F466519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 375 | 498 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10153765|Ga0070676_101537652 |
| Length | 314 |
| Sequence | VPIRPAAPGRPAPGAIDSIASETLADVDADEGGAHGSRADAGGHTLVPELPDVVDQVALARLYGEPLFALPQDLYIPPDALEVFLEAFEGPLDLLLYLIRKQNFNILDIPMAGLTRQYLSYVEEIRTRNLELAAEYLLMAAMLIEIKSRMLLPPRKTAEGEEAEDPRAELVRRLLEYEQAKMQAAALSALPLYGRDFWKAQVHIEQSLKPRFPDVNVVDLREAWADILKRARLVQHHRITREELSVREHMSIVLRKLQGRQFVEFENMFDIARGTPVMVVTFLAMLELAKETLIEITQAEAFAPIYVRLAYSPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 6 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 12 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 13 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 14 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 15 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 18 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 19 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 20 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 21 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 22 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 23 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 24 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 25 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 26 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 27 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 28 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 29 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 30 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 31 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 32 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 33 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 34 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 35 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 36 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 37 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 38 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 39 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 40 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 41 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 42 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 43 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 44 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 45 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 46 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 47 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 48 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 49 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 50 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 51 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 52 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 53 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 54 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 55 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 56 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 57 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 58 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 59 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 60 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 61 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 62 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 63 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 64 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 65 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 66 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 67 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 68 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 69 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 70 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 71 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 72 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 73 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 74 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 75 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 76 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 77 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 78 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 79 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 80 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 81 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 82 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 83 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 84 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 85 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 86 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 87 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 91 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 95 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 96 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 97 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 99 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 100 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 102 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 117 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 124 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 125 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 133 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 134 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 135 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 136 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 138 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 139 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 140 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 142 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 152 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 228 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 229 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 230 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 231 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 232 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 263 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 269 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 270 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 271 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 272 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 273 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 274 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 275 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 276 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 277 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 278 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 279 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 284 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 350 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 351 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 354 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 365 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 366 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 367 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 368 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 369 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 370 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 371 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 372 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 373 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 374 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 375 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.81 |
| Metatranscriptomes | 0.17 |
| Isolates | 15.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 33.11 |
| Nodule | 0.85 |
| Rhizoplane | 3.41 |
| Rhizosphere | 48.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1018016 | 3300001915 | Bacteria | 1133 |
| 2 | JGI24740J21852_10005909 | 3300001979 | Bacteria | 5130 |
| 3 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 4 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 5 | JGI25154J39366_1000144 | 3300002738 | Bacteria | 55903 |
| 6 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 7 | JGI25159J45721_1000982 | 3300002987 | Bacteria | 12319 |
| 8 | JGI25159J45721_1006405 | 3300002987 | Bacteria | 3529 |
| 9 | JGI25153J46596_10045169 | 3300003215 | Bacteria | 1317 |
| 10 | JGI25160J50197_1000149 | 3300003354 | Bacteria | 61868 |
| 11 | JGI25161J50226_1000149 | 3300003374 | Bacteria | 48658 |
| 12 | JGI25161J50226_1000177 | 3300003374 | Bacteria | 42668 |
| 13 | JGI25161J50226_1002972 | 3300003374 | Bacteria | 4084 |
| 14 | JGI25161J50226_1006753 | 3300003374 | Bacteria | 2028 |
| 15 | Ga0006562J51391_1054038 | 3300003578 | Bacteria | 5670 |
| 16 | Ga0055532_1001133 | 3300003758 | Bacteria | 8171 |
| 17 | Ga0055532_1007692 | 3300003758 | Bacteria | 1373 |
| 18 | Ga0055532_1007879 | 3300003758 | Bacteria | 1350 |
| 19 | Ga0055527_1000483 | 3300003760 | Bacteria | 14449 |
| 20 | Ga0055527_1000486 | 3300003760 | Bacteria | 14354 |
| 21 | Ga0055535_1001227 | 3300003761 | Bacteria | 14449 |
| 22 | Ga0055535_1001232 | 3300003761 | Bacteria | 14354 |
| 23 | Ga0055535_1001829 | 3300003761 | Bacteria | 9137 |
| 24 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 25 | Ga0055542_1001223 | 3300003762 | Bacteria | 14354 |
| 26 | Ga0055542_1001936 | 3300003762 | Bacteria | 8093 |
| 27 | Ga0055529_1000553 | 3300003763 | Bacteria | 31437 |
| 28 | Ga0055526_1000806 | 3300003771 | Bacteria | 23377 |
| 29 | Ga0055537_1000115 | 3300003773 | Bacteria | 60828 |
| 30 | Ga0055537_1000217 | 3300003773 | Bacteria | 42589 |
| 31 | Ga0055524_1000186 | 3300003775 | Bacteria | 69106 |
| 32 | Ga0055536_1001432 | 3300003781 | Bacteria | 14374 |
| 33 | Ga0055536_1004931 | 3300003781 | Bacteria | 6649 |
| 34 | Ga0055536_1033041 | 3300003781 | Bacteria | 1327 |
| 35 | Ga0055534_1000106 | 3300003784 | Bacteria | 63996 |
| 36 | Ga0055534_1001499 | 3300003784 | Bacteria | 9221 |
| 37 | Ga0055534_1001503 | 3300003784 | Bacteria | 9202 |
| 38 | Ga0055530_10000208 | 3300003791 | Bacteria | 53265 |
| 39 | Ga0055530_10014659 | 3300003791 | Bacteria | 2598 |
| 40 | Ga0055530_10017384 | 3300003791 | Bacteria | 2257 |
| 41 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 42 | Ga0055540_1000208 | 3300003792 | Bacteria | 56164 |
| 43 | Ga0055540_1023225 | 3300003792 | Bacteria | 1566 |
| 44 | Ga0055540_1023728 | 3300003792 | Bacteria | 1538 |
| 45 | Ga0055531_10000112 | 3300003794 | Bacteria | 89016 |
| 46 | Ga0055531_10024129 | 3300003794 | Bacteria | 2255 |
| 47 | Ga0055543_1000338 | 3300004625 | Bacteria | 32020 |
| 48 | Ga0055543_1001864 | 3300004625 | Bacteria | 7675 |
| 49 | Ga0065165_1010149 | 3300005262 | Bacteria | 4113 |
| 50 | Ga0065165_1017065 | 3300005262 | Bacteria | 2690 |
| 51 | Ga0065704_10139897 | 3300005289 | Bacteria | 1516 |
| 52 | Ga0070658_10042072 | 3300005327 | Bacteria | 3688 |
| 53 | Ga0070676_10153765 | 3300005328 | Bacteria | 1475 |
| 54 | Ga0070666_10245822 | 3300005335 | Bacteria | 1266 |
| 55 | Ga0070680_100042806 | 3300005336 | Bacteria | 3676 |
| 56 | Ga0068868_100225443 | 3300005338 | Bacteria | 1570 |
| 57 | Ga0070660_100000037 | 3300005339 | Bacteria | 77555 |
| 58 | Ga0070671_100008076 | 3300005355 | Bacteria | 8425 |
| 59 | Ga0070674_100063572 | 3300005356 | Bacteria | 2584 |
| 60 | Ga0070673_100306768 | 3300005364 | Bacteria | 1399 |
| 61 | Ga0070659_100000121 | 3300005366 | Bacteria | 58732 |
| 62 | Ga0070659_100226068 | 3300005366 | Bacteria | 1546 |
| 63 | Ga0070667_100021114 | 3300005367 | Bacteria | 5409 |
| 64 | Ga0070663_100041081 | 3300005455 | Bacteria | 3242 |
| 65 | Ga0070678_100006053 | 3300005456 | Bacteria | 7058 |
| 66 | Ga0068867_100126681 | 3300005459 | Bacteria | 1980 |
| 67 | Ga0070679_100002110 | 3300005530 | Bacteria | 17906 |
| 68 | Ga0070679_100007196 | 3300005530 | Bacteria | 10394 |
| 69 | Ga0068853_100048143 | 3300005539 | Bacteria | 3660 |
| 70 | Ga0068853_100262739 | 3300005539 | Bacteria | 1587 |
| 71 | Ga0070665_100049015 | 3300005548 | Bacteria | 4239 |
| 72 | Ga0070665_100183575 | 3300005548 | Bacteria | 2092 |
| 73 | Ga0070665_100533331 | 3300005548 | Bacteria | 1186 |
| 74 | Ga0068855_100001682 | 3300005563 | Bacteria | 27687 |
| 75 | Ga0068855_100059644 | 3300005563 | Bacteria | 4464 |
| 76 | Ga0068855_100229984 | 3300005563 | Bacteria | 2077 |
| 77 | Ga0068855_100262226 | 3300005563 | Bacteria | 1924 |
| 78 | Ga0070664_100030827 | 3300005564 | Bacteria | 4476 |
| 79 | Ga0068856_100242689 | 3300005614 | Bacteria | 1817 |
| 80 | Ga0068852_100055022 | 3300005616 | Bacteria | 3433 |
| 81 | Ga0068852_100090091 | 3300005616 | Bacteria | 2742 |
| 82 | Ga0068859_100456040 | 3300005617 | Bacteria | 1374 |
| 83 | Ga0068864_100077325 | 3300005618 | Bacteria | 2910 |
| 84 | Ga0068864_100137165 | 3300005618 | Bacteria | 2204 |
| 85 | Ga0068861_100058020 | 3300005719 | Bacteria | 2959 |
| 86 | Ga0068851_10004978 | 3300005834 | Bacteria | 6016 |
| 87 | Ga0068860_100067497 | 3300005843 | Bacteria | 3399 |
| 88 | Ga0068862_100021641 | 3300005844 | Bacteria | 5376 |
| 89 | Ga0068862_100058338 | 3300005844 | Bacteria | 3311 |
| 90 | Ga0068862_100386180 | 3300005844 | Bacteria | 1307 |
| 91 | Ga0075365_10006008 | 3300006038 | Bacteria | 6629 |
| 92 | Ga0075365_10112360 | 3300006038 | Bacteria | 1873 |
| 93 | Ga0075363_100034458 | 3300006048 | Bacteria | 2643 |
| 94 | Ga0075432_10020524 | 3300006058 | Bacteria | 2259 |
| 95 | Ga0075362_10018977 | 3300006177 | Bacteria | 2854 |
| 96 | Ga0075362_10053558 | 3300006177 | Bacteria | 1811 |
| 97 | Ga0075367_10017997 | 3300006178 | Bacteria | 3890 |
| 98 | Ga0075366_10001289 | 3300006195 | Bacteria | 12493 |
| 99 | Ga0075366_10001659 | 3300006195 | Bacteria | 11175 |
| 100 | Ga0075366_10002790 | 3300006195 | Bacteria | 9032 |
| 101 | Ga0075366_10044935 | 3300006195 | Bacteria | 2618 |
| 102 | Ga0075366_10047468 | 3300006195 | Bacteria | 2545 |
| 103 | Ga0075366_10050258 | 3300006195 | Bacteria | 2475 |
| 104 | Ga0097621_100182553 | 3300006237 | Bacteria | 1813 |
| 105 | Ga0075370_10001611 | 3300006353 | Bacteria | 9962 |
| 106 | Ga0075370_10003703 | 3300006353 | Bacteria | 7321 |
| 107 | Ga0075370_10039634 | 3300006353 | Bacteria | 2655 |
| 108 | Ga0068871_100065069 | 3300006358 | Bacteria | 2986 |
| 109 | Ga0075436_100267646 | 3300006914 | Bacteria | 1220 |
| 110 | Ga0097620_100456048 | 3300006931 | Bacteria | 1374 |
| 111 | Ga0099826_10019049 | 3300006948 | Bacteria | 5167 |
| 112 | Ga0099826_10218783 | 3300006948 | Bacteria | 1027 |
| 113 | Ga0105250_10003602 | 3300009092 | Bacteria | 7293 |
| 114 | Ga0105240_10006435 | 3300009093 | Bacteria | 17267 |
| 115 | Ga0105240_10133801 | 3300009093 | Bacteria | 2970 |
| 116 | Ga0105240_10247038 | 3300009093 | Bacteria | 2066 |
| 117 | Ga0105245_10024118 | 3300009098 | Bacteria | 5341 |
| 118 | Ga0105243_10003130 | 3300009148 | Bacteria | 13590 |
| 119 | Ga0105243_10081350 | 3300009148 | Bacteria | 2644 |
| 120 | Ga0105248_10004242 | 3300009177 | Bacteria | 15862 |
| 121 | Ga0105248_10362712 | 3300009177 | Bacteria | 1631 |
| 122 | Ga0105237_10065919 | 3300009545 | Bacteria | 3616 |
| 123 | Ga0105238_10005085 | 3300009551 | Bacteria | 13004 |
| 124 | Ga0105238_10071854 | 3300009551 | Bacteria | 3457 |
| 125 | Ga0105249_10203914 | 3300009553 | Bacteria | 1936 |
| 126 | Ga0105239_10043839 | 3300010375 | Bacteria | 4905 |
| 127 | Ga0105239_10337179 | 3300010375 | Bacteria | 1701 |
| 128 | Ga0157343_1003942 | 3300012488 | Bacteria | 896 |
| 129 | Ga0157326_1003322 | 3300012513 | Bacteria | 1694 |
| 130 | Ga0157373_10121768 | 3300013100 | Bacteria | 1834 |
| 131 | Ga0157370_10423524 | 3300013104 | Bacteria | 1225 |
| 132 | Ga0157369_10025878 | 3300013105 | Bacteria | 6509 |
| 133 | Ga0157378_10431660 | 3300013297 | Bacteria | 1304 |
| 134 | Ga0182008_10000070 | 3300014497 | Bacteria | 81986 |
| 135 | Ga0157379_10082217 | 3300014968 | Bacteria | 2886 |
| 136 | Ga0157379_10112290 | 3300014968 | Bacteria | 2449 |
| 137 | Ga0157376_10004660 | 3300014969 | Bacteria | 9558 |
| 138 | Ga0157376_10158068 | 3300014969 | Bacteria | 2052 |
| 139 | Ga0182007_10000289 | 3300015262 | Bacteria | 33181 |
| 140 | Ga0182005_1038226 | 3300015265 | Bacteria | 1305 |
| 141 | Ga0163161_10149356 | 3300017792 | Bacteria | 1775 |
| 142 | Ga0163161_10304929 | 3300017792 | Bacteria | 1255 |
| 143 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 144 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 145 | Ga0209436_104908 | 3300025208 | Bacteria | 3205 |
| 146 | Ga0209436_112451 | 3300025208 | Bacteria | 1443 |
| 147 | Ga0209566_101026 | 3300025225 | Bacteria | 11710 |
| 148 | Ga0209672_100033 | 3300025228 | Bacteria | 315326 |
| 149 | Ga0209672_100034 | 3300025228 | Bacteria | 304973 |
| 150 | Ga0209672_100504 | 3300025228 | Bacteria | 21657 |
| 151 | Ga0209147_100089 | 3300025229 | Bacteria | 178350 |
| 152 | Ga0209147_100191 | 3300025229 | Bacteria | 70769 |
| 153 | Ga0209147_100795 | 3300025229 | Bacteria | 15293 |
| 154 | Ga0209147_101268 | 3300025229 | Bacteria | 9874 |
| 155 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 156 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 157 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 158 | Ga0209258_100242 | 3300025242 | Bacteria | 100588 |
| 159 | Ga0207425_1000267 | 3300025245 | Bacteria | 38528 |
| 160 | Ga0207425_1001446 | 3300025245 | Bacteria | 9918 |
| 161 | Ga0207425_1002352 | 3300025245 | Bacteria | 6748 |
| 162 | Ga0207425_1002461 | 3300025245 | Bacteria | 6500 |
| 163 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 164 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 165 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 166 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 167 | Ga0209148_1001246 | 3300025254 | Bacteria | 14210 |
| 168 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 169 | Ga0209759_1002254 | 3300025256 | Bacteria | 8766 |
| 170 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 171 | Ga0209129_1003624 | 3300025258 | Bacteria | 6579 |
| 172 | Ga0209129_1005213 | 3300025258 | Bacteria | 4710 |
| 173 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 174 | Ga0209565_1000143 | 3300025263 | Bacteria | 99302 |
| 175 | Ga0209565_1000185 | 3300025263 | Bacteria | 76451 |
| 176 | Ga0209565_1000997 | 3300025263 | Bacteria | 14548 |
| 177 | Ga0209565_1003383 | 3300025263 | Bacteria | 5195 |
| 178 | Ga0209455_1000123 | 3300025272 | Bacteria | 167231 |
| 179 | Ga0209455_1000756 | 3300025272 | Bacteria | 18315 |
| 180 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 181 | Ga0209673_1000075 | 3300025273 | Bacteria | 232555 |
| 182 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 183 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 184 | Ga0209673_1000548 | 3300025273 | Bacteria | 60849 |
| 185 | Ga0209673_1000885 | 3300025273 | Bacteria | 38688 |
| 186 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 187 | Ga0209130_1000260 | 3300025284 | Bacteria | 66399 |
| 188 | Ga0209130_1000305 | 3300025284 | Bacteria | 59541 |
| 189 | Ga0209130_1000851 | 3300025284 | Bacteria | 25239 |
| 190 | Ga0209130_1002520 | 3300025284 | Bacteria | 9002 |
| 191 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 192 | Ga0209675_1000368 | 3300025291 | Bacteria | 38358 |
| 193 | Ga0209675_1000820 | 3300025291 | Bacteria | 20466 |
| 194 | Ga0209675_1002902 | 3300025291 | Bacteria | 8484 |
| 195 | Ga0209675_1002962 | 3300025291 | Bacteria | 8375 |
| 196 | Ga0209675_1003157 | 3300025291 | Bacteria | 8009 |
| 197 | Ga0209675_1005682 | 3300025291 | Bacteria | 5154 |
| 198 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 199 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 200 | Ga0209676_1001503 | 3300025292 | Bacteria | 21291 |
| 201 | Ga0209676_1002001 | 3300025292 | Bacteria | 16100 |
| 202 | Ga0209676_1007398 | 3300025292 | Bacteria | 5164 |
| 203 | Ga0209676_1013182 | 3300025292 | Bacteria | 3194 |
| 204 | Ga0209676_1017857 | 3300025292 | Bacteria | 2494 |
| 205 | Ga0209025_1000185 | 3300025294 | Bacteria | 155366 |
| 206 | Ga0209025_1000310 | 3300025294 | Bacteria | 108186 |
| 207 | Ga0209025_1000474 | 3300025294 | Bacteria | 78060 |
| 208 | Ga0209025_1001798 | 3300025294 | Bacteria | 25444 |
| 209 | Ga0209025_1009542 | 3300025294 | Bacteria | 6741 |
| 210 | Ga0209025_1012137 | 3300025294 | Bacteria | 5566 |
| 211 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 212 | Ga0209564_1000435 | 3300025295 | Bacteria | 72434 |
| 213 | Ga0209564_1000629 | 3300025295 | Bacteria | 53834 |
| 214 | Ga0209564_1001509 | 3300025295 | Bacteria | 23296 |
| 215 | Ga0209564_1005185 | 3300025295 | Bacteria | 7556 |
| 216 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 217 | Ga0209758_1005051 | 3300025297 | Bacteria | 10479 |
| 218 | Ga0209758_1011657 | 3300025297 | Bacteria | 5055 |
| 219 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 220 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 221 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 222 | Ga0209050_1001718 | 3300025298 | Bacteria | 21856 |
| 223 | Ga0209050_1001887 | 3300025298 | Bacteria | 20109 |
| 224 | Ga0209050_1007741 | 3300025298 | Bacteria | 5928 |
| 225 | Ga0209050_1009957 | 3300025298 | Bacteria | 4767 |
| 226 | Ga0209050_1021084 | 3300025298 | Bacteria | 2392 |
| 227 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 228 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 229 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 230 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 231 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 232 | Ga0207426_1000320 | 3300025302 | Bacteria | 92467 |
| 233 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 234 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 235 | Ga0209051_1000235 | 3300025303 | Bacteria | 92799 |
| 236 | Ga0209051_1000985 | 3300025303 | Bacteria | 27542 |
| 237 | Ga0209051_1002215 | 3300025303 | Bacteria | 14351 |
| 238 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 239 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 240 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 241 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 242 | Ga0209257_1011116 | 3300025304 | Bacteria | 4396 |
| 243 | Ga0209257_1023951 | 3300025304 | Bacteria | 2129 |
| 244 | Ga0209257_1037541 | 3300025304 | Bacteria | 1476 |
| 245 | Ga0207656_10015115 | 3300025321 | Bacteria | 2984 |
| 246 | Ga0207655_1001822 | 3300025728 | Bacteria | 18437 |
| 247 | Ga0207647_10002981 | 3300025904 | Bacteria | 12741 |
| 248 | Ga0207705_10044566 | 3300025909 | Bacteria | 3187 |
| 249 | Ga0207707_10115590 | 3300025912 | Bacteria | 2345 |
| 250 | Ga0207695_10001130 | 3300025913 | Bacteria | 46252 |
| 251 | Ga0207695_10122107 | 3300025913 | Bacteria | 2572 |
| 252 | Ga0207671_10012673 | 3300025914 | Bacteria | 6765 |
| 253 | Ga0207657_10000098 | 3300025919 | Bacteria | 83552 |
| 254 | Ga0207649_10401289 | 3300025920 | Bacteria | 1026 |
| 255 | Ga0207650_10171448 | 3300025925 | Bacteria | 1725 |
| 256 | Ga0207650_10418240 | 3300025925 | Bacteria | 1112 |
| 257 | Ga0207664_10117144 | 3300025929 | Bacteria | 2224 |
| 258 | Ga0207644_10002501 | 3300025931 | Bacteria | 11832 |
| 259 | Ga0207644_10093394 | 3300025931 | Bacteria | 2246 |
| 260 | Ga0207690_10000055 | 3300025932 | Bacteria | 102536 |
| 261 | Ga0207706_10032308 | 3300025933 | Bacteria | 4662 |
| 262 | Ga0207709_10000215 | 3300025935 | Bacteria | 73474 |
| 263 | Ga0207709_10004503 | 3300025935 | Bacteria | 8039 |
| 264 | Ga0207709_10035882 | 3300025935 | Bacteria | 2935 |
| 265 | Ga0207691_10062589 | 3300025940 | Bacteria | 3375 |
| 266 | Ga0207711_10290896 | 3300025941 | Bacteria | 1506 |
| 267 | Ga0207667_10053384 | 3300025949 | Bacteria | 4253 |
| 268 | Ga0207667_10135943 | 3300025949 | Bacteria | 2531 |
| 269 | Ga0207651_10255054 | 3300025960 | Bacteria | 1437 |
| 270 | Ga0207639_10034938 | 3300026041 | Bacteria | 3718 |
| 271 | Ga0207678_10000238 | 3300026067 | Bacteria | 49410 |
| 272 | Ga0207702_10154399 | 3300026078 | Bacteria | 2091 |
| 273 | Ga0207702_10205774 | 3300026078 | Bacteria | 1827 |
| 274 | Ga0207641_10173452 | 3300026088 | Bacteria | 1970 |
| 275 | Ga0207648_10073604 | 3300026089 | Bacteria | 2977 |
| 276 | Ga0207648_10079811 | 3300026089 | Bacteria | 2854 |
| 277 | Ga0207683_10036652 | 3300026121 | Bacteria | 4272 |
| 278 | Ga0207698_10002821 | 3300026142 | Bacteria | 10400 |
| 279 | Ga0209371_1001116 | 3300027312 | Bacteria | 19849 |
| 280 | Ga0209282_1018296 | 3300027666 | Bacteria | 4447 |
| 281 | Ga0209974_10007016 | 3300027876 | Bacteria | 3899 |
| 282 | Ga0209974_10032851 | 3300027876 | Bacteria | 1720 |
| 283 | Ga0207428_10093873 | 3300027907 | Bacteria | 2327 |
| 284 | Ga0268266_10034388 | 3300028379 | Bacteria | 4310 |
| 285 | Ga0268265_10061117 | 3300028380 | Bacteria | 2890 |
| 286 | Ga0268264_10387656 | 3300028381 | Bacteria | 1339 |
| 287 | Ga0307517_10091072 | 3300028786 | Bacteria | 2495 |
| 288 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 289 | Ga0307515_10003296 | 3300028794 | Bacteria | 34132 |
| 290 | Ga0307515_10121895 | 3300028794 | Bacteria | 2946 |
| 291 | Ga0307515_10244391 | 3300028794 | Bacteria | 1559 |
| 292 | Ga0307515_10263510 | 3300028794 | Bacteria | 1456 |
| 293 | Ga0268256_1000946 | 3300030500 | Bacteria | 19849 |
| 294 | Ga0316176_1136684 | 3300030732 | Bacteria | 2876 |
| 295 | Ga0316178_1136766 | 3300030735 | Bacteria | 3913 |
| 296 | Ga0316183_1004302 | 3300030742 | Bacteria | 3261 |
| 297 | Ga0316181_1021652 | 3300030744 | Bacteria | 2484 |
| 298 | Ga0316182_1070586 | 3300030745 | Bacteria | 3188 |
| 299 | Ga0265329_10015932 | 3300031242 | Bacteria | 2616 |
| 300 | Ga0265331_10001420 | 3300031250 | Bacteria | 17582 |
| 301 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 302 | Ga0265327_10075923 | 3300031251 | Bacteria | 1671 |
| 303 | Ga0307513_10000064 | 3300031456 | Bacteria | 141845 |
| 304 | Ga0307513_10036523 | 3300031456 | Bacteria | 5479 |
| 305 | Ga0307513_10077353 | 3300031456 | Bacteria | 3446 |
| 306 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 307 | Ga0307408_100110292 | 3300031548 | Bacteria | 2112 |
| 308 | Ga0307408_100169177 | 3300031548 | Bacteria | 1743 |
| 309 | Ga0307408_100201790 | 3300031548 | Bacteria | 1610 |
| 310 | Ga0307514_10000641 | 3300031649 | Bacteria | 63711 |
| 311 | Ga0307514_10024525 | 3300031649 | Bacteria | 4882 |
| 312 | Ga0265314_10001279 | 3300031711 | Bacteria | 28615 |
| 313 | Ga0265314_10048181 | 3300031711 | Bacteria | 2992 |
| 314 | Ga0265342_10040873 | 3300031712 | Bacteria | 2810 |
| 315 | Ga0265342_10164581 | 3300031712 | Bacteria | 1224 |
| 316 | Ga0307516_10003024 | 3300031730 | Bacteria | 21938 |
| 317 | Ga0307516_10008873 | 3300031730 | Bacteria | 11285 |
| 318 | Ga0307406_10001114 | 3300031901 | Bacteria | 14991 |
| 319 | Ga0307406_10370817 | 3300031901 | Bacteria | 1125 |
| 320 | Ga0307412_10041871 | 3300031911 | Bacteria | 2971 |
| 321 | Ga0307409_100406717 | 3300031995 | Bacteria | 1302 |
| 322 | Ga0307409_100521335 | 3300031995 | Bacteria | 1161 |
| 323 | Ga0307416_100730581 | 3300032002 | Bacteria | 1081 |
| 324 | Ga0307414_10023610 | 3300032004 | Bacteria | 3904 |
| 325 | Ga0307414_10050258 | 3300032004 | Bacteria | 2887 |
| 326 | Ga0307414_10108395 | 3300032004 | Bacteria | 2107 |
| 327 | Ga0307414_10487371 | 3300032004 | Bacteria | 1088 |
| 328 | Ga0307414_10659947 | 3300032004 | Bacteria | 943 |
| 329 | Ga0307411_10085391 | 3300032005 | Bacteria | 2186 |
| 330 | Ga0373940_0003724 | 3300035088 | Bacteria | 3145 |
| 331 | Ga0373939_0000140 | 3300035114 | Bacteria | 20643 |
| 332 | Ga0373931_0000353 | 3300035691 | Bacteria | 18867 |
| 333 | Ga0373937_0696094 | 3300036401 | Bacteria | 963 |
| 334 | Ga0395899_0011767 | 3300037312 | Bacteria | 6696 |
| 335 | Ga0395899_0044197 | 3300037312 | Bacteria | 3321 |
| 336 | Ga0395900_0029407 | 3300037418 | Bacteria | 5636 |
| 337 | Ga0395900_0059608 | 3300037418 | Bacteria | 3930 |
| 338 | Ga0395898_0003443 | 3300037466 | Bacteria | 17693 |
| 339 | Ga0395898_0018549 | 3300037466 | Bacteria | 7093 |
| 340 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 341 | Ga0395905_0005270 | 3300037471 | Bacteria | 13222 |
| 342 | Ga0395905_0040202 | 3300037471 | Bacteria | 4386 |
| 343 | Ga0395905_0042923 | 3300037471 | Bacteria | 4243 |
| 344 | Ga0395905_0051564 | 3300037471 | Bacteria | 3854 |
| 345 | Ga0395901_0033252 | 3300038443 | Bacteria | 5322 |
| 346 | Ga0395901_0066417 | 3300038443 | Bacteria | 3757 |
| 347 | Ga0436365_0238213 | 3300039437 | Bacteria | 3310 |
| 348 | Ga0436361_0260800 | 3300039447 | Bacteria | 1516 |
| 349 | Ga0436361_0812713 | 3300039447 | Bacteria | 39089 |
| 350 | Ga0439436_0001226 | 3300041404 | Bacteria | 7308 |
| 351 | Ga0439436_0014006 | 3300041404 | Bacteria | 2424 |
| 352 | Ga0439466_0004836 | 3300041411 | Bacteria | 5179 |
| 353 | Ga0439466_0010808 | 3300041411 | Bacteria | 3389 |
| 354 | Ga0439465_0001421 | 3300041413 | Bacteria | 7746 |
| 355 | Ga0439431_0000611 | 3300041997 | Bacteria | 7582 |
| 356 | Ga0439433_0000817 | 3300041999 | Bacteria | 6169 |
| 357 | Ga0439442_005071 | 3300042002 | Bacteria | 2633 |
| 358 | Ga0439445_0001029 | 3300042004 | Bacteria | 5942 |
| 359 | Ga0439432_001181 | 3300042006 | Bacteria | 9880 |
| 360 | Ga0439449_0000581 | 3300042007 | Bacteria | 13701 |
| 361 | Ga0439449_0002198 | 3300042007 | Bacteria | 7679 |
| 362 | Ga0439449_0026391 | 3300042007 | Bacteria | 2168 |
| 363 | Ga0439452_012398 | 3300042010 | Bacteria | 2427 |
| 364 | Ga0439457_010018 | 3300042014 | Bacteria | 2191 |
| 365 | Ga0439462_0000785 | 3300042015 | Bacteria | 6603 |
| 366 | Ga0439462_0005369 | 3300042015 | Bacteria | 3157 |
| 367 | Ga0450917_000004 | 3300042120 | Bacteria | 9152 |
| 368 | Ga0450919_005461 | 3300042121 | Bacteria | 1526 |
| 369 | Ga0450920_005154 | 3300042122 | Bacteria | 2317 |
| 370 | Ga0450921_000038 | 3300042123 | Bacteria | 3362 |
| 371 | Ga0450923_041023 | 3300042125 | Bacteria | 972 |
| 372 | Ga0450891_000928 | 3300042129 | Bacteria | 3056 |
| 373 | Ga0450892_000986 | 3300042130 | Bacteria | 3027 |
| 374 | Ga0450894_003218 | 3300042131 | Bacteria | 2143 |
| 375 | Ga0450889_000148 | 3300042144 | Bacteria | 7104 |
| 376 | Ga0450906_004756 | 3300042145 | Bacteria | 2828 |
| 377 | Ga0439446_0000431 | 3300042156 | Bacteria | 8211 |
| 378 | Ga0439446_0026018 | 3300042156 | Bacteria | 1674 |
| 379 | Ga0450908_000667 | 3300042184 | Bacteria | 6605 |
| 380 | Ga0439434_0010056 | 3300042435 | Bacteria | 2786 |
| 381 | Ga0450918_001718 | 3300042531 | Bacteria | 4262 |
| 382 | Ga0450893_0001655 | 3300042532 | Bacteria | 3430 |
| 383 | Ga0450893_0002199 | 3300042532 | Bacteria | 3036 |
| 384 | Ga0450893_0007459 | 3300042532 | Bacteria | 1778 |
| 385 | Ga0451577_0013885 | 3300042876 | Bacteria | 7522 |
| 386 | Ga0451577_0087490 | 3300042876 | Bacteria | 2779 |
| 387 | Ga0451577_0341639 | 3300042876 | Bacteria | 1358 |
| 388 | Ga0466965_0008623 | 3300044683 | Bacteria | 4717 |
| 389 | Ga0466961_0079017 | 3300044693 | Bacteria | 2083 |
| 390 | Ga0453684_0006446 | 3300044712 | Bacteria | 22283 |
| 391 | Ga0453684_0207043 | 3300044712 | Bacteria | 2282 |
| 392 | Ga0453684_0330275 | 3300044712 | Bacteria | 1724 |
| 393 | Ga0453684_0342741 | 3300044712 | Bacteria | 1687 |
| 394 | Ga0466960_0019788 | 3300044901 | Bacteria | 2972 |
| 395 | Ga0466959_0241873 | 3300045049 | Bacteria | 1246 |
| 396 | Ga0451576_0003864 | 3300045051 | Bacteria | 20090 |
| 397 | Ga0451576_0352393 | 3300045051 | Bacteria | 1541 |
| 398 | Ga0495627_016496 | 3300046453 | Bacteria | 2527 |
| 399 | Ga0495650_0001967 | 3300046471 | Bacteria | 18141 |
| 400 | Ga0495639_0002555 | 3300046475 | Bacteria | 7936 |
| 401 | Ga0495607_0000480 | 3300046501 | Bacteria | 39938 |
| 402 | Ga0495610_0047230 | 3300046512 | Bacteria | 2119 |
| 403 | Ga0495610_0051200 | 3300046512 | Bacteria | 2011 |
| 404 | Ga0495620_0013399 | 3300046515 | Bacteria | 4198 |
| 405 | Ga0495631_0000123 | 3300046518 | Bacteria | 51897 |
| 406 | Ga0495648_0138357 | 3300046524 | Bacteria | 1285 |
| 407 | Ga0495642_0038313 | 3300046528 | Bacteria | 1942 |
| 408 | Ga0495621_0006963 | 3300046539 | Bacteria | 3327 |
| 409 | Ga0495633_0000458 | 3300046558 | Bacteria | 41814 |
| 410 | Ga0495656_0034791 | 3300046615 | Bacteria | 2065 |
| 411 | Ga0495656_0067992 | 3300046615 | Bacteria | 1574 |
| 412 | Ga0495625_0000661 | 3300046660 | Bacteria | 49248 |
| 413 | Ga0495625_0052337 | 3300046660 | Bacteria | 2924 |
| 414 | Ga0495588_0041143 | 3300046674 | Bacteria | 2359 |
| 415 | Ga0495670_0094728 | 3300046691 | Bacteria | 1531 |
| 416 | Ga0495671_0101776 | 3300046692 | Bacteria | 1404 |
| 417 | Ga0495660_0073063 | 3300046810 | Bacteria | 1815 |
| 418 | Ga0495676_0228971 | 3300047321 | Bacteria | 1277 |
| 419 | Ga0495593_0035411 | 3300047673 | Bacteria | 2711 |
| 420 | Ga0496100_0019529 | 3300048903 | Bacteria | 4045 |
| 421 | Ga0496101_0008376 | 3300048904 | Bacteria | 6756 |
| 422 | Ga0496101_0015984 | 3300048904 | Bacteria | 5064 |
| 423 | Ga0496102_0004638 | 3300048905 | Bacteria | 11630 |
| 424 | Ga0496102_0078740 | 3300048905 | Bacteria | 3035 |
| 425 | Ga0496103_0112725 | 3300048906 | Bacteria | 1728 |
| 426 | Ga0496104_0002111 | 3300048907 | Bacteria | 17262 |
| 427 | Ga0496104_0031140 | 3300048907 | Bacteria | 4960 |
| 428 | Ga0496107_0102781 | 3300048910 | Bacteria | 2096 |
| 429 | Ga0496110_0130673 | 3300048913 | Bacteria | 2267 |
| 430 | Ga0496113_0185745 | 3300048916 | Bacteria | 1649 |
| 431 | Ga0496113_0230364 | 3300048916 | Bacteria | 1477 |
| 432 | Ga0496114_0125020 | 3300048917 | Bacteria | 2216 |
| 433 | Ga0496116_0098545 | 3300048919 | Bacteria | 1753 |
| 434 | Ga0496117_0021380 | 3300048920 | Bacteria | 5237 |
| 435 | Ga0496117_0050367 | 3300048920 | Bacteria | 2953 |
| 436 | Ga0496117_0081878 | 3300048920 | Bacteria | 2116 |
| 437 | Ga0496118_0136960 | 3300048921 | Bacteria | 1560 |
| 438 | Ga0496122_0000204 | 3300048925 | Bacteria | 132123 |
| 439 | Ga0496123_0001226 | 3300048926 | Bacteria | 37377 |
| 440 | Ga0496123_0055090 | 3300048926 | Bacteria | 2611 |
| 441 | Ga0496123_0222030 | 3300048926 | Bacteria | 952 |
| 442 | Ga0496124_0094008 | 3300048927 | Bacteria | 2439 |
| 443 | Ga0496124_0117231 | 3300048927 | Bacteria | 2133 |
| 444 | Ga0496125_0002426 | 3300048928 | Bacteria | 24246 |
| 445 | Ga0496125_0033202 | 3300048928 | Bacteria | 4572 |
| 446 | Ga0496126_0010476 | 3300048929 | Bacteria | 9711 |
| 447 | Ga0501031_0148380 | 3300049568 | Bacteria | 1532 |
| 448 | Ga0501034_0061426 | 3300049571 | Bacteria | 3773 |
| 449 | Ga0501034_0223754 | 3300049571 | Bacteria | 1833 |
| 450 | Ga0501034_0315329 | 3300049571 | Bacteria | 1497 |
| 451 | Ga0501038_0285026 | 3300049574 | Bacteria | 1299 |
| 452 | Ga0501039_0092947 | 3300049575 | Bacteria | 2351 |
| 453 | Ga0501047_0095318 | 3300049581 | Bacteria | 2855 |
| 454 | Ga0501076_0085483 | 3300049592 | Bacteria | 2535 |
| 455 | Ga0501035_0128669 | 3300049822 | Bacteria | 2209 |
| 456 | Ga0501035_0228395 | 3300049822 | Bacteria | 1587 |
| 457 | Ga0501035_0420788 | 3300049822 | Bacteria | 1109 |
| 458 | Ga0501044_0006926 | 3300049823 | Bacteria | 12479 |
| 459 | Ga0501045_0072768 | 3300049824 | Bacteria | 2531 |
| 460 | nmdc:mga03683_190646_c1 | 3300050489 | Bacteria | 938 |
| 461 | nmdc:mga03n38_53415_c1 | 3300050490 | Bacteria | 1812 |
| 462 | nmdc:mga00v17_44916_c1 | 3300050491 | Bacteria | 2667 |
| 463 | nmdc:mga0yw44_36273_c1 | 3300050492 | Bacteria | 2905 |
| 464 | nmdc:mga0k408_108688_c1 | 3300050493 | Bacteria | 1638 |
| 465 | nmdc:mga0k408_13895_c1 | 3300050493 | Bacteria | 4425 |
| 466 | nmdc:mga0k408_194977_c1 | 3300050493 | Bacteria | 1209 |
| 467 | nmdc:mga0k408_25013_c1 | 3300050493 | Bacteria | 3379 |
| 468 | nmdc:mga0k408_31573_c2 | 3300050493 | Bacteria | 1094 |
| 469 | nmdc:mga0k408_60015_c1 | 3300050493 | Bacteria | 2210 |
| 470 | nmdc:mga0k408_62154_c1 | 3300050493 | Bacteria | 2171 |
| 471 | nmdc:mga0k408_95453_c1 | 3300050493 | Bacteria | 1750 |
| 472 | nmdc:mga07m45_141636_c1 | 3300050496 | Bacteria | 1393 |
| 473 | nmdc:mga07m45_1804_c1 | 3300050496 | Bacteria | 9867 |
| 474 | nmdc:mga07m45_2760_c1 | 3300050496 | Bacteria | 8285 |
| 475 | nmdc:mga07m45_3914_c1 | 3300050496 | Bacteria | 7236 |
| 476 | nmdc:mga0sz30_186446_c1 | 3300050516 | Bacteria | 921 |
| 477 | Ga0500646_0026432 | 3300053090 | Bacteria | 1573 |
| 478 | Ga0500651_0000587 | 3300053093 | Bacteria | 18283 |
| 479 | Ga0500562_009992 | 3300053108 | Bacteria | 2401 |
| 480 | Ga0500571_000163 | 3300053110 | Bacteria | 23380 |
| 481 | Ga0500593_006394 | 3300053117 | Bacteria | 4711 |
| 482 | Ga0500593_008058 | 3300053117 | Bacteria | 4316 |
| 483 | Ga0500607_007342 | 3300053121 | Bacteria | 6828 |
| 484 | Ga0500608_017874 | 3300053122 | Bacteria | 3228 |
| 485 | Ga0500618_029850 | 3300053125 | Bacteria | 1285 |
| 486 | Ga0500626_038011 | 3300053128 | Bacteria | 2177 |
| 487 | Ga0500655_006237 | 3300053133 | Bacteria | 2147 |
| 488 | Ga0500658_0000314 | 3300053134 | Bacteria | 21651 |
| 489 | Ga0500658_0000476 | 3300053134 | Bacteria | 17115 |
| 490 | Ga0500559_0018106 | 3300053136 | Bacteria | 2977 |
| 491 | Ga0500568_0001888 | 3300053139 | Bacteria | 12905 |
| 492 | Ga0500574_002257 | 3300053141 | Bacteria | 3129 |
| 493 | Ga0500616_0005383 | 3300053153 | Bacteria | 8700 |
| 494 | Ga0500622_0066694 | 3300053156 | Bacteria | 1827 |
| 495 | Ga0500627_0000392 | 3300053158 | Bacteria | 11733 |
| 496 | Ga0500634_0054341 | 3300053161 | Bacteria | 2146 |
| 497 | Ga0500638_007950 | 3300053162 | Bacteria | 4485 |
| 498 | Ga0500645_004482 | 3300053730 | Bacteria | 5345 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025931 | Ga0207644_10002501 | Ga0207644_100025016 | 255 |
| 2 | 3300005336 | Ga0070680_100042806 | Ga0070680_1000428062 | 257 |
| 3 | 3300005530 | Ga0070679_100002110 | Ga0070679_10000211015 | 257 |
| 4 | 3300025912 | Ga0207707_10115590 | Ga0207707_101155902 | 257 |
| 5 | 3300049571 | Ga0501034_0223754 | Ga0501034_0223754_775_1578 | 260 |
| 6 | 3300049571 | Ga0501034_0315329 | Ga0501034_0315329_439_1242 | 260 |
| 7 | 3300049574 | Ga0501038_0285026 | Ga0501038_0285026_48_851 | 260 |
| 8 | iso_pu_bacteria | 2643221585 | 2643933137 | 261 |
| 9 | iso_pu_bacteria | 2643221656 | 2644314386 | 261 |
| 10 | 3300049822 | Ga0501035_0128669 | Ga0501035_0128669_881_1690 | 262 |
| 11 | 3300036401 | Ga0373937_0696094 | Ga0373937_0696094_106_909 | 263 |
| 12 | 3300031995 | Ga0307409_100406717 | Ga0307409_1004067172 | 264 |
| 13 | 3300005456 | Ga0070678_100006053 | Ga0070678_1000060539 | 265 |
| 14 | 3300031456 | Ga0307513_10000064 | Ga0307513_1000006492 | 265 |
| 15 | 3300031548 | Ga0307408_100201790 | Ga0307408_1002017903 | 265 |
| 16 | 3300031730 | Ga0307516_10003024 | Ga0307516_1000302413 | 265 |
| 17 | 3300046512 | Ga0495610_0051200 | Ga0495610_0051200_240_1037 | 265 |
| 18 | 3300046515 | Ga0495620_0013399 | Ga0495620_0013399_1758_2555 | 265 |
| 19 | 3300046674 | Ga0495588_0041143 | Ga0495588_0041143_601_1398 | 265 |
| 20 | 3300046691 | Ga0495670_0094728 | Ga0495670_0094728_709_1506 | 265 |
| 21 | 3300050516 | nmdc:mga0sz30_186446_c1 | nmdc:mga0sz30_186446_c1_18_815 | 265 |
| 22 | 3300053117 | Ga0500593_006394 | Ga0500593_006394_3878_4675 | 265 |
| 23 | 3300053161 | Ga0500634_0054341 | Ga0500634_0054341_1029_1826 | 265 |
| 24 | 3300039447 | Ga0436361_0260800 | Ga0436361_0260800_220_1026 | 267 |
| 25 | 3300021361 | Ga0213872_10000070 | Ga0213872_1000007075 | 268 |
| 26 | 3300039447 | Ga0436361_0812713 | Ga0436361_0812713_37451_38266 | 268 |
| 27 | 3300046528 | Ga0495642_0038313 | Ga0495642_0038313_1051_1905 | 268 |
| 28 | 3300012488 | Ga0157343_1003942 | Ga0157343_10039421 | 270 |
| 29 | 3300048926 | Ga0496123_0055090 | Ga0496123_0055090_1551_2480 | 270 |
| 30 | 3300048928 | Ga0496125_0002426 | Ga0496125_0002426_8340_9269 | 270 |
| 31 | 3300048929 | Ga0496126_0010476 | Ga0496126_0010476_5314_6243 | 270 |
| 32 | 3300032004 | Ga0307414_10050258 | Ga0307414_100502582 | 272 |
| 33 | iso_pu_bacteria | 2643221639 | 2644217280 | 272 |
| 34 | iso_pu_bacteria | 2643221646 | 2644258949 | 272 |
| 35 | iso_pu_bacteria | 2738541337 | 2739055686 | 272 |
| 36 | iso_pu_bacteria | 8002392321 | 8002395643 | 272 |
| 37 | 3300028794 | Ga0307515_10244391 | Ga0307515_102443912 | 273 |
| 38 | 3300031456 | Ga0307513_10077353 | Ga0307513_100773533 | 273 |
| 39 | iso_pu_bacteria | 8048746797 | 8048747257 | 273 |
| 40 | 3300005844 | Ga0068862_100021641 | Ga0068862_1000216414 | 274 |
| 41 | 3300028786 | Ga0307517_10091072 | Ga0307517_100910722 | 274 |
| 42 | 3300031250 | Ga0265331_10001420 | Ga0265331_100014207 | 274 |
| 43 | 3300031251 | Ga0265327_10000028 | Ga0265327_1000002887 | 274 |
| 44 | 3300031730 | Ga0307516_10008873 | Ga0307516_1000887310 | 274 |
| 45 | iso_pu_bacteria | 2513020051 | 2513231292 | 274 |
| 46 | iso_pu_bacteria | 2599185214 | 2599623340 | 274 |
| 47 | iso_pu_bacteria | 2599185226 | 2599675442 | 274 |
| 48 | iso_pu_bacteria | 2599185227 | 2599680945 | 274 |
| 49 | iso_pu_bacteria | 2599185229 | 2599692960 | 274 |
| 50 | iso_pu_bacteria | 2643221544 | 2643746386 | 274 |
| 51 | iso_pu_bacteria | 2643221628 | 2644161896 | 274 |
| 52 | iso_pu_bacteria | 2643221658 | 2644325501 | 274 |
| 53 | iso_pu_bacteria | 2643221672 | 2644399225 | 274 |
| 54 | iso_pu_bacteria | 2643221683 | 2644467091 | 274 |
| 55 | iso_pu_bacteria | 2738541277 | 2738718249 | 274 |
| 56 | iso_pu_bacteria | 2738541307 | 2738882626 | 274 |
| 57 | iso_pu_bacteria | 2738543019 | 2739281436 | 274 |
| 58 | iso_pu_bacteria | 2818991446 | 2819600516 | 274 |
| 59 | iso_pu_bacteria | 2831265667 | 2831267758 | 274 |
| 60 | iso_pu_bacteria | 2838054893 | 2838061514 | 274 |
| 61 | iso_pu_bacteria | 2842677519 | 2842677583 | 274 |
| 62 | iso_pu_bacteria | 2885198086 | 2885198773 | 274 |
| 63 | iso_pu_bacteria | 2885211737 | 2885211847 | 274 |
| 64 | iso_pu_bacteria | 2899924645 | 2899928337 | 274 |
| 65 | iso_pu_bacteria | 2904449895 | 2904451873 | 274 |
| 66 | iso_pu_bacteria | 2904456579 | 2904462470 | 274 |
| 67 | iso_pu_bacteria | 2919462493 | 2919467143 | 274 |
| 68 | iso_pu_bacteria | 2928037797 | 2928041289 | 274 |
| 69 | iso_pu_bacteria | 2928044640 | 2928048131 | 274 |
| 70 | iso_pu_bacteria | 2928051484 | 2928055972 | 274 |
| 71 | iso_pu_bacteria | 2928064002 | 2928066547 | 274 |
| 72 | iso_pu_bacteria | 2928070936 | 2928077299 | 274 |
| 73 | iso_pu_bacteria | 2928084124 | 2928087600 | 274 |
| 74 | iso_pu_bacteria | 2929520902 | 2929523583 | 274 |
| 75 | iso_pu_bacteria | 2945945610 | 2945946175 | 274 |
| 76 | iso_pu_bacteria | 2945972063 | 2945975775 | 274 |
| 77 | 3300005614 | Ga0068856_100242689 | Ga0068856_1002426893 | 275 |
| 78 | 3300006177 | Ga0075362_10018977 | Ga0075362_100189772 | 275 |
| 79 | 3300025292 | Ga0209676_1002001 | Ga0209676_10020019 | 275 |
| 80 | 3300025294 | Ga0209025_1012137 | Ga0209025_10121374 | 275 |
| 81 | 3300026078 | Ga0207702_10205774 | Ga0207702_102057742 | 275 |
| 82 | 3300049581 | Ga0501047_0095318 | Ga0501047_0095318_669_1523 | 275 |
| 83 | 3300049823 | Ga0501044_0006926 | Ga0501044_0006926_2007_2861 | 275 |
| 84 | iso_pu_bacteria | 2904479285 | 2904481729 | 275 |
| 85 | iso_pu_bacteria | 2904541872 | 2904545070 | 275 |
| 86 | iso_pu_bacteria | 2929160207 | 2929165248 | 275 |
| 87 | iso_pu_bacteria | 2945909444 | 2945910147 | 275 |
| 88 | iso_pu_bacteria | 2945984333 | 2945987837 | 275 |
| 89 | iso_pu_bacteria | 2954767861 | 2954768775 | 275 |
| 90 | 3300006353 | Ga0075370_10039634 | Ga0075370_100396343 | 276 |
| 91 | 3300009148 | Ga0105243_10081350 | Ga0105243_100813503 | 276 |
| 92 | 3300009553 | Ga0105249_10203914 | Ga0105249_102039143 | 276 |
| 93 | 3300025298 | Ga0209050_1007741 | Ga0209050_10077412 | 276 |
| 94 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021537 | 276 |
| 95 | 3300025304 | Ga0209257_1023951 | Ga0209257_10239512 | 276 |
| 96 | 3300025935 | Ga0207709_10035882 | Ga0207709_100358823 | 276 |
| 97 | 3300028794 | Ga0307515_10121895 | Ga0307515_101218952 | 276 |
| 98 | 3300031548 | Ga0307408_100000160 | Ga0307408_1000001603 | 276 |
| 99 | 3300032004 | Ga0307414_10023610 | Ga0307414_100236102 | 276 |
| 100 | 3300042120 | Ga0450917_000004 | Ga0450917_000004_439_1269 | 276 |
| 101 | 3300042129 | Ga0450891_000928 | Ga0450891_000928_69_899 | 276 |
| 102 | 3300042130 | Ga0450892_000986 | Ga0450892_000986_1149_1979 | 276 |
| 103 | 3300042144 | Ga0450889_000148 | Ga0450889_000148_1060_1890 | 276 |
| 104 | 3300042532 | Ga0450893_0002199 | Ga0450893_0002199_166_996 | 276 |
| 105 | 3300044712 | Ga0453684_0330275 | Ga0453684_0330275_445_1281 | 276 |
| 106 | 3300049822 | Ga0501035_0420788 | Ga0501035_0420788_134_973 | 276 |
| 107 | 3300002987 | JGI25159J45721_1000982 | JGI25159J45721_10009824 | 277 |
| 108 | 3300003215 | JGI25153J46596_10045169 | JGI25153J46596_100451692 | 277 |
| 109 | 3300003354 | JGI25160J50197_1000149 | JGI25160J50197_100014924 | 277 |
| 110 | 3300003374 | JGI25161J50226_1000149 | JGI25161J50226_100014912 | 277 |
| 111 | 3300003374 | JGI25161J50226_1000177 | JGI25161J50226_100017724 | 277 |
| 112 | 3300004625 | Ga0055543_1000338 | Ga0055543_100033821 | 277 |
| 113 | 3300005459 | Ga0068867_100126681 | Ga0068867_1001266813 | 277 |
| 114 | 3300006914 | Ga0075436_100267646 | Ga0075436_1002676462 | 277 |
| 115 | 3300014497 | Ga0182008_10000070 | Ga0182008_1000007060 | 277 |
| 116 | 3300025208 | Ga0209436_112451 | Ga0209436_1124512 | 277 |
| 117 | 3300025245 | Ga0207425_1001446 | Ga0207425_10014467 | 277 |
| 118 | 3300025263 | Ga0209565_1000997 | Ga0209565_10009972 | 277 |
| 119 | 3300025284 | Ga0209130_1000072 | Ga0209130_1000072140 | 277 |
| 120 | 3300025291 | Ga0209675_1003157 | Ga0209675_10031572 | 277 |
| 121 | 3300025297 | Ga0209758_1005051 | Ga0209758_10050515 | 277 |
| 122 | 3300025298 | Ga0209050_1001887 | Ga0209050_100188710 | 277 |
| 123 | 3300025302 | Ga0207426_1000320 | Ga0207426_100032055 | 277 |
| 124 | 3300026089 | Ga0207648_10079811 | Ga0207648_100798112 | 277 |
| 125 | 3300032004 | Ga0307414_10108395 | Ga0307414_101083952 | 277 |
| 126 | 3300046539 | Ga0495621_0006963 | Ga0495621_0006963_885_1721 | 277 |
| 127 | 3300048916 | Ga0496113_0185745 | Ga0496113_0185745_336_1172 | 277 |
| 128 | 3300050493 | nmdc:mga0k408_60015_c1 | nmdc:mga0k408_60015_c1_1354_2199 | 277 |
| 129 | iso_pu_bacteria | 2842733646 | 2842736316 | 277 |
| 130 | iso_pu_bacteria | 2842747753 | 2842748827 | 277 |
| 131 | iso_pu_bacteria | 2881101125 | 2881103053 | 277 |
| 132 | 3300001979 | JGI24740J21852_10005909 | JGI24740J21852_100059096 | 278 |
| 133 | 3300003374 | JGI25161J50226_1002972 | JGI25161J50226_10029724 | 278 |
| 134 | 3300003374 | JGI25161J50226_1006753 | JGI25161J50226_10067532 | 278 |
| 135 | 3300003578 | Ga0006562J51391_1054038 | Ga0006562J51391_10540386 | 278 |
| 136 | 3300003761 | Ga0055535_1001829 | Ga0055535_10018295 | 278 |
| 137 | 3300003762 | Ga0055542_1000062 | Ga0055542_1000062118 | 278 |
| 138 | 3300003773 | Ga0055537_1000217 | Ga0055537_10002175 | 278 |
| 139 | 3300003781 | Ga0055536_1004931 | Ga0055536_10049317 | 278 |
| 140 | 3300003781 | Ga0055536_1033041 | Ga0055536_10330412 | 278 |
| 141 | 3300003784 | Ga0055534_1000106 | Ga0055534_100010638 | 278 |
| 142 | 3300003791 | Ga0055530_10014659 | Ga0055530_100146592 | 278 |
| 143 | 3300003791 | Ga0055530_10017384 | Ga0055530_100173842 | 278 |
| 144 | 3300003792 | Ga0055540_1023225 | Ga0055540_10232252 | 278 |
| 145 | 3300003792 | Ga0055540_1023728 | Ga0055540_10237282 | 278 |
| 146 | 3300003794 | Ga0055531_10024129 | Ga0055531_100241292 | 278 |
| 147 | 3300004625 | Ga0055543_1001864 | Ga0055543_10018642 | 278 |
| 148 | 3300005262 | Ga0065165_1010149 | Ga0065165_10101492 | 278 |
| 149 | 3300005262 | Ga0065165_1017065 | Ga0065165_10170652 | 278 |
| 150 | 3300005289 | Ga0065704_10139897 | Ga0065704_101398972 | 278 |
| 151 | 3300005335 | Ga0070666_10245822 | Ga0070666_102458221 | 278 |
| 152 | 3300005355 | Ga0070671_100008076 | Ga0070671_1000080764 | 278 |
| 153 | 3300005356 | Ga0070674_100063572 | Ga0070674_1000635722 | 278 |
| 154 | 3300005364 | Ga0070673_100306768 | Ga0070673_1003067682 | 278 |
| 155 | 3300005366 | Ga0070659_100226068 | Ga0070659_1002260682 | 278 |
| 156 | 3300005539 | Ga0068853_100048143 | Ga0068853_1000481432 | 278 |
| 157 | 3300005539 | Ga0068853_100262739 | Ga0068853_1002627393 | 278 |
| 158 | 3300005548 | Ga0070665_100049015 | Ga0070665_1000490156 | 278 |
| 159 | 3300005548 | Ga0070665_100533331 | Ga0070665_1005333311 | 278 |
| 160 | 3300005563 | Ga0068855_100262226 | Ga0068855_1002622262 | 278 |
| 161 | 3300005564 | Ga0070664_100030827 | Ga0070664_1000308273 | 278 |
| 162 | 3300005616 | Ga0068852_100090091 | Ga0068852_1000900914 | 278 |
| 163 | 3300005834 | Ga0068851_10004978 | Ga0068851_100049784 | 278 |
| 164 | 3300005844 | Ga0068862_100058338 | Ga0068862_1000583382 | 278 |
| 165 | 3300006038 | Ga0075365_10112360 | Ga0075365_101123602 | 278 |
| 166 | 3300006048 | Ga0075363_100034458 | Ga0075363_1000344582 | 278 |
| 167 | 3300006177 | Ga0075362_10053558 | Ga0075362_100535582 | 278 |
| 168 | 3300006178 | Ga0075367_10017997 | Ga0075367_100179974 | 278 |
| 169 | 3300006195 | Ga0075366_10001289 | Ga0075366_1000128910 | 278 |
| 170 | 3300006195 | Ga0075366_10001659 | Ga0075366_100016597 | 278 |
| 171 | 3300006195 | Ga0075366_10047468 | Ga0075366_100474682 | 278 |
| 172 | 3300006195 | Ga0075366_10050258 | Ga0075366_100502583 | 278 |
| 173 | 3300006237 | Ga0097621_100182553 | Ga0097621_1001825532 | 278 |
| 174 | 3300006353 | Ga0075370_10001611 | Ga0075370_100016114 | 278 |
| 175 | 3300006358 | Ga0068871_100065069 | Ga0068871_1000650694 | 278 |
| 176 | 3300006948 | Ga0099826_10019049 | Ga0099826_100190492 | 278 |
| 177 | 3300006948 | Ga0099826_10218783 | Ga0099826_102187831 | 278 |
| 178 | 3300009148 | Ga0105243_10003130 | Ga0105243_1000313013 | 278 |
| 179 | 3300009177 | Ga0105248_10004242 | Ga0105248_100042424 | 278 |
| 180 | 3300009545 | Ga0105237_10065919 | Ga0105237_100659193 | 278 |
| 181 | 3300009551 | Ga0105238_10071854 | Ga0105238_100718542 | 278 |
| 182 | 3300013104 | Ga0157370_10423524 | Ga0157370_104235241 | 278 |
| 183 | 3300013105 | Ga0157369_10025878 | Ga0157369_100258784 | 278 |
| 184 | 3300013297 | Ga0157378_10431660 | Ga0157378_104316602 | 278 |
| 185 | 3300014968 | Ga0157379_10112290 | Ga0157379_101122903 | 278 |
| 186 | 3300014969 | Ga0157376_10158068 | Ga0157376_101580683 | 278 |
| 187 | 3300015265 | Ga0182005_1038226 | Ga0182005_10382261 | 278 |
| 188 | 3300017792 | Ga0163161_10149356 | Ga0163161_101493562 | 278 |
| 189 | 3300025208 | Ga0209436_104908 | Ga0209436_1049082 | 278 |
| 190 | 3300025228 | Ga0209672_100504 | Ga0209672_1005044 | 278 |
| 191 | 3300025229 | Ga0209147_100795 | Ga0209147_1007952 | 278 |
| 192 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051148 | 278 |
| 193 | 3300025242 | Ga0209258_100154 | Ga0209258_10015457 | 278 |
| 194 | 3300025245 | Ga0207425_1000267 | Ga0207425_10002672 | 278 |
| 195 | 3300025245 | Ga0207425_1002352 | Ga0207425_10023522 | 278 |
| 196 | 3300025254 | Ga0209148_1000145 | Ga0209148_100014557 | 278 |
| 197 | 3300025258 | Ga0209129_1000054 | Ga0209129_100005496 | 278 |
| 198 | 3300025258 | Ga0209129_1003624 | Ga0209129_10036247 | 278 |
| 199 | 3300025258 | Ga0209129_1005213 | Ga0209129_10052132 | 278 |
| 200 | 3300025263 | Ga0209565_1000067 | Ga0209565_1000067121 | 278 |
| 201 | 3300025263 | Ga0209565_1000185 | Ga0209565_100018531 | 278 |
| 202 | 3300025263 | Ga0209565_1003383 | Ga0209565_10033834 | 278 |
| 203 | 3300025273 | Ga0209673_1000097 | Ga0209673_1000097123 | 278 |
| 204 | 3300025273 | Ga0209673_1000172 | Ga0209673_1000172102 | 278 |
| 205 | 3300025273 | Ga0209673_1000548 | Ga0209673_10005489 | 278 |
| 206 | 3300025273 | Ga0209673_1000885 | Ga0209673_10008856 | 278 |
| 207 | 3300025284 | Ga0209130_1000260 | Ga0209130_10002602 | 278 |
| 208 | 3300025284 | Ga0209130_1000851 | Ga0209130_100085117 | 278 |
| 209 | 3300025291 | Ga0209675_1000038 | Ga0209675_1000038123 | 278 |
| 210 | 3300025291 | Ga0209675_1000368 | Ga0209675_100036841 | 278 |
| 211 | 3300025291 | Ga0209675_1002962 | Ga0209675_10029627 | 278 |
| 212 | 3300025291 | Ga0209675_1005682 | Ga0209675_10056822 | 278 |
| 213 | 3300025292 | Ga0209676_1000103 | Ga0209676_100010343 | 278 |
| 214 | 3300025292 | Ga0209676_1001503 | Ga0209676_100150314 | 278 |
| 215 | 3300025292 | Ga0209676_1007398 | Ga0209676_10073983 | 278 |
| 216 | 3300025292 | Ga0209676_1017857 | Ga0209676_10178572 | 278 |
| 217 | 3300025294 | Ga0209025_1000185 | Ga0209025_1000185131 | 278 |
| 218 | 3300025294 | Ga0209025_1000310 | Ga0209025_100031047 | 278 |
| 219 | 3300025294 | Ga0209025_1000474 | Ga0209025_100047433 | 278 |
| 220 | 3300025294 | Ga0209025_1001798 | Ga0209025_100179823 | 278 |
| 221 | 3300025295 | Ga0209564_1000241 | Ga0209564_100024140 | 278 |
| 222 | 3300025295 | Ga0209564_1000629 | Ga0209564_100062957 | 278 |
| 223 | 3300025295 | Ga0209564_1005185 | Ga0209564_10051855 | 278 |
| 224 | 3300025297 | Ga0209758_1000034 | Ga0209758_1000034342 | 278 |
| 225 | 3300025297 | Ga0209758_1011657 | Ga0209758_10116572 | 278 |
| 226 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012428 | 278 |
| 227 | 3300025298 | Ga0209050_1000294 | Ga0209050_100029444 | 278 |
| 228 | 3300025298 | Ga0209050_1001718 | Ga0209050_100171812 | 278 |
| 229 | 3300025298 | Ga0209050_1021084 | Ga0209050_10210843 | 278 |
| 230 | 3300025299 | Ga0209256_1000103 | Ga0209256_100010398 | 278 |
| 231 | 3300025299 | Ga0209256_1000165 | Ga0209256_100016557 | 278 |
| 232 | 3300025302 | Ga0207426_1000058 | Ga0207426_1000058226 | 278 |
| 233 | 3300025302 | Ga0207426_1000067 | Ga0207426_1000067231 | 278 |
| 234 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019347 | 278 |
| 235 | 3300025303 | Ga0209051_1000235 | Ga0209051_10002357 | 278 |
| 236 | 3300025303 | Ga0209051_1000985 | Ga0209051_100098514 | 278 |
| 237 | 3300025303 | Ga0209051_1002215 | Ga0209051_10022152 | 278 |
| 238 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024374 | 278 |
| 239 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057286 | 278 |
| 240 | 3300025304 | Ga0209257_1011116 | Ga0209257_10111162 | 278 |
| 241 | 3300025304 | Ga0209257_1037541 | Ga0209257_10375412 | 278 |
| 242 | 3300025321 | Ga0207656_10015115 | Ga0207656_100151154 | 278 |
| 243 | 3300025728 | Ga0207655_1001822 | Ga0207655_10018227 | 278 |
| 244 | 3300025920 | Ga0207649_10401289 | Ga0207649_104012891 | 278 |
| 245 | 3300025925 | Ga0207650_10418240 | Ga0207650_104182402 | 278 |
| 246 | 3300025931 | Ga0207644_10093394 | Ga0207644_100933942 | 278 |
| 247 | 3300025933 | Ga0207706_10032308 | Ga0207706_100323084 | 278 |
| 248 | 3300025935 | Ga0207709_10000215 | Ga0207709_1000021542 | 278 |
| 249 | 3300025935 | Ga0207709_10004503 | Ga0207709_100045037 | 278 |
| 250 | 3300025949 | Ga0207667_10135943 | Ga0207667_101359434 | 278 |
| 251 | 3300025960 | Ga0207651_10255054 | Ga0207651_102550542 | 278 |
| 252 | 3300026041 | Ga0207639_10034938 | Ga0207639_100349384 | 278 |
| 253 | 3300026089 | Ga0207648_10073604 | Ga0207648_100736044 | 278 |
| 254 | 3300027666 | Ga0209282_1018296 | Ga0209282_10182964 | 278 |
| 255 | 3300027876 | Ga0209974_10007016 | Ga0209974_100070163 | 278 |
| 256 | 3300028379 | Ga0268266_10034388 | Ga0268266_100343886 | 278 |
| 257 | 3300028380 | Ga0268265_10061117 | Ga0268265_100611172 | 278 |
| 258 | 3300028794 | Ga0307515_10263510 | Ga0307515_102635102 | 278 |
| 259 | 3300030732 | Ga0316176_1136684 | Ga0316176_11366841 | 278 |
| 260 | 3300030735 | Ga0316178_1136766 | Ga0316178_11367664 | 278 |
| 261 | 3300030742 | Ga0316183_1004302 | Ga0316183_10043022 | 278 |
| 262 | 3300030744 | Ga0316181_1021652 | Ga0316181_10216522 | 278 |
| 263 | 3300030745 | Ga0316182_1070586 | Ga0316182_10705862 | 278 |
| 264 | 3300031548 | Ga0307408_100169177 | Ga0307408_1001691771 | 278 |
| 265 | 3300031649 | Ga0307514_10024525 | Ga0307514_100245254 | 278 |
| 266 | 3300031901 | Ga0307406_10001114 | Ga0307406_100011142 | 278 |
| 267 | 3300031901 | Ga0307406_10370817 | Ga0307406_103708172 | 278 |
| 268 | 3300032002 | Ga0307416_100730581 | Ga0307416_1007305812 | 278 |
| 269 | 3300032004 | Ga0307414_10487371 | Ga0307414_104873712 | 278 |
| 270 | 3300032004 | Ga0307414_10659947 | Ga0307414_106599471 | 278 |
| 271 | 3300032005 | Ga0307411_10085391 | Ga0307411_100853912 | 278 |
| 272 | 3300035088 | Ga0373940_0003724 | Ga0373940_0003724_1876_2718 | 278 |
| 273 | 3300035114 | Ga0373939_0000140 | Ga0373939_0000140_11171_12013 | 278 |
| 274 | 3300035691 | Ga0373931_0000353 | Ga0373931_0000353_13560_14402 | 278 |
| 275 | 3300037471 | Ga0395905_0005270 | Ga0395905_0005270_7048_7887 | 278 |
| 276 | 3300041404 | Ga0439436_0014006 | Ga0439436_0014006_775_1611 | 278 |
| 277 | 3300042002 | Ga0439442_005071 | Ga0439442_005071_838_1674 | 278 |
| 278 | 3300042121 | Ga0450919_005461 | Ga0450919_005461_137_973 | 278 |
| 279 | 3300042122 | Ga0450920_005154 | Ga0450920_005154_498_1334 | 278 |
| 280 | 3300042123 | Ga0450921_000038 | Ga0450921_000038_1702_2538 | 278 |
| 281 | 3300042125 | Ga0450923_041023 | Ga0450923_041023_106_942 | 278 |
| 282 | 3300042131 | Ga0450894_003218 | Ga0450894_003218_960_1796 | 278 |
| 283 | 3300042145 | Ga0450906_004756 | Ga0450906_004756_749_1585 | 278 |
| 284 | 3300042156 | Ga0439446_0000431 | Ga0439446_0000431_295_1131 | 278 |
| 285 | 3300042184 | Ga0450908_000667 | Ga0450908_000667_4912_5748 | 278 |
| 286 | 3300042435 | Ga0439434_0010056 | Ga0439434_0010056_416_1252 | 278 |
| 287 | 3300042531 | Ga0450918_001718 | Ga0450918_001718_1054_1890 | 278 |
| 288 | 3300042876 | Ga0451577_0013885 | Ga0451577_0013885_6193_7068 | 278 |
| 289 | 3300044712 | Ga0453684_0006446 | Ga0453684_0006446_17834_18685 | 278 |
| 290 | 3300044712 | Ga0453684_0342741 | Ga0453684_0342741_227_1102 | 278 |
| 291 | 3300045051 | Ga0451576_0003864 | Ga0451576_0003864_14572_15447 | 278 |
| 292 | 3300046453 | Ga0495627_016496 | Ga0495627_016496_879_1715 | 278 |
| 293 | 3300046471 | Ga0495650_0001967 | Ga0495650_0001967_638_1525 | 278 |
| 294 | 3300046512 | Ga0495610_0047230 | Ga0495610_0047230_324_1160 | 278 |
| 295 | 3300046518 | Ga0495631_0000123 | Ga0495631_0000123_676_1512 | 278 |
| 296 | 3300046524 | Ga0495648_0138357 | Ga0495648_0138357_59_895 | 278 |
| 297 | 3300046660 | Ga0495625_0000661 | Ga0495625_0000661_1094_1930 | 278 |
| 298 | 3300046660 | Ga0495625_0052337 | Ga0495625_0052337_1291_2127 | 278 |
| 299 | 3300047321 | Ga0495676_0228971 | Ga0495676_0228971_411_1247 | 278 |
| 300 | 3300047673 | Ga0495593_0035411 | Ga0495593_0035411_542_1378 | 278 |
| 301 | 3300048904 | Ga0496101_0015984 | Ga0496101_0015984_908_1744 | 278 |
| 302 | 3300048905 | Ga0496102_0078740 | Ga0496102_0078740_353_1189 | 278 |
| 303 | 3300048907 | Ga0496104_0031140 | Ga0496104_0031140_1602_2465 | 278 |
| 304 | 3300048916 | Ga0496113_0230364 | Ga0496113_0230364_286_1149 | 278 |
| 305 | 3300048920 | Ga0496117_0021380 | Ga0496117_0021380_1998_2834 | 278 |
| 306 | 3300048920 | Ga0496117_0081878 | Ga0496117_0081878_1112_1948 | 278 |
| 307 | 3300048921 | Ga0496118_0136960 | Ga0496118_0136960_701_1537 | 278 |
| 308 | 3300048925 | Ga0496122_0000204 | Ga0496122_0000204_97253_98098 | 278 |
| 309 | 3300048926 | Ga0496123_0001226 | Ga0496123_0001226_3081_3926 | 278 |
| 310 | 3300048926 | Ga0496123_0222030 | Ga0496123_0222030_88_924 | 278 |
| 311 | 3300048927 | Ga0496124_0094008 | Ga0496124_0094008_1137_1982 | 278 |
| 312 | 3300048927 | Ga0496124_0117231 | Ga0496124_0117231_887_1723 | 278 |
| 313 | 3300048928 | Ga0496125_0033202 | Ga0496125_0033202_1524_2360 | 278 |
| 314 | 3300050490 | nmdc:mga03n38_53415_c1 | nmdc:mga03n38_53415_c1_912_1748 | 278 |
| 315 | 3300050491 | nmdc:mga00v17_44916_c1 | nmdc:mga00v17_44916_c1_341_1177 | 278 |
| 316 | 3300050492 | nmdc:mga0yw44_36273_c1 | nmdc:mga0yw44_36273_c1_1087_1923 | 278 |
| 317 | 3300050493 | nmdc:mga0k408_108688_c1 | nmdc:mga0k408_108688_c1_605_1459 | 278 |
| 318 | 3300050493 | nmdc:mga0k408_13895_c1 | nmdc:mga0k408_13895_c1_729_1580 | 278 |
| 319 | 3300050493 | nmdc:mga0k408_194977_c1 | nmdc:mga0k408_194977_c1_280_1122 | 278 |
| 320 | 3300050493 | nmdc:mga0k408_25013_c1 | nmdc:mga0k408_25013_c1_1500_2336 | 278 |
| 321 | 3300050493 | nmdc:mga0k408_31573_c2 | nmdc:mga0k408_31573_c2_20_883 | 278 |
| 322 | 3300050493 | nmdc:mga0k408_62154_c1 | nmdc:mga0k408_62154_c1_304_1143 | 278 |
| 323 | 3300050496 | nmdc:mga07m45_1804_c1 | nmdc:mga07m45_1804_c1_6882_7718 | 278 |
| 324 | 3300050496 | nmdc:mga07m45_2760_c1 | nmdc:mga07m45_2760_c1_1958_2794 | 278 |
| 325 | 3300050496 | nmdc:mga07m45_3914_c1 | nmdc:mga07m45_3914_c1_5278_6114 | 278 |
| 326 | 3300053090 | Ga0500646_0026432 | Ga0500646_0026432_16_861 | 278 |
| 327 | 3300053093 | Ga0500651_0000587 | Ga0500651_0000587_1009_1845 | 278 |
| 328 | 3300053108 | Ga0500562_009992 | Ga0500562_009992_57_893 | 278 |
| 329 | 3300053110 | Ga0500571_000163 | Ga0500571_000163_4559_5395 | 278 |
| 330 | 3300053121 | Ga0500607_007342 | Ga0500607_007342_680_1516 | 278 |
| 331 | 3300053122 | Ga0500608_017874 | Ga0500608_017874_177_1013 | 278 |
| 332 | 3300053125 | Ga0500618_029850 | Ga0500618_029850_314_1150 | 278 |
| 333 | 3300053128 | Ga0500626_038011 | Ga0500626_038011_732_1568 | 278 |
| 334 | 3300053133 | Ga0500655_006237 | Ga0500655_006237_749_1585 | 278 |
| 335 | 3300053134 | Ga0500658_0000314 | Ga0500658_0000314_1993_2829 | 278 |
| 336 | 3300053134 | Ga0500658_0000476 | Ga0500658_0000476_15246_16082 | 278 |
| 337 | 3300053136 | Ga0500559_0018106 | Ga0500559_0018106_986_1831 | 278 |
| 338 | 3300053139 | Ga0500568_0001888 | Ga0500568_0001888_2150_2986 | 278 |
| 339 | 3300053141 | Ga0500574_002257 | Ga0500574_002257_1206_2042 | 278 |
| 340 | 3300053153 | Ga0500616_0005383 | Ga0500616_0005383_380_1216 | 278 |
| 341 | 3300053156 | Ga0500622_0066694 | Ga0500622_0066694_676_1521 | 278 |
| 342 | 3300053158 | Ga0500627_0000392 | Ga0500627_0000392_9815_10651 | 278 |
| 343 | 3300053162 | Ga0500638_007950 | Ga0500638_007950_3402_4238 | 278 |
| 344 | iso_pu_bacteria | 2511231002 | 2511244554 | 278 |
| 345 | iso_pu_bacteria | 2643221660 | 2644340373 | 278 |
| 346 | iso_pu_bacteria | 2739367655 | 2739610117 | 278 |
| 347 | iso_pu_bacteria | 2881927736 | 2881930728 | 278 |
| 348 | iso_pu_bacteria | 2887375801 | 2887376866 | 278 |
| 349 | iso_pu_bacteria | 2895511927 | 2895516203 | 278 |
| 350 | iso_pu_bacteria | 2928115317 | 2928120712 | 278 |
| 351 | 3300005548 | Ga0070665_100183575 | Ga0070665_1001835752 | 279 |
| 352 | 3300005617 | Ga0068859_100456040 | Ga0068859_1004560401 | 279 |
| 353 | 3300005618 | Ga0068864_100077325 | Ga0068864_1000773252 | 279 |
| 354 | 3300005719 | Ga0068861_100058020 | Ga0068861_1000580202 | 279 |
| 355 | 3300005843 | Ga0068860_100067497 | Ga0068860_1000674974 | 279 |
| 356 | 3300006058 | Ga0075432_10020524 | Ga0075432_100205244 | 279 |
| 357 | 3300006931 | Ga0097620_100456048 | Ga0097620_1004560481 | 279 |
| 358 | 3300014968 | Ga0157379_10082217 | Ga0157379_100822173 | 279 |
| 359 | 3300027876 | Ga0209974_10032851 | Ga0209974_100328512 | 279 |
| 360 | 3300027907 | Ga0207428_10093873 | Ga0207428_100938732 | 279 |
| 361 | 3300028381 | Ga0268264_10387656 | Ga0268264_103876563 | 279 |
| 362 | 3300053117 | Ga0500593_008058 | Ga0500593_008058_97_978 | 279 |
| 363 | iso_pu_bacteria | 2738543013 | 2739248335 | 279 |
| 364 | 3300003784 | Ga0055534_1001503 | Ga0055534_10015031 | 280 |
| 365 | 3300005530 | Ga0070679_100007196 | Ga0070679_10000719610 | 280 |
| 366 | 3300006038 | Ga0075365_10006008 | Ga0075365_100060086 | 280 |
| 367 | 3300009093 | Ga0105240_10006435 | Ga0105240_100064355 | 280 |
| 368 | 3300025284 | Ga0209130_1002520 | Ga0209130_10025202 | 280 |
| 369 | 3300025291 | Ga0209675_1002902 | Ga0209675_10029025 | 280 |
| 370 | 3300025292 | Ga0209676_1013182 | Ga0209676_10131824 | 280 |
| 371 | 3300025298 | Ga0209050_1009957 | Ga0209050_10099575 | 280 |
| 372 | 3300028794 | Ga0307515_10003296 | Ga0307515_1000329633 | 280 |
| 373 | 3300031456 | Ga0307513_10036523 | Ga0307513_100365235 | 280 |
| 374 | 3300031649 | Ga0307514_10000641 | Ga0307514_1000064131 | 280 |
| 375 | 3300049571 | Ga0501034_0061426 | Ga0501034_0061426_2718_3578 | 280 |
| 376 | 3300005563 | Ga0068855_100001682 | Ga0068855_1000016826 | 281 |
| 377 | 3300005618 | Ga0068864_100137165 | Ga0068864_1001371652 | 281 |
| 378 | 3300005844 | Ga0068862_100386180 | Ga0068862_1003861802 | 281 |
| 379 | 3300009177 | Ga0105248_10362712 | Ga0105248_103627122 | 281 |
| 380 | 3300025925 | Ga0207650_10171448 | Ga0207650_101714483 | 281 |
| 381 | 3300025929 | Ga0207664_10117144 | Ga0207664_101171443 | 281 |
| 382 | 3300025941 | Ga0207711_10290896 | Ga0207711_102908962 | 281 |
| 383 | 3300026088 | Ga0207641_10173452 | Ga0207641_101734522 | 281 |
| 384 | 3300037471 | Ga0395905_0042923 | Ga0395905_0042923_193_1047 | 281 |
| 385 | 3300049568 | Ga0501031_0148380 | Ga0501031_0148380_550_1422 | 281 |
| 386 | 3300050489 | nmdc:mga03683_190646_c1 | nmdc:mga03683_190646_c1_43_897 | 281 |
| 387 | iso_pu_bacteria | 2885192300 | 2885196881 | 281 |
| 388 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_100000516 | 282 |
| 389 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_10000178 | 282 |
| 390 | 3300002738 | JGI25154J39366_1000144 | JGI25154J39366_100014444 | 282 |
| 391 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_100000324 | 282 |
| 392 | 3300002987 | JGI25159J45721_1006405 | JGI25159J45721_10064052 | 282 |
| 393 | 3300003771 | Ga0055526_1000806 | Ga0055526_10008066 | 282 |
| 394 | 3300003773 | Ga0055537_1000115 | Ga0055537_100011519 | 282 |
| 395 | 3300003775 | Ga0055524_1000186 | Ga0055524_100018618 | 282 |
| 396 | 3300003781 | Ga0055536_1001432 | Ga0055536_10014328 | 282 |
| 397 | 3300003784 | Ga0055534_1001499 | Ga0055534_10014992 | 282 |
| 398 | 3300003791 | Ga0055530_10000208 | Ga0055530_1000020850 | 282 |
| 399 | 3300003792 | Ga0055540_1000037 | Ga0055540_1000037159 | 282 |
| 400 | 3300003792 | Ga0055540_1000208 | Ga0055540_100020828 | 282 |
| 401 | 3300003794 | Ga0055531_10000112 | Ga0055531_100001128 | 282 |
| 402 | 3300005328 | Ga0070676_10153765 | Ga0070676_101537652 | 282 |
| 403 | 3300005338 | Ga0068868_100225443 | Ga0068868_1002254432 | 282 |
| 404 | 3300005563 | Ga0068855_100229984 | Ga0068855_1002299842 | 282 |
| 405 | 3300009098 | Ga0105245_10024118 | Ga0105245_100241185 | 282 |
| 406 | 3300010375 | Ga0105239_10337179 | Ga0105239_103371793 | 282 |
| 407 | 3300012513 | Ga0157326_1003322 | Ga0157326_10033222 | 282 |
| 408 | 3300014969 | Ga0157376_10004660 | Ga0157376_100046601 | 282 |
| 409 | 3300025206 | Ga0209435_100002 | Ga0209435_100002131 | 282 |
| 410 | 3300025245 | Ga0207425_1002461 | Ga0207425_10024614 | 282 |
| 411 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012274 | 282 |
| 412 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001931 | 282 |
| 413 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011905 | 282 |
| 414 | 3300025263 | Ga0209565_1000143 | Ga0209565_100014349 | 282 |
| 415 | 3300025273 | Ga0209673_1000008 | Ga0209673_1000008180 | 282 |
| 416 | 3300025284 | Ga0209130_1000305 | Ga0209130_100030545 | 282 |
| 417 | 3300025291 | Ga0209675_1000820 | Ga0209675_100082011 | 282 |
| 418 | 3300025292 | Ga0209676_1000023 | Ga0209676_1000023253 | 282 |
| 419 | 3300025294 | Ga0209025_1009542 | Ga0209025_10095424 | 282 |
| 420 | 3300025295 | Ga0209564_1000435 | Ga0209564_10004357 | 282 |
| 421 | 3300025295 | Ga0209564_1001509 | Ga0209564_10015096 | 282 |
| 422 | 3300025298 | Ga0209050_1000022 | Ga0209050_1000022235 | 282 |
| 423 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011721 | 282 |
| 424 | 3300025303 | Ga0209051_1000013 | Ga0209051_1000013235 | 282 |
| 425 | 3300025304 | Ga0209257_1000042 | Ga0209257_1000042251 | 282 |
| 426 | 3300031242 | Ga0265329_10015932 | Ga0265329_100159322 | 282 |
| 427 | 3300031548 | Ga0307408_100110292 | Ga0307408_1001102923 | 282 |
| 428 | 3300031711 | Ga0265314_10001279 | Ga0265314_1000127927 | 282 |
| 429 | 3300031711 | Ga0265314_10048181 | Ga0265314_100481812 | 282 |
| 430 | 3300031712 | Ga0265342_10040873 | Ga0265342_100408733 | 282 |
| 431 | 3300031712 | Ga0265342_10164581 | Ga0265342_101645812 | 282 |
| 432 | 3300031995 | Ga0307409_100521335 | Ga0307409_1005213352 | 282 |
| 433 | 3300037312 | Ga0395899_0011767 | Ga0395899_0011767_936_1793 | 282 |
| 434 | 3300037312 | Ga0395899_0044197 | Ga0395899_0044197_754_1611 | 282 |
| 435 | 3300037418 | Ga0395900_0029407 | Ga0395900_0029407_3799_4656 | 282 |
| 436 | 3300037418 | Ga0395900_0059608 | Ga0395900_0059608_1000_1857 | 282 |
| 437 | 3300037466 | Ga0395898_0003443 | Ga0395898_0003443_11079_11936 | 282 |
| 438 | 3300037466 | Ga0395898_0018549 | Ga0395898_0018549_397_1254 | 282 |
| 439 | 3300037471 | Ga0395905_0000043 | Ga0395905_0000043_223432_224289 | 282 |
| 440 | 3300037471 | Ga0395905_0040202 | Ga0395905_0040202_1150_2007 | 282 |
| 441 | 3300037471 | Ga0395905_0051564 | Ga0395905_0051564_966_1823 | 282 |
| 442 | 3300038443 | Ga0395901_0033252 | Ga0395901_0033252_1729_2586 | 282 |
| 443 | 3300038443 | Ga0395901_0066417 | Ga0395901_0066417_2534_3391 | 282 |
| 444 | 3300042532 | Ga0450893_0001655 | Ga0450893_0001655_2549_3403 | 282 |
| 445 | 3300045049 | Ga0466959_0241873 | Ga0466959_0241873_319_1185 | 282 |
| 446 | 3300045051 | Ga0451576_0352393 | Ga0451576_0352393_241_1095 | 282 |
| 447 | 3300046615 | Ga0495656_0067992 | Ga0495656_0067992_369_1226 | 282 |
| 448 | 3300046810 | Ga0495660_0073063 | Ga0495660_0073063_124_981 | 282 |
| 449 | 3300049575 | Ga0501039_0092947 | Ga0501039_0092947_31_909 | 282 |
| 450 | 3300049592 | Ga0501076_0085483 | Ga0501076_0085483_814_1692 | 282 |
| 451 | 3300049822 | Ga0501035_0228395 | Ga0501035_0228395_17_895 | 282 |
| 452 | 3300049824 | Ga0501045_0072768 | Ga0501045_0072768_1451_2329 | 282 |
| 453 | 3300053730 | Ga0500645_004482 | Ga0500645_004482_2297_3178 | 282 |
| 454 | 3300006195 | Ga0075366_10002790 | Ga0075366_100027901 | 284 |
| 455 | 3300041404 | Ga0439436_0001226 | Ga0439436_0001226_1321_2190 | 284 |
| 456 | 3300041411 | Ga0439466_0004836 | Ga0439466_0004836_2700_3569 | 284 |
| 457 | 3300041413 | Ga0439465_0001421 | Ga0439465_0001421_2417_3286 | 284 |
| 458 | 3300041997 | Ga0439431_0000611 | Ga0439431_0000611_726_1595 | 284 |
| 459 | 3300041999 | Ga0439433_0000817 | Ga0439433_0000817_1050_1919 | 284 |
| 460 | 3300042004 | Ga0439445_0001029 | Ga0439445_0001029_1829_2698 | 284 |
| 461 | 3300042006 | Ga0439432_001181 | Ga0439432_001181_6772_7641 | 284 |
| 462 | 3300042007 | Ga0439449_0002198 | Ga0439449_0002198_5007_5876 | 284 |
| 463 | 3300042007 | Ga0439449_0026391 | Ga0439449_0026391_131_1000 | 284 |
| 464 | 3300042015 | Ga0439462_0000785 | Ga0439462_0000785_2856_3725 | 284 |
| 465 | 3300042156 | Ga0439446_0026018 | Ga0439446_0026018_313_1182 | 284 |
| 466 | 3300042532 | Ga0450893_0007459 | Ga0450893_0007459_889_1758 | 284 |
| 467 | 3300042876 | Ga0451577_0087490 | Ga0451577_0087490_323_1213 | 284 |
| 468 | 3300042876 | Ga0451577_0341639 | Ga0451577_0341639_262_1140 | 284 |
| 469 | 3300044712 | Ga0453684_0207043 | Ga0453684_0207043_957_1847 | 284 |
| 470 | 3300046501 | Ga0495607_0000480 | Ga0495607_0000480_31650_32528 | 284 |
| 471 | 3300046558 | Ga0495633_0000458 | Ga0495633_0000458_12557_13417 | 284 |
| 472 | 3300050493 | nmdc:mga0k408_95453_c1 | nmdc:mga0k408_95453_c1_175_1041 | 284 |
| 473 | 3300050496 | nmdc:mga07m45_141636_c1 | nmdc:mga07m45_141636_c1_486_1352 | 284 |
| 474 | 3300006195 | Ga0075366_10044935 | Ga0075366_100449354 | 285 |
| 475 | 3300006353 | Ga0075370_10003703 | Ga0075370_100037037 | 285 |
| 476 | 3300015262 | Ga0182007_10000289 | Ga0182007_1000028934 | 285 |
| 477 | 3300026121 | Ga0207683_10036652 | Ga0207683_100366526 | 285 |
| 478 | 3300031911 | Ga0307412_10041871 | Ga0307412_100418712 | 285 |
| 479 | 3300041411 | Ga0439466_0010808 | Ga0439466_0010808_168_1073 | 285 |
| 480 | 3300042007 | Ga0439449_0000581 | Ga0439449_0000581_783_1688 | 285 |
| 481 | 3300042010 | Ga0439452_012398 | Ga0439452_012398_1107_2012 | 285 |
| 482 | 3300042014 | Ga0439457_010018 | Ga0439457_010018_412_1317 | 285 |
| 483 | 3300042015 | Ga0439462_0005369 | Ga0439462_0005369_615_1520 | 285 |
| 484 | 3300044683 | Ga0466965_0008623 | Ga0466965_0008623_738_1643 | 285 |
| 485 | 3300044693 | Ga0466961_0079017 | Ga0466961_0079017_519_1385 | 285 |
| 486 | 3300044901 | Ga0466960_0019788 | Ga0466960_0019788_1383_2288 | 285 |
| 487 | 3300048910 | Ga0496107_0102781 | Ga0496107_0102781_1007_1927 | 285 |
| 488 | 3300005367 | Ga0070667_100021114 | Ga0070667_1000211142 | 286 |
| 489 | 3300017792 | Ga0163161_10304929 | Ga0163161_103049292 | 286 |
| 490 | 3300025940 | Ga0207691_10062589 | Ga0207691_100625893 | 286 |
| 491 | 3300028794 | Ga0307515_10000472 | Ga0307515_1000047238 | 286 |
| 492 | 3300031251 | Ga0265327_10075923 | Ga0265327_100759232 | 286 |
| 493 | 3300046475 | Ga0495639_0002555 | Ga0495639_0002555_2859_3782 | 286 |
| 494 | 3300046615 | Ga0495656_0034791 | Ga0495656_0034791_461_1384 | 286 |
| 495 | 3300048903 | Ga0496100_0019529 | Ga0496100_0019529_481_1404 | 286 |
| 496 | 3300048904 | Ga0496101_0008376 | Ga0496101_0008376_4447_5370 | 286 |
| 497 | 3300048905 | Ga0496102_0004638 | Ga0496102_0004638_2962_3885 | 286 |
| 498 | 3300048906 | Ga0496103_0112725 | Ga0496103_0112725_218_1141 | 286 |
| 499 | 3300048907 | Ga0496104_0002111 | Ga0496104_0002111_6426_7349 | 286 |
| 500 | 3300048913 | Ga0496110_0130673 | Ga0496110_0130673_377_1300 | 286 |
| 501 | 3300048917 | Ga0496114_0125020 | Ga0496114_0125020_458_1381 | 286 |
| 502 | iso_pu_bacteria | 2519103095 | 2519459491 | 286 |
| 503 | iso_pu_bacteria | 2582581311 | 2585291078 | 286 |
| 504 | iso_pu_bacteria | 2599185239 | 2599738536 | 286 |
| 505 | iso_pu_bacteria | 2599185240 | 2599748245 | 286 |
| 506 | iso_pu_bacteria | 2599185355 | 2600210071 | 286 |
| 507 | iso_pu_bacteria | 2675903129 | 2676746429 | 286 |
| 508 | iso_pu_bacteria | 2816332253 | 2817261773 | 286 |
| 509 | iso_pu_bacteria | 2816332256 | 2817279457 | 286 |
| 510 | iso_pu_bacteria | 2816332286 | 2817456787 | 286 |
| 511 | iso_pu_bacteria | 2818991452 | 2819633326 | 286 |
| 512 | iso_pu_bacteria | 2863421361 | 2863425761 | 286 |
| 513 | iso_pu_bacteria | 2870068957 | 2870070516 | 286 |
| 514 | iso_pu_bacteria | 2904564687 | 2904569131 | 286 |
| 515 | iso_pu_bacteria | 2904571731 | 2904576561 | 286 |
| 516 | iso_pu_bacteria | 2928157003 | 2928161446 | 286 |
| 517 | iso_pu_bacteria | 2928163908 | 2928168274 | 286 |
| 518 | iso_pu_bacteria | 2928170801 | 2928175016 | 286 |
| 519 | iso_pu_bacteria | 2928536128 | 2928541739 | 286 |
| 520 | iso_pu_bacteria | 2981990288 | 2981993387 | 286 |
| 521 | iso_pu_bacteria | 641736154 | 642419294 | 286 |
| 522 | iso_pu_bacteria | 8018845410 | 8018849928 | 286 |
| 523 | iso_pu_bacteria | 8020807995 | 8020813043 | 286 |
| 524 | iso_pu_bacteria | 8020938398 | 8020938764 | 286 |
| 525 | iso_pu_bacteria | 8020945358 | 8020949274 | 286 |
| 526 | iso_pu_bacteria | 8020953355 | 8020959138 | 286 |
| 527 | iso_pu_bacteria | 8021120328 | 8021125374 | 286 |
| 528 | iso_pu_bacteria | 8039098773 | 8039100753 | 286 |
| 529 | iso_pu_bacteria | 8040167225 | 8040169123 | 286 |
| 530 | iso_pu_bacteria | 8040173305 | 8040179415 | 286 |
| 531 | 3300009093 | Ga0105240_10133801 | Ga0105240_101338014 | 288 |
| 532 | 3300046692 | Ga0495671_0101776 | Ga0495671_0101776_448_1323 | 288 |
| 533 | iso_pu_bacteria | 2501025502 | 2501081376 | 288 |
| 534 | iso_pu_bacteria | 2510917013 | 2511089222 | 288 |
| 535 | 3300001915 | JGI24741J21665_1018016 | JGI24741J21665_10180162 | 290 |
| 536 | 3300003758 | Ga0055532_1001133 | Ga0055532_10011333 | 290 |
| 537 | 3300003758 | Ga0055532_1007692 | Ga0055532_10076922 | 290 |
| 538 | 3300003758 | Ga0055532_1007879 | Ga0055532_10078792 | 290 |
| 539 | 3300003760 | Ga0055527_1000483 | Ga0055527_10004835 | 290 |
| 540 | 3300003760 | Ga0055527_1000486 | Ga0055527_10004865 | 290 |
| 541 | 3300003761 | Ga0055535_1001227 | Ga0055535_10012275 | 290 |
| 542 | 3300003761 | Ga0055535_1001232 | Ga0055535_10012325 | 290 |
| 543 | 3300003762 | Ga0055542_1001223 | Ga0055542_10012235 | 290 |
| 544 | 3300003762 | Ga0055542_1001936 | Ga0055542_10019364 | 290 |
| 545 | 3300003763 | Ga0055529_1000553 | Ga0055529_100055329 | 290 |
| 546 | 3300005327 | Ga0070658_10042072 | Ga0070658_100420723 | 290 |
| 547 | 3300005339 | Ga0070660_100000037 | Ga0070660_1000000374 | 290 |
| 548 | 3300005366 | Ga0070659_100000121 | Ga0070659_10000012159 | 290 |
| 549 | 3300005455 | Ga0070663_100041081 | Ga0070663_1000410812 | 290 |
| 550 | 3300005563 | Ga0068855_100059644 | Ga0068855_1000596444 | 290 |
| 551 | 3300005616 | Ga0068852_100055022 | Ga0068852_1000550224 | 290 |
| 552 | 3300009092 | Ga0105250_10003602 | Ga0105250_100036029 | 290 |
| 553 | 3300009093 | Ga0105240_10247038 | Ga0105240_102470383 | 290 |
| 554 | 3300009551 | Ga0105238_10005085 | Ga0105238_100050854 | 290 |
| 555 | 3300010375 | Ga0105239_10043839 | Ga0105239_100438392 | 290 |
| 556 | 3300013100 | Ga0157373_10121768 | Ga0157373_101217683 | 290 |
| 557 | 3300025225 | Ga0209566_101026 | Ga0209566_1010264 | 290 |
| 558 | 3300025228 | Ga0209672_100033 | Ga0209672_100033217 | 290 |
| 559 | 3300025228 | Ga0209672_100034 | Ga0209672_10003475 | 290 |
| 560 | 3300025229 | Ga0209147_100089 | Ga0209147_10008986 | 290 |
| 561 | 3300025229 | Ga0209147_100191 | Ga0209147_10019167 | 290 |
| 562 | 3300025229 | Ga0209147_101268 | Ga0209147_1012682 | 290 |
| 563 | 3300025242 | Ga0209258_100023 | Ga0209258_10002310 | 290 |
| 564 | 3300025242 | Ga0209258_100242 | Ga0209258_10024210 | 290 |
| 565 | 3300025254 | Ga0209148_1000029 | Ga0209148_100002975 | 290 |
| 566 | 3300025254 | Ga0209148_1001246 | Ga0209148_10012468 | 290 |
| 567 | 3300025256 | Ga0209759_1002254 | Ga0209759_10022548 | 290 |
| 568 | 3300025272 | Ga0209455_1000123 | Ga0209455_100012375 | 290 |
| 569 | 3300025272 | Ga0209455_1000756 | Ga0209455_10007568 | 290 |
| 570 | 3300025273 | Ga0209673_1000075 | Ga0209673_100007596 | 290 |
| 571 | 3300025904 | Ga0207647_10002981 | Ga0207647_100029819 | 290 |
| 572 | 3300025909 | Ga0207705_10044566 | Ga0207705_100445663 | 290 |
| 573 | 3300025913 | Ga0207695_10001130 | Ga0207695_1000113019 | 290 |
| 574 | 3300025913 | Ga0207695_10122107 | Ga0207695_101221072 | 290 |
| 575 | 3300025914 | Ga0207671_10012673 | Ga0207671_100126733 | 290 |
| 576 | 3300025919 | Ga0207657_10000098 | Ga0207657_100000984 | 290 |
| 577 | 3300025932 | Ga0207690_10000055 | Ga0207690_100000555 | 290 |
| 578 | 3300025949 | Ga0207667_10053384 | Ga0207667_100533843 | 290 |
| 579 | 3300026067 | Ga0207678_10000238 | Ga0207678_1000023821 | 290 |
| 580 | 3300026078 | Ga0207702_10154399 | Ga0207702_101543991 | 290 |
| 581 | 3300026142 | Ga0207698_10002821 | Ga0207698_100028213 | 290 |
| 582 | 3300027312 | Ga0209371_1001116 | Ga0209371_10011164 | 290 |
| 583 | 3300030500 | Ga0268256_1000946 | Ga0268256_100094620 | 290 |
| 584 | 3300039437 | Ga0436365_0238213 | Ga0436365_0238213_1594_2466 | 290 |
| 585 | 3300048919 | Ga0496116_0098545 | Ga0496116_0098545_690_1562 | 290 |
| 586 | 3300048920 | Ga0496117_0050367 | Ga0496117_0050367_596_1468 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar