | 3300046524 | Ga0495648_0188962 | Ga0495648_0188962_529_1008 | 159 |
| 313 | 3300046528 | Ga0495642_0000415 | Ga0495642_0000415_20021_20500 | 159 |
| 314 | 3300046528 | Ga0495642_0022979 | Ga0495642_0022979_225_704 | 159 |
| 315 | 3300046530 | Ga0495654_0051871 | Ga0495654_0051871_1260_1739 | 159 |
| 316 | 3300046531 | Ga0495665_0380762 | Ga0495665_0380762_112_591 | 159 |
| 317 | 3300046536 | Ga0495587_0000190 | Ga0495587_0000190_16539_17018 | 159 |
| 318 | 3300046538 | Ga0495609_0001763 | Ga0495609_0001763_3230_3709 | 159 |
| 319 | 3300046538 | Ga0495609_0093097 | Ga0495609_0093097_426_905 | 159 |
| 320 | 3300046542 | Ga0495597_0030641 | Ga0495597_0030641_649_1128 | 159 |
| 321 | 3300046542 | Ga0495597_0124504 | Ga0495597_0124504_168_647 | 159 |
| 322 | 3300046557 | Ga0495622_0001288 | Ga0495622_0001288_9848_10327 | 159 |
| 323 | 3300046557 | Ga0495622_0027356 | Ga0495622_0027356_1022_1501 | 159 |
| 324 | 3300046557 | Ga0495622_0084328 | Ga0495622_0084328_261_740 | 159 |
| 325 | 3300046615 | Ga0495656_0030780 | Ga0495656_0030780_159_638 | 159 |
| 326 | 3300046615 | Ga0495656_0249341 | Ga0495656_0249341_145_624 | 159 |
| 327 | 3300046616 | Ga0495668_0377480 | Ga0495668_0377480_82_561 | 159 |
| 328 | 3300046642 | Ga0495634_0001714 | Ga0495634_0001714_11057_11569 | 159 |
| 329 | 3300046648 | Ga0495611_0033499 | Ga0495611_0033499_1222_1701 | 159 |
| 330 | 3300046660 | Ga0495625_0087225 | Ga0495625_0087225_529_1008 | 159 |
| 331 | 3300046660 | Ga0495625_0132768 | Ga0495625_0132768_682_1161 | 159 |
| 332 | 3300046663 | Ga0495635_0000350 | Ga0495635_0000350_13202_13681 | 159 |
| 333 | 3300046665 | Ga0495661_0177388 | Ga0495661_0177388_345_824 | 159 |
| 334 | 3300046674 | Ga0495588_0015425 | Ga0495588_0015425_1261_1740 | 159 |
| 335 | 3300046674 | Ga0495588_0118185 | Ga0495588_0118185_736_1215 | 159 |
| 336 | 3300046679 | Ga0495623_0000943 | Ga0495623_0000943_8610_9089 | 159 |
| 337 | 3300046680 | Ga0495646_0000790 | Ga0495646_0000790_11099_11611 | 159 |
| 338 | 3300046680 | Ga0495646_0003348 | Ga0495646_0003348_663_1142 | 159 |
| 339 | 3300046683 | Ga0495658_0057510 | Ga0495658_0057510_591_1070 | 159 |
| 340 | 3300046684 | Ga0495669_0005909 | Ga0495669_0005909_2306_2785 | 159 |
| 341 | 3300046684 | Ga0495669_0154975 | Ga0495669_0154975_289_768 | 159 |
| 342 | 3300046689 | Ga0495613_0088680 | Ga0495613_0088680_594_1073 | 159 |
| 343 | 3300046691 | Ga0495670_0030514 | Ga0495670_0030514_766_1245 | 159 |
| 344 | 3300046691 | Ga0495670_0041789 | Ga0495670_0041789_1228_1707 | 159 |
| 345 | 3300046692 | Ga0495671_0002591 | Ga0495671_0002591_4091_4570 | 159 |
| 346 | 3300046692 | Ga0495671_0090853 | Ga0495671_0090853_979_1458 | 159 |
| 347 | 3300046692 | Ga0495671_0404444 | Ga0495671_0404444_16_495 | 159 |
| 348 | 3300046694 | Ga0495649_0035434 | Ga0495649_0035434_2242_2721 | 159 |
| 349 | 3300046794 | Ga0495589_0036578 | Ga0495589_0036578_1437_1916 | 159 |
| 350 | 3300046810 | Ga0495660_0060106 | Ga0495660_0060106_1189_1668 | 159 |
| 351 | 3300046810 | Ga0495660_0179410 | Ga0495660_0179410_463_942 | 159 |
| 352 | 3300047319 | Ga0495674_0013811 | Ga0495674_0013811_6980_7459 | 159 |
| 353 | 3300047320 | Ga0495672_0103464 | Ga0495672_0103464_530_1009 | 159 |
| 354 | 3300047322 | Ga0495680_0046363 | Ga0495680_0046363_86_565 | 159 |
| 355 | 3300047323 | Ga0495683_0144893 | Ga0495683_0144893_255_734 | 159 |
| 356 | 3300047444 | Ga0495675_0003809 | Ga0495675_0003809_1409_1888 | 159 |
| 357 | 3300047445 | Ga0495677_0001204 | Ga0495677_0001204_9097_9576 | 159 |
| 358 | 3300047445 | Ga0495677_0036075 | Ga0495677_0036075_234_713 | 159 |
| 359 | 3300047447 | Ga0495685_014601 | Ga0495685_014601_1188_1667 | 159 |
| 360 | 3300047469 | Ga0495673_0001372 | Ga0495673_0001372_5236_5715 | 159 |
| 361 | 3300047469 | Ga0495673_0022361 | Ga0495673_0022361_1558_2037 | 159 |
| 362 | 3300047469 | Ga0495673_0120106 | Ga0495673_0120106_530_1009 | 159 |
| 363 | 3300047470 | Ga0495681_0002913 | Ga0495681_0002913_10178_10657 | 159 |
| 364 | 3300047470 | Ga0495681_0121745 | Ga0495681_0121745_22_501 | 159 |
| 365 | 3300047673 | Ga0495593_0070663 | Ga0495593_0070663_601_1080 | 159 |
| 366 | 3300047673 | Ga0495593_0098503 | Ga0495593_0098503_874_1353 | 159 |
| 367 | 3300048903 | Ga0496100_0016146 | Ga0496100_0016146_626_1105 | 159 |
| 368 | 3300048905 | Ga0496102_0000821 | Ga0496102_0000821_13248_13727 | 159 |
| 369 | 3300048905 | Ga0496102_0262216 | Ga0496102_0262216_272_751 | 159 |
| 370 | 3300048906 | Ga0496103_0001316 | Ga0496103_0001316_13330_13809 | 159 |
| 371 | 3300048908 | Ga0496105_0020731 | Ga0496105_0020731_722_1201 | 159 |
| 372 | 3300048908 | Ga0496105_0410507 | Ga0496105_0410507_490_969 | 159 |
| 373 | 3300048909 | Ga0496106_0107708 | Ga0496106_0107708_1321_1800 | 159 |
| 374 | 3300048910 | Ga0496107_0658980 | Ga0496107_0658980_38_517 | 159 |
| 375 | 3300048913 | Ga0496110_0113356 | Ga0496110_0113356_1601_2080 | 159 |
| 376 | 3300048913 | Ga0496110_0175764 | Ga0496110_0175764_566_1045 | 159 |
| 377 | 3300048914 | Ga0496111_0063457 | Ga0496111_0063457_103_582 | 159 |
| 378 | 3300048918 | Ga0496115_0004304 | Ga0496115_0004304_5250_5729 | 159 |
| 379 | 3300048918 | Ga0496115_0792429 | Ga0496115_0792429_43_522 | 159 |
| 380 | 3300048919 | Ga0496116_0011895 | Ga0496116_0011895_1031_1510 | 159 |
| 381 | 3300048920 | Ga0496117_0013466 | Ga0496117_0013466_4497_4976 | 159 |
| 382 | 3300048920 | Ga0496117_0013650 | Ga0496117_0013650_1797_2276 | 159 |
| 383 | 3300048921 | Ga0496118_0003083 | Ga0496118_0003083_16250_16729 | 159 |
| 384 | 3300048921 | Ga0496118_0004488 | Ga0496118_0004488_3531_4010 | 159 |
| 385 | 3300048924 | Ga0496121_0001221 | Ga0496121_0001221_25253_25732 | 159 |
| 386 | 3300048924 | Ga0496121_0321052 | Ga0496121_0321052_137_616 | 159 |
| 387 | 3300048927 | Ga0496124_0241392 | Ga0496124_0241392_375_854 | 159 |
| 388 | 3300048928 | Ga0496125_0014795 | Ga0496125_0014795_6915_7394 | 159 |
| 389 | 3300048929 | Ga0496126_0000134 | Ga0496126_0000134_109591_110070 | 159 |
| 390 | 3300048929 | Ga0496126_0094223 | Ga0496126_0094223_1168_1647 | 159 |
| 391 | 3300049459 | Ga0495678_176468 | Ga0495678_176468_177_656 | 159 |
| 392 | 3300049460 | Ga0495682_0002634 | Ga0495682_0002634_3294_3773 | 159 |
| 393 | 3300049460 | Ga0495682_0110363 | Ga0495682_0110363_255_734 | 159 |
| 394 | 3300049572 | Ga0501036_0011020 | Ga0501036_0011020_6358_6837 | 159 |
| 395 | 3300049573 | Ga0501037_0021408 | Ga0501037_0021408_4258_4737 | 159 |
| 396 | 3300049579 | Ga0501043_0005420 | Ga0501043_0005420_3844_4335 | 159 |
| 397 | 3300049580 | Ga0501046_0202587 | Ga0501046_0202587_790_1269 | 159 |
| 398 | 3300049672 | Ga0501239_007749 | Ga0501239_007749_50_529 | 159 |
| 399 | 3300049758 | Ga0501241_017980 | Ga0501241_017980_669_1148 | 159 |
| 400 | 3300049823 | Ga0501044_0009893 | Ga0501044_0009893_6234_6713 | 159 |
| 401 | 3300050489 | nmdc:mga03683_141319_c1 | nmdc:mga03683_141319_c1_547_1026 | 159 |
| 402 | 3300050493 | nmdc:mga0k408_127377_c1 | nmdc:mga0k408_127377_c1_383_862 | 159 |
| 403 | 3300050493 | nmdc:mga0k408_1391_c2 | nmdc:mga0k408_1391_c2_8159_8638 | 159 |
| 404 | 3300050493 | nmdc:mga0k408_258090_c1 | nmdc:mga0k408_258090_c1_359_838 | 159 |
| 405 | 3300050496 | nmdc:mga07m45_1397_c1 | nmdc:mga07m45_1397_c1_438_917 | 159 |
| 406 | 3300050496 | nmdc:mga07m45_228436_c1 | nmdc:mga07m45_228436_c1_87_566 | 159 |
| 407 | 3300050508 | nmdc:mga09592_736429_c1 | nmdc:mga09592_736429_c1_239_718 | 159 |
| 408 | 3300050509 | nmdc:mga0qj67_314293_c1 | nmdc:mga0qj67_314293_c1_406_885 | 159 |
| 409 | 3300050512 | nmdc:mga0n895_680479_c1 | nmdc:mga0n895_680479_c1_288_767 | 159 |
| 410 | 3300053103 | Ga0500555_140833 | Ga0500555_140833_58_546 | 159 |
| 411 | iso_pu_bacteria | 2588253510 | 2588291836 | 159 |
| 412 | 3300005331 | Ga0070670_100045953 | Ga0070670_1000459535 | 160 |
| 413 | 3300005336 | Ga0070680_100131720 | Ga0070680_1001317202 | 160 |
| 414 | 3300005339 | Ga0070660_100010221 | Ga0070660_1000102216 | 160 |
| 415 | 3300005344 | Ga0070661_100435245 | Ga0070661_1004352451 | 160 |
| 416 | 3300005366 | Ga0070659_100035370 | Ga0070659_1000353701 | 160 |
| 417 | 3300005435 | Ga0070714_100007323 | Ga0070714_1000073239 | 160 |
| 418 | 3300005530 | Ga0070679_101126552 | Ga0070679_1011265521 | 160 |
| 419 | 3300005539 | Ga0068853_100282417 | Ga0068853_1002824172 | 160 |
| 420 | 3300005563 | Ga0068855_100827487 | Ga0068855_1008274871 | 160 |
| 421 | 3300005614 | Ga0068856_100902215 | Ga0068856_1009022152 | 160 |
| 422 | 3300005618 | Ga0068864_100059273 | Ga0068864_1000592734 | 160 |
| 423 | 3300005841 | Ga0068863_100074984 | Ga0068863_1000749842 | 160 |
| 424 | 3300009093 | Ga0105240_10176421 | Ga0105240_101764212 | 160 |
| 425 | 3300009093 | Ga0105240_10755085 | Ga0105240_107550852 | 160 |
| 426 | 3300009094 | Ga0111539_10420615 | Ga0111539_104206152 | 160 |
| 427 | 3300009551 | Ga0105238_10550934 | Ga0105238_105509342 | 160 |
| 428 | 3300013104 | Ga0157370_11091654 | Ga0157370_110916541 | 160 |
| 429 | 3300013307 | Ga0157372_10038778 | Ga0157372_100387784 | 160 |
| 430 | 3300014325 | Ga0163163_10026023 | Ga0163163_100260235 | 160 |
| 431 | 3300014497 | Ga0182008_10009806 | Ga0182008_100098062 | 160 |
| 432 | 3300014969 | Ga0157376_11474270 | Ga0157376_114742701 | 160 |
| 433 | 3300025913 | Ga0207695_10781901 | Ga0207695_107819012 | 160 |
| 434 | 3300025913 | Ga0207695_10798367 | Ga0207695_107983671 | 160 |
| 435 | 3300025917 | Ga0207660_10606994 | Ga0207660_106069942 | 160 |
| 436 | 3300025919 | Ga0207657_10015410 | Ga0207657_100154102 | 160 |
| 437 | 3300025924 | Ga0207694_10004583 | Ga0207694_100045835 | 160 |
| 438 | 3300025925 | Ga0207650_10007016 | Ga0207650_100070168 | 160 |
| 439 | 3300025929 | Ga0207664_10025854 | Ga0207664_100258545 | 160 |
| 440 | 3300025949 | Ga0207667_10329064 | Ga0207667_103290642 | 160 |
| 441 | 3300025949 | Ga0207667_10459970 | Ga0207667_104599702 | 160 |
| 442 | 3300026041 | Ga0207639_10028948 | Ga0207639_100289482 | 160 |
| 443 | 3300026067 | Ga0207678_10068028 | Ga0207678_100680282 | 160 |
| 444 | 3300026078 | Ga0207702_10930754 | Ga0207702_109307542 | 160 |
| 445 | 3300026088 | Ga0207641_10005319 | Ga0207641_100053198 | 160 |
| 446 | 3300026095 | Ga0207676_10015577 | Ga0207676_100155774 | 160 |
| 447 | 3300026142 | Ga0207698_10476213 | Ga0207698_104762132 | 160 |
| 448 | 3300031239 | Ga0265328_10023123 | Ga0265328_100231232 | 160 |
| 449 | 3300031250 | Ga0265331_10001794 | Ga0265331_100017949 | 160 |
| 450 | 3300031251 | Ga0265327_10000035 | Ga0265327_10000035279 | 160 |
| 451 | 3300035086 | Ga0373934_0089134 | Ga0373934_0089134_362_898 | 160 |
| 452 | 3300041459 | Ga0451800_0379387 | Ga0451800_0379387_383_868 | 160 |
| 453 | 3300046454 | Ga0495592_0030903 | Ga0495592_0030903_1434_1916 | 160 |
| 454 | 3300046533 | Ga0495640_0027391 | Ga0495640_0027391_918_1400 | 160 |
| 455 | 3300046535 | Ga0495586_0102952 | Ga0495586_0102952_309_791 | 160 |
| 456 | 3300046642 | Ga0495634_0283130 | Ga0495634_0283130_84_566 | 160 |
| 457 | 3300046681 | Ga0495647_0100292 | Ga0495647_0100292_147_629 | 160 |
| 458 | 3300047321 | Ga0495676_0095568 | Ga0495676_0095568_402_884 | 160 |
| 459 | 3300001990 | JGI24737J22298_10056301 | JGI24737J22298_100563012 | 161 |
| 460 | 3300003756 | Ga0055533_1000805 | Ga0055533_10008058 | 161 |
| 461 | 3300005293 | Ga0065715_10533244 | Ga0065715_105332442 | 161 |
| 462 | 3300005295 | Ga0065707_10013027 | Ga0065707_100130273 | 161 |
| 463 | 3300005327 | Ga0070658_10029811 | Ga0070658_100298114 | 161 |
| 464 | 3300005329 | Ga0070683_100001582 | Ga0070683_1000015824 | 161 |
| 465 | 3300005330 | Ga0070690_100427305 | Ga0070690_1004273052 | 161 |
| 466 | 3300005331 | Ga0070670_100047703 | Ga0070670_1000477034 | 161 |
| 467 | 3300005335 | Ga0070666_10110394 | Ga0070666_101103944 | 161 |
| 468 | 3300005336 | Ga0070680_100000041 | Ga0070680_1000000413 | 161 |
| 469 | 3300005339 | Ga0070660_100165522 | Ga0070660_1001655222 | 161 |
| 470 | 3300005340 | Ga0070689_100023905 | Ga0070689_1000239055 | 161 |
| 471 | 3300005344 | Ga0070661_100006146 | Ga0070661_1000061462 | 161 |
| 472 | 3300005353 | Ga0070669_100039483 | Ga0070669_1000394832 | 161 |
| 473 | 3300005354 | Ga0070675_100004394 | Ga0070675_10000439410 | 161 |
| 474 | 3300005354 | Ga0070675_100007321 | Ga0070675_10000732116 | 161 |
| 475 | 3300005354 | Ga0070675_100028447 | Ga0070675_1000284472 | 161 |
| 476 | 3300005355 | Ga0070671_100007061 | Ga0070671_1000070612 | 161 |
| 477 | 3300005356 | Ga0070674_100002771 | Ga0070674_10000277113 | 161 |
| 478 | 3300005364 | Ga0070673_100008183 | Ga0070673_1000081832 | 161 |
| 479 | 3300005364 | Ga0070673_100036119 | Ga0070673_1000361194 | 161 |
| 480 | 3300005364 | Ga0070673_100599499 | Ga0070673_1005994991 | 161 |
| 481 | 3300005365 | Ga0070688_100006764 | Ga0070688_1000067645 | 161 |
| 482 | 3300005366 | Ga0070659_100182942 | Ga0070659_1001829423 | 161 |
| 483 | 3300005367 | Ga0070667_100014655 | Ga0070667_1000146551 | 161 |
| 484 | 3300005367 | Ga0070667_100130592 | Ga0070667_1001305923 | 161 |
| 485 | 3300005439 | Ga0070711_100006250 | Ga0070711_1000062503 | 161 |
| 486 | 3300005441 | Ga0070700_100982256 | Ga0070700_1009822561 | 161 |
| 487 | 3300005456 | Ga0070678_100001706 | Ga0070678_10000170613 | 161 |
| 488 | 3300005459 | Ga0068867_100079565 | Ga0068867_1000795654 | 161 |
| 489 | 3300005459 | Ga0068867_100987525 | Ga0068867_1009875251 | 161 |
| 490 | 3300005535 | Ga0070684_100005545 | Ga0070684_10000554511 | 161 |
| 491 | 3300005539 | Ga0068853_100482508 | Ga0068853_1004825082 | 161 |
| 492 | 3300005543 | Ga0070672_100009342 | Ga0070672_1000093422 | 161 |
| 493 | 3300005543 | Ga0070672_100205615 | Ga0070672_1002056152 | 161 |
| 494 | 3300005564 | Ga0070664_100020556 | Ga0070664_1000205564 | 161 |
| 495 | 3300005564 | Ga0070664_100096849 | Ga0070664_1000968493 | 161 |
| 496 | 3300005577 | Ga0068857_100013457 | Ga0068857_1000134573 | 161 |
| 497 | 3300005615 | Ga0070702_100969993 | Ga0070702_1009699931 | 161 |
| 498 | 3300005617 | Ga0068859_100325510 | Ga0068859_1003255103 | 161 |
| 499 | 3300005617 | Ga0068859_101103405 | Ga0068859_1011034052 | 161 |
| 500 | 3300005618 | Ga0068864_100257580 | Ga0068864_1002575802 | 161 |
| 501 | 3300005618 | Ga0068864_100806571 | Ga0068864_1008065712 | 161 |
| 502 | 3300005718 | Ga0068866_10010553 | Ga0068866_100105537 | 161 |
| 503 | 3300005834 | Ga0068851_10019685 | Ga0068851_100196854 | 161 |
| 504 | 3300005841 | Ga0068863_100296172 | Ga0068863_1002961722 | 161 |
| 505 | 3300006237 | Ga0097621_100027470 | Ga0097621_1000274706 | 161 |
| 506 | 3300006353 | Ga0075370_10009981 | Ga0075370_100099815 | 161 |
| 507 | 3300006358 | Ga0068871_100434357 | Ga0068871_1004343571 | 161 |
| 508 | 3300006931 | Ga0097620_100325483 | Ga0097620_1003254833 | 161 |
| 509 | 3300006931 | Ga0097620_101103557 | Ga0097620_1011035572 | 161 |
| 510 | 3300009177 | Ga0105248_10292627 | Ga0105248_102926272 | 161 |
| 511 | 3300009177 | Ga0105248_10378080 | Ga0105248_103780802 | 161 |
| 512 | 3300009177 | Ga0105248_10401178 | Ga0105248_104011781 | 161 |
| 513 | 3300013296 | Ga0157374_10014248 | Ga0157374_100142482 | 161 |
| 514 | 3300013297 | Ga0157378_10015098 | Ga0157378_1001509812 | 161 |
| 515 | 3300013306 | Ga0163162_10160195 | Ga0163162_101601954 | 161 |
| 516 | 3300013306 | Ga0163162_11916346 | Ga0163162_119163461 | 161 |
| 517 | 3300013307 | Ga0157372_10053836 | Ga0157372_100538364 | 161 |
| 518 | 3300013308 | Ga0157375_10001449 | Ga0157375_1000144911 | 161 |
| 519 | 3300013308 | Ga0157375_10642021 | Ga0157375_106420212 | 161 |
| 520 | 3300014325 | Ga0163163_11060730 | Ga0163163_110607302 | 161 |
| 521 | 3300014745 | Ga0157377_10049289 | Ga0157377_100492891 | 161 |
| 522 | 3300014968 | Ga0157379_11046843 | Ga0157379_110468432 | 161 |
| 523 | 3300017792 | Ga0163161_10037395 | Ga0163161_100373955 | 161 |
| 524 | 3300017792 | Ga0163161_10629547 | Ga0163161_106295472 | 161 |
| 525 | 3300017792 | Ga0163161_10770943 | Ga0163161_107709431 | 161 |
| 526 | 3300025226 | Ga0209674_100014 | Ga0209674_10001469 | 161 |
| 527 | 3300025315 | Ga0207697_10029375 | Ga0207697_100293754 | 161 |
| 528 | 3300025321 | Ga0207656_10376132 | Ga0207656_103761322 | 161 |
| 529 | 3300025901 | Ga0207688_10428542 | Ga0207688_104285422 | 161 |
| 530 | 3300025907 | Ga0207645_10210049 | Ga0207645_102100491 | 161 |
| 531 | 3300025917 | Ga0207660_10008583 | Ga0207660_100085833 | 161 |
| 532 | 3300025919 | Ga0207657_10063799 | Ga0207657_100637992 | 161 |
| 533 | 3300025919 | Ga0207657_10321636 | Ga0207657_103216362 | 161 |
| 534 | 3300025920 | Ga0207649_10678676 | Ga0207649_106786762 | 161 |
| 535 | 3300025920 | Ga0207649_11006988 | Ga0207649_110069881 | 161 |
| 536 | 3300025923 | Ga0207681_10032402 | Ga0207681_100324022 | 161 |
| 537 | 3300025923 | Ga0207681_10193700 | Ga0207681_101937002 | 161 |
| 538 | 3300025925 | Ga0207650_10011973 | Ga0207650_100119737 | 161 |
| 539 | 3300025925 | Ga0207650_10416344 | Ga0207650_104163442 | 161 |
| 540 | 3300025926 | Ga0207659_10007489 | Ga0207659_100074892 | 161 |
| 541 | 3300025926 | Ga0207659_10377058 | Ga0207659_103770582 | 161 |
| 542 | 3300025931 | Ga0207644_10039506 | Ga0207644_100395062 | 161 |
| 543 | 3300025932 | Ga0207690_10689691 | Ga0207690_106896911 | 161 |
| 544 | 3300025933 | Ga0207706_10271971 | Ga0207706_102719713 | 161 |
| 545 | 3300025936 | Ga0207670_10004663 | Ga0207670_100046636 | 161 |
| 546 | 3300025937 | Ga0207669_10006834 | Ga0207669_100068349 | 161 |
| 547 | 3300025940 | Ga0207691_10001087 | Ga0207691_1000108711 | 161 |
| 548 | 3300025940 | Ga0207691_10017913 | Ga0207691_1001791312 | 161 |
| 549 | 3300025940 | Ga0207691_10066542 | Ga0207691_100665424 | 161 |
| 550 | 3300025940 | Ga0207691_10701883 | Ga0207691_107018832 | 161 |
| 551 | 3300025944 | Ga0207661_10220419 | Ga0207661_102204192 | 161 |
| 552 | 3300025945 | Ga0207679_10118564 | Ga0207679_101185643 | 161 |
| 553 | 3300025945 | Ga0207679_11140853 | Ga0207679_111408531 | 161 |
| 554 | 3300025945 | Ga0207679_11467432 | Ga0207679_114674321 | 161 |
| 555 | 3300025949 | Ga0207667_11398262 | Ga0207667_113982621 | 161 |
| 556 | 3300025960 | Ga0207651_10004049 | Ga0207651_100040492 | 161 |
| 557 | 3300025960 | Ga0207651_10006137 | Ga0207651_100061376 | 161 |
| 558 | 3300025972 | Ga0207668_10025498 | Ga0207668_100254981 | 161 |
| 559 | 3300025986 | Ga0207658_10092952 | Ga0207658_100929523 | 161 |
| 560 | 3300026023 | Ga0207677_10014689 | Ga0207677_100146894 | 161 |
| 561 | 3300026041 | Ga0207639_10780721 | Ga0207639_107807212 | 161 |
| 562 | 3300026089 | Ga0207648_10105675 | Ga0207648_101056751 | 161 |
| 563 | 3300026089 | Ga0207648_10354638 | Ga0207648_103546384 | 161 |
| 564 | 3300026116 | Ga0207674_10004125 | Ga0207674_1000412516 | 161 |
| 565 | 3300026116 | Ga0207674_10120585 | Ga0207674_101205852 | 161 |
| 566 | 3300026118 | Ga0207675_100098057 | Ga0207675_1000980573 | 161 |
| 567 | 3300026121 | Ga0207683_10028823 | Ga0207683_100288232 | 161 |
| 568 | 3300026142 | Ga0207698_10135407 | Ga0207698_101354072 | 161 |
| 569 | 3300028794 | Ga0307515_10773987 | Ga0307515_107739871 | 161 |
| 570 | 3300032004 | Ga0307414_10316368 | Ga0307414_103163682 | 161 |
| 571 | 3300032005 | Ga0307411_10760013 | Ga0307411_107600131 | 161 |
| 572 | 3300037471 | Ga0395905_0758475 | Ga0395905_0758475_163_660 | 161 |
| 573 | 3300037853 | Ga0436364_0315105 | Ga0436364_0315105_631_1116 | 161 |
| 574 | 3300037853 | Ga0436364_0513231 | Ga0436364_0513231_295_780 | 161 |
| 575 | 3300041406 | Ga0439439_0067088 | Ga0439439_0067088_346_831 | 161 |
| 576 | 3300041443 | Ga0451789_1110718 | Ga0451789_1110718_124_612 | 161 |
| 577 | 3300044712 | Ga0453684_0001907 | Ga0453684_0001907_52656_53141 | 161 |
| 578 | 3300048907 | Ga0496104_0222530 | Ga0496104_0222530_357_842 | 161 |
| 579 | 3300048907 | Ga0496104_0748819 | Ga0496104_0748819_241_735 | 161 |
| 580 | 3300048911 | Ga0496108_0033870 | Ga0496108_0033870_3101_3595 | 161 |
| 581 | 3300048911 | Ga0496108_1171137 | Ga0496108_1171137_34_519 | 161 |
| 582 | 3300048912 | Ga0496109_0067738 | Ga0496109_0067738_2446_2940 | 161 |
| 583 | 3300048913 | Ga0496110_0226727 | Ga0496110_0226727_465_959 | 161 |
| 584 | 3300048916 | Ga0496113_0343318 | Ga0496113_0343318_212_697 | 161 |
| 585 | 3300048917 | Ga0496114_0146173 | Ga0496114_0146173_1155_1649 | 161 |
| 586 | 3300048918 | Ga0496115_0321587 | Ga0496115_0321587_636_1130 | 161 |
| 587 | 3300050496 | nmdc:mga07m45_218_c2 | nmdc:mga07m45_218_c2_19412_19903 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tsj-assembly1.cif.gz_A | crystal structure of protein from staphylococcus aureus | 0.7887 | 1 | 120 |
| 1tsj-assembly1.cif.gz_A | crystal structure of protein from staphylococcus aureus | 0.7575 | 1 | 120 |
| 3rhe-assembly1.cif.gz_A | the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila | 0.6726 | 7 | 122 |
| 3rhe-assembly1.cif.gz_A | the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila | 0.6533 | 7 | 122 |
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.6437 | 5 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8777 | 81 | 122 | 3.30.720.110 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8542 | 81 | 122 | 3.30.720.110 |
| af_P0AG24_192_325_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.7164 | 76 | 122 | 3.30.460.10 |
| 1tsjA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7108 | 1 | 120 | 3.10.180.10 |
| 3omsA01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.6864 | 10 | 76 | 3.30.720.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6GFM2-F1-model_v4 | deleted | 1.008 | 84 | 161 |
|
| AF-A0A534H6Z1-F1-model_v4 | VOC family protein | 1.007 | 81 | 161 |
|
| AF-A0A4Q3P670-F1-model_v4 | deleted | 0.9995 | 86 | 161 |
|
| AF-A0A6J7U880-F1-model_v4 | Unannotated protein | 0.9957 | 81 | 159 |
|
| AF-A0A3D3I036-F1-model_v4 | PhnB-like domain-containing protein | 0.9939 | 107 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar