F466519

General Info

Members Datasets Scaffolds Average Seq Length
586 375 498 283

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10153765|Ga0070676_101537652
Length 314
Sequence VPIRPAAPGRPAPGAIDSIASETLADVDADEGGAHGSRADAGGHTLVPELPDVVDQVALARLYGEPLFALPQDLYIPPDALEVFLEAFEGPLDLLLYLIRKQNFNILDIPMAGLTRQYLSYVEEIRTRNLELAAEYLLMAAMLIEIKSRMLLPPRKTAEGEEAEDPRAELVRRLLEYEQAKMQAAALSALPLYGRDFWKAQVHIEQSLKPRFPDVNVVDLREAWADILKRARLVQHHRITREELSVREHMSIVLRKLQGRQFVEFENMFDIARGTPVMVVTFLAMLELAKETLIEITQAEAFAPIYVRLAYSPA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2519103095 Burkholderia sp. KJ006 Isolate Nodule
6 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
12 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
13 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
14 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
15 2643221585 Pelomonas sp. Root662 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
18 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221660 Methylibium sp. Root1272 Isolate Unclassified
22 2643221672 Variovorax sp. Root434 Isolate Unclassified
23 2643221683 Variovorax sp. Root473 Isolate Unclassified
24 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
25 2738541277 Variovorax sp. GV051 Isolate Unclassified
26 2738541307 Variovorax sp. GV008 Isolate Unclassified
27 2738541337 Pelomonas sp. BT06 Isolate Unclassified
28 2738543013 Variovorax sp. BT01 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
31 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
32 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
33 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2818991452 Burkholderia cepacia 561 Isolate Unclassified
36 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
37 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
38 2842677519 Variovorax sp. R-72495 Isolate Unclassified
39 2842733646 Variovorax sp. R-72446 Isolate Unclassified
40 2842747753 Variovorax sp. R-72060 Isolate Unclassified
41 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
42 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
43 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
44 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
45 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
46 2885198086 Variovorax sp. 679 Isolate Unclassified
47 2885211737 Variovorax sp. 553 Isolate Unclassified
48 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
49 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
50 2899924645 Variovorax sp. 369 Isolate Unclassified
51 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
52 2904456579 Variovorax sp. 2002 Isolate Unclassified
53 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
54 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
55 2904564687 Burkholderia sp. 571 Isolate Unclassified
56 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
57 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
58 2928037797 Variovorax sp. 1126 Isolate Unclassified
59 2928044640 Variovorax sp. 1128 Isolate Unclassified
60 2928051484 Variovorax sp. 1133 Isolate Unclassified
61 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
62 2928070936 Variovorax gossypii 1167 Isolate Unclassified
63 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
64 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
65 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
66 2928163908 Burkholderia sp. 567 Isolate Unclassified
67 2928170801 Burkholderia sp. 572 Isolate Unclassified
68 2928536128 Burkholderia sola 565 Isolate Unclassified
69 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
70 2929520902 Variovorax beijingensis 502 Isolate Unclassified
71 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
72 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
73 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
74 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
75 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
76 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
77 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
78 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
83 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
84 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
85 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
86 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
87 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
88 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
89 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
90 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
91 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
92 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
93 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
94 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
95 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
96 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
97 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
98 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
99 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
100 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
105 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
106 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
107 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
111 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
112 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
135 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
142 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
143 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
152 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
161 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
165 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
228 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
229 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
230 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
263 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
271 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
272 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
273 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
274 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
275 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
276 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
277 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
278 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
279 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
284 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
347 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
348 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
349 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
350 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
351 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
352 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
353 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
362 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
365 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
366 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
367 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
368 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
369 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
370 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
371 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
372 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
373 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
374 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
375 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.81
Metatranscriptomes 0.17
Isolates 15.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.11
Nodule 0.85
Rhizoplane 3.41
Rhizosphere 48.63
Stem 0
Stem Tuber 0
Unclassified 13.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1018016 3300001915 Bacteria 1133
2 JGI24740J21852_10005909 3300001979 Bacteria 5130
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25154J39366_1000017 3300002738 Bacteria 252448
5 JGI25154J39366_1000144 3300002738 Bacteria 55903
6 JGI25157J39369_1000003 3300002741 Bacteria 274935
7 JGI25159J45721_1000982 3300002987 Bacteria 12319
8 JGI25159J45721_1006405 3300002987 Bacteria 3529
9 JGI25153J46596_10045169 3300003215 Bacteria 1317
10 JGI25160J50197_1000149 3300003354 Bacteria 61868
11 JGI25161J50226_1000149 3300003374 Bacteria 48658
12 JGI25161J50226_1000177 3300003374 Bacteria 42668
13 JGI25161J50226_1002972 3300003374 Bacteria 4084
14 JGI25161J50226_1006753 3300003374 Bacteria 2028
15 Ga0006562J51391_1054038 3300003578 Bacteria 5670
16 Ga0055532_1001133 3300003758 Bacteria 8171
17 Ga0055532_1007692 3300003758 Bacteria 1373
18 Ga0055532_1007879 3300003758 Bacteria 1350
19 Ga0055527_1000483 3300003760 Bacteria 14449
20 Ga0055527_1000486 3300003760 Bacteria 14354
21 Ga0055535_1001227 3300003761 Bacteria 14449
22 Ga0055535_1001232 3300003761 Bacteria 14354
23 Ga0055535_1001829 3300003761 Bacteria 9137
24 Ga0055542_1000062 3300003762 Bacteria 161494
25 Ga0055542_1001223 3300003762 Bacteria 14354
26 Ga0055542_1001936 3300003762 Bacteria 8093
27 Ga0055529_1000553 3300003763 Bacteria 31437
28 Ga0055526_1000806 3300003771 Bacteria 23377
29 Ga0055537_1000115 3300003773 Bacteria 60828
30 Ga0055537_1000217 3300003773 Bacteria 42589
31 Ga0055524_1000186 3300003775 Bacteria 69106
32 Ga0055536_1001432 3300003781 Bacteria 14374
33 Ga0055536_1004931 3300003781 Bacteria 6649
34 Ga0055536_1033041 3300003781 Bacteria 1327
35 Ga0055534_1000106 3300003784 Bacteria 63996
36 Ga0055534_1001499 3300003784 Bacteria 9221
37 Ga0055534_1001503 3300003784 Bacteria 9202
38 Ga0055530_10000208 3300003791 Bacteria 53265
39 Ga0055530_10014659 3300003791 Bacteria 2598
40 Ga0055530_10017384 3300003791 Bacteria 2257
41 Ga0055540_1000037 3300003792 Bacteria 162957
42 Ga0055540_1000208 3300003792 Bacteria 56164
43 Ga0055540_1023225 3300003792 Bacteria 1566
44 Ga0055540_1023728 3300003792 Bacteria 1538
45 Ga0055531_10000112 3300003794 Bacteria 89016
46 Ga0055531_10024129 3300003794 Bacteria 2255
47 Ga0055543_1000338 3300004625 Bacteria 32020
48 Ga0055543_1001864 3300004625 Bacteria 7675
49 Ga0065165_1010149 3300005262 Bacteria 4113
50 Ga0065165_1017065 3300005262 Bacteria 2690
51 Ga0065704_10139897 3300005289 Bacteria 1516
52 Ga0070658_10042072 3300005327 Bacteria 3688
53 Ga0070676_10153765 3300005328 Bacteria 1475
54 Ga0070666_10245822 3300005335 Bacteria 1266
55 Ga0070680_100042806 3300005336 Bacteria 3676
56 Ga0068868_100225443 3300005338 Bacteria 1570
57 Ga0070660_100000037 3300005339 Bacteria 77555
58 Ga0070671_100008076 3300005355 Bacteria 8425
59 Ga0070674_100063572 3300005356 Bacteria 2584
60 Ga0070673_100306768 3300005364 Bacteria 1399
61 Ga0070659_100000121 3300005366 Bacteria 58732
62 Ga0070659_100226068 3300005366 Bacteria 1546
63 Ga0070667_100021114 3300005367 Bacteria 5409
64 Ga0070663_100041081 3300005455 Bacteria 3242
65 Ga0070678_100006053 3300005456 Bacteria 7058
66 Ga0068867_100126681 3300005459 Bacteria 1980
67 Ga0070679_100002110 3300005530 Bacteria 17906
68 Ga0070679_100007196 3300005530 Bacteria 10394
69 Ga0068853_100048143 3300005539 Bacteria 3660
70 Ga0068853_100262739 3300005539 Bacteria 1587
71 Ga0070665_100049015 3300005548 Bacteria 4239
72 Ga0070665_100183575 3300005548 Bacteria 2092
73 Ga0070665_100533331 3300005548 Bacteria 1186
74 Ga0068855_100001682 3300005563 Bacteria 27687
75 Ga0068855_100059644 3300005563 Bacteria 4464
76 Ga0068855_100229984 3300005563 Bacteria 2077
77 Ga0068855_100262226 3300005563 Bacteria 1924
78 Ga0070664_100030827 3300005564 Bacteria 4476
79 Ga0068856_100242689 3300005614 Bacteria 1817
80 Ga0068852_100055022 3300005616 Bacteria 3433
81 Ga0068852_100090091 3300005616 Bacteria 2742
82 Ga0068859_100456040 3300005617 Bacteria 1374
83 Ga0068864_100077325 3300005618 Bacteria 2910
84 Ga0068864_100137165 3300005618 Bacteria 2204
85 Ga0068861_100058020 3300005719 Bacteria 2959
86 Ga0068851_10004978 3300005834 Bacteria 6016
87 Ga0068860_100067497 3300005843 Bacteria 3399
88 Ga0068862_100021641 3300005844 Bacteria 5376
89 Ga0068862_100058338 3300005844 Bacteria 3311
90 Ga0068862_100386180 3300005844 Bacteria 1307
91 Ga0075365_10006008 3300006038 Bacteria 6629
92 Ga0075365_10112360 3300006038 Bacteria 1873
93 Ga0075363_100034458 3300006048 Bacteria 2643
94 Ga0075432_10020524 3300006058 Bacteria 2259
95 Ga0075362_10018977 3300006177 Bacteria 2854
96 Ga0075362_10053558 3300006177 Bacteria 1811
97 Ga0075367_10017997 3300006178 Bacteria 3890
98 Ga0075366_10001289 3300006195 Bacteria 12493
99 Ga0075366_10001659 3300006195 Bacteria 11175
100 Ga0075366_10002790 3300006195 Bacteria 9032
101 Ga0075366_10044935 3300006195 Bacteria 2618
102 Ga0075366_10047468 3300006195 Bacteria 2545
103 Ga0075366_10050258 3300006195 Bacteria 2475
104 Ga0097621_100182553 3300006237 Bacteria 1813
105 Ga0075370_10001611 3300006353 Bacteria 9962
106 Ga0075370_10003703 3300006353 Bacteria 7321
107 Ga0075370_10039634 3300006353 Bacteria 2655
108 Ga0068871_100065069 3300006358 Bacteria 2986
109 Ga0075436_100267646 3300006914 Bacteria 1220
110 Ga0097620_100456048 3300006931 Bacteria 1374
111 Ga0099826_10019049 3300006948 Bacteria 5167
112 Ga0099826_10218783 3300006948 Bacteria 1027
113 Ga0105250_10003602 3300009092 Bacteria 7293
114 Ga0105240_10006435 3300009093 Bacteria 17267
115 Ga0105240_10133801 3300009093 Bacteria 2970
116 Ga0105240_10247038 3300009093 Bacteria 2066
117 Ga0105245_10024118 3300009098 Bacteria 5341
118 Ga0105243_10003130 3300009148 Bacteria 13590
119 Ga0105243_10081350 3300009148 Bacteria 2644
120 Ga0105248_10004242 3300009177 Bacteria 15862
121 Ga0105248_10362712 3300009177 Bacteria 1631
122 Ga0105237_10065919 3300009545 Bacteria 3616
123 Ga0105238_10005085 3300009551 Bacteria 13004
124 Ga0105238_10071854 3300009551 Bacteria 3457
125 Ga0105249_10203914 3300009553 Bacteria 1936
126 Ga0105239_10043839 3300010375 Bacteria 4905
127 Ga0105239_10337179 3300010375 Bacteria 1701
128 Ga0157343_1003942 3300012488 Bacteria 896
129 Ga0157326_1003322 3300012513 Bacteria 1694
130 Ga0157373_10121768 3300013100 Bacteria 1834
131 Ga0157370_10423524 3300013104 Bacteria 1225
132 Ga0157369_10025878 3300013105 Bacteria 6509
133 Ga0157378_10431660 3300013297 Bacteria 1304
134 Ga0182008_10000070 3300014497 Bacteria 81986
135 Ga0157379_10082217 3300014968 Bacteria 2886
136 Ga0157379_10112290 3300014968 Bacteria 2449
137 Ga0157376_10004660 3300014969 Bacteria 9558
138 Ga0157376_10158068 3300014969 Bacteria 2052
139 Ga0182007_10000289 3300015262 Bacteria 33181
140 Ga0182005_1038226 3300015265 Bacteria 1305
141 Ga0163161_10149356 3300017792 Bacteria 1775
142 Ga0163161_10304929 3300017792 Bacteria 1255
143 Ga0213872_10000070 3300021361 Bacteria 91519
144 Ga0209435_100002 3300025206 Bacteria 794178
145 Ga0209436_104908 3300025208 Bacteria 3205
146 Ga0209436_112451 3300025208 Bacteria 1443
147 Ga0209566_101026 3300025225 Bacteria 11710
148 Ga0209672_100033 3300025228 Bacteria 315326
149 Ga0209672_100034 3300025228 Bacteria 304973
150 Ga0209672_100504 3300025228 Bacteria 21657
151 Ga0209147_100089 3300025229 Bacteria 178350
152 Ga0209147_100191 3300025229 Bacteria 70769
153 Ga0209147_100795 3300025229 Bacteria 15293
154 Ga0209147_101268 3300025229 Bacteria 9874
155 Ga0209563_100005 3300025230 Bacteria 1774893
156 Ga0209258_100023 3300025242 Bacteria 547286
157 Ga0209258_100154 3300025242 Bacteria 158235
158 Ga0209258_100242 3300025242 Bacteria 100588
159 Ga0207425_1000267 3300025245 Bacteria 38528
160 Ga0207425_1001446 3300025245 Bacteria 9918
161 Ga0207425_1002352 3300025245 Bacteria 6748
162 Ga0207425_1002461 3300025245 Bacteria 6500
163 Ga0209646_1000001 3300025246 Bacteria 3092932
164 Ga0209026_1000001 3300025250 Bacteria 1228671
165 Ga0209148_1000029 3300025254 Bacteria 579199
166 Ga0209148_1000145 3300025254 Bacteria 161352
167 Ga0209148_1001246 3300025254 Bacteria 14210
168 Ga0209759_1000001 3300025256 Bacteria 2799452
169 Ga0209759_1002254 3300025256 Bacteria 8766
170 Ga0209129_1000054 3300025258 Bacteria 261997
171 Ga0209129_1003624 3300025258 Bacteria 6579
172 Ga0209129_1005213 3300025258 Bacteria 4710
173 Ga0209565_1000067 3300025263 Bacteria 171247
174 Ga0209565_1000143 3300025263 Bacteria 99302
175 Ga0209565_1000185 3300025263 Bacteria 76451
176 Ga0209565_1000997 3300025263 Bacteria 14548
177 Ga0209565_1003383 3300025263 Bacteria 5195
178 Ga0209455_1000123 3300025272 Bacteria 167231
179 Ga0209455_1000756 3300025272 Bacteria 18315
180 Ga0209673_1000008 3300025273 Bacteria 626013
181 Ga0209673_1000075 3300025273 Bacteria 232555
182 Ga0209673_1000097 3300025273 Bacteria 193482
183 Ga0209673_1000172 3300025273 Bacteria 133472
184 Ga0209673_1000548 3300025273 Bacteria 60849
185 Ga0209673_1000885 3300025273 Bacteria 38688
186 Ga0209130_1000072 3300025284 Bacteria 175726
187 Ga0209130_1000260 3300025284 Bacteria 66399
188 Ga0209130_1000305 3300025284 Bacteria 59541
189 Ga0209130_1000851 3300025284 Bacteria 25239
190 Ga0209130_1002520 3300025284 Bacteria 9002
191 Ga0209675_1000038 3300025291 Bacteria 250481
192 Ga0209675_1000368 3300025291 Bacteria 38358
193 Ga0209675_1000820 3300025291 Bacteria 20466
194 Ga0209675_1002902 3300025291 Bacteria 8484
195 Ga0209675_1002962 3300025291 Bacteria 8375
196 Ga0209675_1003157 3300025291 Bacteria 8009
197 Ga0209675_1005682 3300025291 Bacteria 5154
198 Ga0209676_1000023 3300025292 Bacteria 589732
199 Ga0209676_1000103 3300025292 Bacteria 226908
200 Ga0209676_1001503 3300025292 Bacteria 21291
201 Ga0209676_1002001 3300025292 Bacteria 16100
202 Ga0209676_1007398 3300025292 Bacteria 5164
203 Ga0209676_1013182 3300025292 Bacteria 3194
204 Ga0209676_1017857 3300025292 Bacteria 2494
205 Ga0209025_1000185 3300025294 Bacteria 155366
206 Ga0209025_1000310 3300025294 Bacteria 108186
207 Ga0209025_1000474 3300025294 Bacteria 78060
208 Ga0209025_1001798 3300025294 Bacteria 25444
209 Ga0209025_1009542 3300025294 Bacteria 6741
210 Ga0209025_1012137 3300025294 Bacteria 5566
211 Ga0209564_1000241 3300025295 Bacteria 118237
212 Ga0209564_1000435 3300025295 Bacteria 72434
213 Ga0209564_1000629 3300025295 Bacteria 53834
214 Ga0209564_1001509 3300025295 Bacteria 23296
215 Ga0209564_1005185 3300025295 Bacteria 7556
216 Ga0209758_1000034 3300025297 Bacteria 467637
217 Ga0209758_1005051 3300025297 Bacteria 10479
218 Ga0209758_1011657 3300025297 Bacteria 5055
219 Ga0209050_1000012 3300025298 Bacteria 813717
220 Ga0209050_1000022 3300025298 Bacteria 565239
221 Ga0209050_1000294 3300025298 Bacteria 105705
222 Ga0209050_1001718 3300025298 Bacteria 21856
223 Ga0209050_1001887 3300025298 Bacteria 20109
224 Ga0209050_1007741 3300025298 Bacteria 5928
225 Ga0209050_1009957 3300025298 Bacteria 4767
226 Ga0209050_1021084 3300025298 Bacteria 2392
227 Ga0209256_1000001 3300025299 Bacteria 2166974
228 Ga0209256_1000103 3300025299 Bacteria 193900
229 Ga0209256_1000165 3300025299 Bacteria 135104
230 Ga0207426_1000058 3300025302 Bacteria 363857
231 Ga0207426_1000067 3300025302 Bacteria 342108
232 Ga0207426_1000320 3300025302 Bacteria 92467
233 Ga0209051_1000013 3300025303 Bacteria 565239
234 Ga0209051_1000019 3300025303 Bacteria 511268
235 Ga0209051_1000235 3300025303 Bacteria 92799
236 Ga0209051_1000985 3300025303 Bacteria 27542
237 Ga0209051_1002215 3300025303 Bacteria 14351
238 Ga0209257_1000021 3300025304 Bacteria 771986
239 Ga0209257_1000024 3300025304 Bacteria 726068
240 Ga0209257_1000042 3300025304 Bacteria 537149
241 Ga0209257_1000057 3300025304 Bacteria 396985
242 Ga0209257_1011116 3300025304 Bacteria 4396
243 Ga0209257_1023951 3300025304 Bacteria 2129
244 Ga0209257_1037541 3300025304 Bacteria 1476
245 Ga0207656_10015115 3300025321 Bacteria 2984
246 Ga0207655_1001822 3300025728 Bacteria 18437
247 Ga0207647_10002981 3300025904 Bacteria 12741
248 Ga0207705_10044566 3300025909 Bacteria 3187
249 Ga0207707_10115590 3300025912 Bacteria 2345
250 Ga0207695_10001130 3300025913 Bacteria 46252
251 Ga0207695_10122107 3300025913 Bacteria 2572
252 Ga0207671_10012673 3300025914 Bacteria 6765
253 Ga0207657_10000098 3300025919 Bacteria 83552
254 Ga0207649_10401289 3300025920 Bacteria 1026
255 Ga0207650_10171448 3300025925 Bacteria 1725
256 Ga0207650_10418240 3300025925 Bacteria 1112
257 Ga0207664_10117144 3300025929 Bacteria 2224
258 Ga0207644_10002501 3300025931 Bacteria 11832
259 Ga0207644_10093394 3300025931 Bacteria 2246
260 Ga0207690_10000055 3300025932 Bacteria 102536
261 Ga0207706_10032308 3300025933 Bacteria 4662
262 Ga0207709_10000215 3300025935 Bacteria 73474
263 Ga0207709_10004503 3300025935 Bacteria 8039
264 Ga0207709_10035882 3300025935 Bacteria 2935
265 Ga0207691_10062589 3300025940 Bacteria 3375
266 Ga0207711_10290896 3300025941 Bacteria 1506
267 Ga0207667_10053384 3300025949 Bacteria 4253
268 Ga0207667_10135943 3300025949 Bacteria 2531
269 Ga0207651_10255054 3300025960 Bacteria 1437
270 Ga0207639_10034938 3300026041 Bacteria 3718
271 Ga0207678_10000238 3300026067 Bacteria 49410
272 Ga0207702_10154399 3300026078 Bacteria 2091
273 Ga0207702_10205774 3300026078 Bacteria 1827
274 Ga0207641_10173452 3300026088 Bacteria 1970
275 Ga0207648_10073604 3300026089 Bacteria 2977
276 Ga0207648_10079811 3300026089 Bacteria 2854
277 Ga0207683_10036652 3300026121 Bacteria 4272
278 Ga0207698_10002821 3300026142 Bacteria 10400
279 Ga0209371_1001116 3300027312 Bacteria 19849
280 Ga0209282_1018296 3300027666 Bacteria 4447
281 Ga0209974_10007016 3300027876 Bacteria 3899
282 Ga0209974_10032851 3300027876 Bacteria 1720
283 Ga0207428_10093873 3300027907 Bacteria 2327
284 Ga0268266_10034388 3300028379 Bacteria 4310
285 Ga0268265_10061117 3300028380 Bacteria 2890
286 Ga0268264_10387656 3300028381 Bacteria 1339
287 Ga0307517_10091072 3300028786 Bacteria 2495
288 Ga0307515_10000472 3300028794 Bacteria 96172
289 Ga0307515_10003296 3300028794 Bacteria 34132
290 Ga0307515_10121895 3300028794 Bacteria 2946
291 Ga0307515_10244391 3300028794 Bacteria 1559
292 Ga0307515_10263510 3300028794 Bacteria 1456
293 Ga0268256_1000946 3300030500 Bacteria 19849
294 Ga0316176_1136684 3300030732 Bacteria 2876
295 Ga0316178_1136766 3300030735 Bacteria 3913
296 Ga0316183_1004302 3300030742 Bacteria 3261
297 Ga0316181_1021652 3300030744 Bacteria 2484
298 Ga0316182_1070586 3300030745 Bacteria 3188
299 Ga0265329_10015932 3300031242 Bacteria 2616
300 Ga0265331_10001420 3300031250 Bacteria 17582
301 Ga0265327_10000028 3300031251 Bacteria 361066
302 Ga0265327_10075923 3300031251 Bacteria 1671
303 Ga0307513_10000064 3300031456 Bacteria 141845
304 Ga0307513_10036523 3300031456 Bacteria 5479
305 Ga0307513_10077353 3300031456 Bacteria 3446
306 Ga0307408_100000160 3300031548 Bacteria 74342
307 Ga0307408_100110292 3300031548 Bacteria 2112
308 Ga0307408_100169177 3300031548 Bacteria 1743
309 Ga0307408_100201790 3300031548 Bacteria 1610
310 Ga0307514_10000641 3300031649 Bacteria 63711
311 Ga0307514_10024525 3300031649 Bacteria 4882
312 Ga0265314_10001279 3300031711 Bacteria 28615
313 Ga0265314_10048181 3300031711 Bacteria 2992
314 Ga0265342_10040873 3300031712 Bacteria 2810
315 Ga0265342_10164581 3300031712 Bacteria 1224
316 Ga0307516_10003024 3300031730 Bacteria 21938
317 Ga0307516_10008873 3300031730 Bacteria 11285
318 Ga0307406_10001114 3300031901 Bacteria 14991
319 Ga0307406_10370817 3300031901 Bacteria 1125
320 Ga0307412_10041871 3300031911 Bacteria 2971
321 Ga0307409_100406717 3300031995 Bacteria 1302
322 Ga0307409_100521335 3300031995 Bacteria 1161
323 Ga0307416_100730581 3300032002 Bacteria 1081
324 Ga0307414_10023610 3300032004 Bacteria 3904
325 Ga0307414_10050258 3300032004 Bacteria 2887
326 Ga0307414_10108395 3300032004 Bacteria 2107
327 Ga0307414_10487371 3300032004 Bacteria 1088
328 Ga0307414_10659947 3300032004 Bacteria 943
329 Ga0307411_10085391 3300032005 Bacteria 2186
330 Ga0373940_0003724 3300035088 Bacteria 3145
331 Ga0373939_0000140 3300035114 Bacteria 20643
332 Ga0373931_0000353 3300035691 Bacteria 18867
333 Ga0373937_0696094 3300036401 Bacteria 963
334 Ga0395899_0011767 3300037312 Bacteria 6696
335 Ga0395899_0044197 3300037312 Bacteria 3321
336 Ga0395900_0029407 3300037418 Bacteria 5636
337 Ga0395900_0059608 3300037418 Bacteria 3930
338 Ga0395898_0003443 3300037466 Bacteria 17693
339 Ga0395898_0018549 3300037466 Bacteria 7093
340 Ga0395905_0000043 3300037471 Bacteria 247469
341 Ga0395905_0005270 3300037471 Bacteria 13222
342 Ga0395905_0040202 3300037471 Bacteria 4386
343 Ga0395905_0042923 3300037471 Bacteria 4243
344 Ga0395905_0051564 3300037471 Bacteria 3854
345 Ga0395901_0033252 3300038443 Bacteria 5322
346 Ga0395901_0066417 3300038443 Bacteria 3757
347 Ga0436365_0238213 3300039437 Bacteria 3310
348 Ga0436361_0260800 3300039447 Bacteria 1516
349 Ga0436361_0812713 3300039447 Bacteria 39089
350 Ga0439436_0001226 3300041404 Bacteria 7308
351 Ga0439436_0014006 3300041404 Bacteria 2424
352 Ga0439466_0004836 3300041411 Bacteria 5179
353 Ga0439466_0010808 3300041411 Bacteria 3389
354 Ga0439465_0001421 3300041413 Bacteria 7746
355 Ga0439431_0000611 3300041997 Bacteria 7582
356 Ga0439433_0000817 3300041999 Bacteria 6169
357 Ga0439442_005071 3300042002 Bacteria 2633
358 Ga0439445_0001029 3300042004 Bacteria 5942
359 Ga0439432_001181 3300042006 Bacteria 9880
360 Ga0439449_0000581 3300042007 Bacteria 13701
361 Ga0439449_0002198 3300042007 Bacteria 7679
362 Ga0439449_0026391 3300042007 Bacteria 2168
363 Ga0439452_012398 3300042010 Bacteria 2427
364 Ga0439457_010018 3300042014 Bacteria 2191
365 Ga0439462_0000785 3300042015 Bacteria 6603
366 Ga0439462_0005369 3300042015 Bacteria 3157
367 Ga0450917_000004 3300042120 Bacteria 9152
368 Ga0450919_005461 3300042121 Bacteria 1526
369 Ga0450920_005154 3300042122 Bacteria 2317
370 Ga0450921_000038 3300042123 Bacteria 3362
371 Ga0450923_041023 3300042125 Bacteria 972
372 Ga0450891_000928 3300042129 Bacteria 3056
373 Ga0450892_000986 3300042130 Bacteria 3027
374 Ga0450894_003218 3300042131 Bacteria 2143
375 Ga0450889_000148 3300042144 Bacteria 7104
376 Ga0450906_004756 3300042145 Bacteria 2828
377 Ga0439446_0000431 3300042156 Bacteria 8211
378 Ga0439446_0026018 3300042156 Bacteria 1674
379 Ga0450908_000667 3300042184 Bacteria 6605
380 Ga0439434_0010056 3300042435 Bacteria 2786
381 Ga0450918_001718 3300042531 Bacteria 4262
382 Ga0450893_0001655 3300042532 Bacteria 3430
383 Ga0450893_0002199 3300042532 Bacteria 3036
384 Ga0450893_0007459 3300042532 Bacteria 1778
385 Ga0451577_0013885 3300042876 Bacteria 7522
386 Ga0451577_0087490 3300042876 Bacteria 2779
387 Ga0451577_0341639 3300042876 Bacteria 1358
388 Ga0466965_0008623 3300044683 Bacteria 4717
389 Ga0466961_0079017 3300044693 Bacteria 2083
390 Ga0453684_0006446 3300044712 Bacteria 22283
391 Ga0453684_0207043 3300044712 Bacteria 2282
392 Ga0453684_0330275 3300044712 Bacteria 1724
393 Ga0453684_0342741 3300044712 Bacteria 1687
394 Ga0466960_0019788 3300044901 Bacteria 2972
395 Ga0466959_0241873 3300045049 Bacteria 1246
396 Ga0451576_0003864 3300045051 Bacteria 20090
397 Ga0451576_0352393 3300045051 Bacteria 1541
398 Ga0495627_016496 3300046453 Bacteria 2527
399 Ga0495650_0001967 3300046471 Bacteria 18141
400 Ga0495639_0002555 3300046475 Bacteria 7936
401 Ga0495607_0000480 3300046501 Bacteria 39938
402 Ga0495610_0047230 3300046512 Bacteria 2119
403 Ga0495610_0051200 3300046512 Bacteria 2011
404 Ga0495620_0013399 3300046515 Bacteria 4198
405 Ga0495631_0000123 3300046518 Bacteria 51897
406 Ga0495648_0138357 3300046524 Bacteria 1285
407 Ga0495642_0038313 3300046528 Bacteria 1942
408 Ga0495621_0006963 3300046539 Bacteria 3327
409 Ga0495633_0000458 3300046558 Bacteria 41814
410 Ga0495656_0034791 3300046615 Bacteria 2065
411 Ga0495656_0067992 3300046615 Bacteria 1574
412 Ga0495625_0000661 3300046660 Bacteria 49248
413 Ga0495625_0052337 3300046660 Bacteria 2924
414 Ga0495588_0041143 3300046674 Bacteria 2359
415 Ga0495670_0094728 3300046691 Bacteria 1531
416 Ga0495671_0101776 3300046692 Bacteria 1404
417 Ga0495660_0073063 3300046810 Bacteria 1815
418 Ga0495676_0228971 3300047321 Bacteria 1277
419 Ga0495593_0035411 3300047673 Bacteria 2711
420 Ga0496100_0019529 3300048903 Bacteria 4045
421 Ga0496101_0008376 3300048904 Bacteria 6756
422 Ga0496101_0015984 3300048904 Bacteria 5064
423 Ga0496102_0004638 3300048905 Bacteria 11630
424 Ga0496102_0078740 3300048905 Bacteria 3035
425 Ga0496103_0112725 3300048906 Bacteria 1728
426 Ga0496104_0002111 3300048907 Bacteria 17262
427 Ga0496104_0031140 3300048907 Bacteria 4960
428 Ga0496107_0102781 3300048910 Bacteria 2096
429 Ga0496110_0130673 3300048913 Bacteria 2267
430 Ga0496113_0185745 3300048916 Bacteria 1649
431 Ga0496113_0230364 3300048916 Bacteria 1477
432 Ga0496114_0125020 3300048917 Bacteria 2216
433 Ga0496116_0098545 3300048919 Bacteria 1753
434 Ga0496117_0021380 3300048920 Bacteria 5237
435 Ga0496117_0050367 3300048920 Bacteria 2953
436 Ga0496117_0081878 3300048920 Bacteria 2116
437 Ga0496118_0136960 3300048921 Bacteria 1560
438 Ga0496122_0000204 3300048925 Bacteria 132123
439 Ga0496123_0001226 3300048926 Bacteria 37377
440 Ga0496123_0055090 3300048926 Bacteria 2611
441 Ga0496123_0222030 3300048926 Bacteria 952
442 Ga0496124_0094008 3300048927 Bacteria 2439
443 Ga0496124_0117231 3300048927 Bacteria 2133
444 Ga0496125_0002426 3300048928 Bacteria 24246
445 Ga0496125_0033202 3300048928 Bacteria 4572
446 Ga0496126_0010476 3300048929 Bacteria 9711
447 Ga0501031_0148380 3300049568 Bacteria 1532
448 Ga0501034_0061426 3300049571 Bacteria 3773
449 Ga0501034_0223754 3300049571 Bacteria 1833
450 Ga0501034_0315329 3300049571 Bacteria 1497
451 Ga0501038_0285026 3300049574 Bacteria 1299
452 Ga0501039_0092947 3300049575 Bacteria 2351
453 Ga0501047_0095318 3300049581 Bacteria 2855
454 Ga0501076_0085483 3300049592 Bacteria 2535
455 Ga0501035_0128669 3300049822 Bacteria 2209
456 Ga0501035_0228395 3300049822 Bacteria 1587
457 Ga0501035_0420788 3300049822 Bacteria 1109
458 Ga0501044_0006926 3300049823 Bacteria 12479
459 Ga0501045_0072768 3300049824 Bacteria 2531
460 nmdc:mga03683_190646_c1 3300050489 Bacteria 938
461 nmdc:mga03n38_53415_c1 3300050490 Bacteria 1812
462 nmdc:mga00v17_44916_c1 3300050491 Bacteria 2667
463 nmdc:mga0yw44_36273_c1 3300050492 Bacteria 2905
464 nmdc:mga0k408_108688_c1 3300050493 Bacteria 1638
465 nmdc:mga0k408_13895_c1 3300050493 Bacteria 4425
466 nmdc:mga0k408_194977_c1 3300050493 Bacteria 1209
467 nmdc:mga0k408_25013_c1 3300050493 Bacteria 3379
468 nmdc:mga0k408_31573_c2 3300050493 Bacteria 1094
469 nmdc:mga0k408_60015_c1 3300050493 Bacteria 2210
470 nmdc:mga0k408_62154_c1 3300050493 Bacteria 2171
471 nmdc:mga0k408_95453_c1 3300050493 Bacteria 1750
472 nmdc:mga07m45_141636_c1 3300050496 Bacteria 1393
473 nmdc:mga07m45_1804_c1 3300050496 Bacteria 9867
474 nmdc:mga07m45_2760_c1 3300050496 Bacteria 8285
475 nmdc:mga07m45_3914_c1 3300050496 Bacteria 7236
476 nmdc:mga0sz30_186446_c1 3300050516 Bacteria 921
477 Ga0500646_0026432 3300053090 Bacteria 1573
478 Ga0500651_0000587 3300053093 Bacteria 18283
479 Ga0500562_009992 3300053108 Bacteria 2401
480 Ga0500571_000163 3300053110 Bacteria 23380
481 Ga0500593_006394 3300053117 Bacteria 4711
482 Ga0500593_008058 3300053117 Bacteria 4316
483 Ga0500607_007342 3300053121 Bacteria 6828
484 Ga0500608_017874 3300053122 Bacteria 3228
485 Ga0500618_029850 3300053125 Bacteria 1285
486 Ga0500626_038011 3300053128 Bacteria 2177
487 Ga0500655_006237 3300053133 Bacteria 2147
488 Ga0500658_0000314 3300053134 Bacteria 21651
489 Ga0500658_0000476 3300053134 Bacteria 17115
490 Ga0500559_0018106 3300053136 Bacteria 2977
491 Ga0500568_0001888 3300053139 Bacteria 12905
492 Ga0500574_002257 3300053141 Bacteria 3129
493 Ga0500616_0005383 3300053153 Bacteria 8700
494 Ga0500622_0066694 3300053156 Bacteria 1827
495 Ga0500627_0000392 3300053158 Bacteria 11733
496 Ga0500634_0054341 3300053161 Bacteria 2146
497 Ga0500638_007950 3300053162 Bacteria 4485
498 Ga0500645_004482 3300053730 Bacteria 5345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10002501 Ga0207644_100025016 255
2 3300005336 Ga0070680_100042806 Ga0070680_1000428062 257
3 3300005530 Ga0070679_100002110 Ga0070679_10000211015 257
4 3300025912 Ga0207707_10115590 Ga0207707_101155902 257
5 3300049571 Ga0501034_0223754 Ga0501034_0223754_775_1578 260
6 3300049571 Ga0501034_0315329 Ga0501034_0315329_439_1242 260
7 3300049574 Ga0501038_0285026 Ga0501038_0285026_48_851 260
8 iso_pu_bacteria 2643221585 2643933137 261
9 iso_pu_bacteria 2643221656 2644314386 261
10 3300049822 Ga0501035_0128669 Ga0501035_0128669_881_1690 262
11 3300036401 Ga0373937_0696094 Ga0373937_0696094_106_909 263
12 3300031995 Ga0307409_100406717 Ga0307409_1004067172 264
13 3300005456 Ga0070678_100006053 Ga0070678_1000060539 265
14 3300031456 Ga0307513_10000064 Ga0307513_1000006492 265
15 3300031548 Ga0307408_100201790 Ga0307408_1002017903 265
16 3300031730 Ga0307516_10003024 Ga0307516_1000302413 265
17 3300046512 Ga0495610_0051200 Ga0495610_0051200_240_1037 265
18 3300046515 Ga0495620_0013399 Ga0495620_0013399_1758_2555 265
19 3300046674 Ga0495588_0041143 Ga0495588_0041143_601_1398 265
20 3300046691 Ga0495670_0094728 Ga0495670_0094728_709_1506 265
21 3300050516 nmdc:mga0sz30_186446_c1 nmdc:mga0sz30_186446_c1_18_815 265
22 3300053117 Ga0500593_006394 Ga0500593_006394_3878_4675 265
23 3300053161 Ga0500634_0054341 Ga0500634_0054341_1029_1826 265
24 3300039447 Ga0436361_0260800 Ga0436361_0260800_220_1026 267
25 3300021361 Ga0213872_10000070 Ga0213872_1000007075 268
26 3300039447 Ga0436361_0812713 Ga0436361_0812713_37451_38266 268
27 3300046528 Ga0495642_0038313 Ga0495642_0038313_1051_1905 268
28 3300012488 Ga0157343_1003942 Ga0157343_10039421 270
29 3300048926 Ga0496123_0055090 Ga0496123_0055090_1551_2480 270
30 3300048928 Ga0496125_0002426 Ga0496125_0002426_8340_9269 270
31 3300048929 Ga0496126_0010476 Ga0496126_0010476_5314_6243 270
32 3300032004 Ga0307414_10050258 Ga0307414_100502582 272
33 iso_pu_bacteria 2643221639 2644217280 272
34 iso_pu_bacteria 2643221646 2644258949 272
35 iso_pu_bacteria 2738541337 2739055686 272
36 iso_pu_bacteria 8002392321 8002395643 272
37 3300028794 Ga0307515_10244391 Ga0307515_102443912 273
38 3300031456 Ga0307513_10077353 Ga0307513_100773533 273
39 iso_pu_bacteria 8048746797 8048747257 273
40 3300005844 Ga0068862_100021641 Ga0068862_1000216414 274
41 3300028786 Ga0307517_10091072 Ga0307517_100910722 274
42 3300031250 Ga0265331_10001420 Ga0265331_100014207 274
43 3300031251 Ga0265327_10000028 Ga0265327_1000002887 274
44 3300031730 Ga0307516_10008873 Ga0307516_1000887310 274
45 iso_pu_bacteria 2513020051 2513231292 274
46 iso_pu_bacteria 2599185214 2599623340 274
47 iso_pu_bacteria 2599185226 2599675442 274
48 iso_pu_bacteria 2599185227 2599680945 274
49 iso_pu_bacteria 2599185229 2599692960 274
50 iso_pu_bacteria 2643221544 2643746386 274
51 iso_pu_bacteria 2643221628 2644161896 274
52 iso_pu_bacteria 2643221658 2644325501 274
53 iso_pu_bacteria 2643221672 2644399225 274
54 iso_pu_bacteria 2643221683 2644467091 274
55 iso_pu_bacteria 2738541277 2738718249 274
56 iso_pu_bacteria 2738541307 2738882626 274
57 iso_pu_bacteria 2738543019 2739281436 274
58 iso_pu_bacteria 2818991446 2819600516 274
59 iso_pu_bacteria 2831265667 2831267758 274
60 iso_pu_bacteria 2838054893 2838061514 274
61 iso_pu_bacteria 2842677519 2842677583 274
62 iso_pu_bacteria 2885198086 2885198773 274
63 iso_pu_bacteria 2885211737 2885211847 274
64 iso_pu_bacteria 2899924645 2899928337 274
65 iso_pu_bacteria 2904449895 2904451873 274
66 iso_pu_bacteria 2904456579 2904462470 274
67 iso_pu_bacteria 2919462493 2919467143 274
68 iso_pu_bacteria 2928037797 2928041289 274
69 iso_pu_bacteria 2928044640 2928048131 274
70 iso_pu_bacteria 2928051484 2928055972 274
71 iso_pu_bacteria 2928064002 2928066547 274
72 iso_pu_bacteria 2928070936 2928077299 274
73 iso_pu_bacteria 2928084124 2928087600 274
74 iso_pu_bacteria 2929520902 2929523583 274
75 iso_pu_bacteria 2945945610 2945946175 274
76 iso_pu_bacteria 2945972063 2945975775 274
77 3300005614 Ga0068856_100242689 Ga0068856_1002426893 275
78 3300006177 Ga0075362_10018977 Ga0075362_100189772 275
79 3300025292 Ga0209676_1002001 Ga0209676_10020019 275
80 3300025294 Ga0209025_1012137 Ga0209025_10121374 275
81 3300026078 Ga0207702_10205774 Ga0207702_102057742 275
82 3300049581 Ga0501047_0095318 Ga0501047_0095318_669_1523 275
83 3300049823 Ga0501044_0006926 Ga0501044_0006926_2007_2861 275
84 iso_pu_bacteria 2904479285 2904481729 275
85 iso_pu_bacteria 2904541872 2904545070 275
86 iso_pu_bacteria 2929160207 2929165248 275
87 iso_pu_bacteria 2945909444 2945910147 275
88 iso_pu_bacteria 2945984333 2945987837 275
89 iso_pu_bacteria 2954767861 2954768775 275
90 3300006353 Ga0075370_10039634 Ga0075370_100396343 276
91 3300009148 Ga0105243_10081350 Ga0105243_100813503 276
92 3300009553 Ga0105249_10203914 Ga0105249_102039143 276
93 3300025298 Ga0209050_1007741 Ga0209050_10077412 276
94 3300025304 Ga0209257_1000021 Ga0209257_1000021537 276
95 3300025304 Ga0209257_1023951 Ga0209257_10239512 276
96 3300025935 Ga0207709_10035882 Ga0207709_100358823 276
97 3300028794 Ga0307515_10121895 Ga0307515_101218952 276
98 3300031548 Ga0307408_100000160 Ga0307408_1000001603 276
99 3300032004 Ga0307414_10023610 Ga0307414_100236102 276
100 3300042120 Ga0450917_000004 Ga0450917_000004_439_1269 276
101 3300042129 Ga0450891_000928 Ga0450891_000928_69_899 276
102 3300042130 Ga0450892_000986 Ga0450892_000986_1149_1979 276
103 3300042144 Ga0450889_000148 Ga0450889_000148_1060_1890 276
104 3300042532 Ga0450893_0002199 Ga0450893_0002199_166_996 276
105 3300044712 Ga0453684_0330275 Ga0453684_0330275_445_1281 276
106 3300049822 Ga0501035_0420788 Ga0501035_0420788_134_973 276
107 3300002987 JGI25159J45721_1000982 JGI25159J45721_10009824 277
108 3300003215 JGI25153J46596_10045169 JGI25153J46596_100451692 277
109 3300003354 JGI25160J50197_1000149 JGI25160J50197_100014924 277
110 3300003374 JGI25161J50226_1000149 JGI25161J50226_100014912 277
111 3300003374 JGI25161J50226_1000177 JGI25161J50226_100017724 277
112 3300004625 Ga0055543_1000338 Ga0055543_100033821 277
113 3300005459 Ga0068867_100126681 Ga0068867_1001266813 277
114 3300006914 Ga0075436_100267646 Ga0075436_1002676462 277
115 3300014497 Ga0182008_10000070 Ga0182008_1000007060 277
116 3300025208 Ga0209436_112451 Ga0209436_1124512 277
117 3300025245 Ga0207425_1001446 Ga0207425_10014467 277
118 3300025263 Ga0209565_1000997 Ga0209565_10009972 277
119 3300025284 Ga0209130_1000072 Ga0209130_1000072140 277
120 3300025291 Ga0209675_1003157 Ga0209675_10031572 277
121 3300025297 Ga0209758_1005051 Ga0209758_10050515 277
122 3300025298 Ga0209050_1001887 Ga0209050_100188710 277
123 3300025302 Ga0207426_1000320 Ga0207426_100032055 277
124 3300026089 Ga0207648_10079811 Ga0207648_100798112 277
125 3300032004 Ga0307414_10108395 Ga0307414_101083952 277
126 3300046539 Ga0495621_0006963 Ga0495621_0006963_885_1721 277
127 3300048916 Ga0496113_0185745 Ga0496113_0185745_336_1172 277
128 3300050493 nmdc:mga0k408_60015_c1 nmdc:mga0k408_60015_c1_1354_2199 277
129 iso_pu_bacteria 2842733646 2842736316 277
130 iso_pu_bacteria 2842747753 2842748827 277
131 iso_pu_bacteria 2881101125 2881103053 277
132 3300001979 JGI24740J21852_10005909 JGI24740J21852_100059096 278
133 3300003374 JGI25161J50226_1002972 JGI25161J50226_10029724 278
134 3300003374 JGI25161J50226_1006753 JGI25161J50226_10067532 278
135 3300003578 Ga0006562J51391_1054038 Ga0006562J51391_10540386 278
136 3300003761 Ga0055535_1001829 Ga0055535_10018295 278
137 3300003762 Ga0055542_1000062 Ga0055542_1000062118 278
138 3300003773 Ga0055537_1000217 Ga0055537_10002175 278
139 3300003781 Ga0055536_1004931 Ga0055536_10049317 278
140 3300003781 Ga0055536_1033041 Ga0055536_10330412 278
141 3300003784 Ga0055534_1000106 Ga0055534_100010638 278
142 3300003791 Ga0055530_10014659 Ga0055530_100146592 278
143 3300003791 Ga0055530_10017384 Ga0055530_100173842 278
144 3300003792 Ga0055540_1023225 Ga0055540_10232252 278
145 3300003792 Ga0055540_1023728 Ga0055540_10237282 278
146 3300003794 Ga0055531_10024129 Ga0055531_100241292 278
147 3300004625 Ga0055543_1001864 Ga0055543_10018642 278
148 3300005262 Ga0065165_1010149 Ga0065165_10101492 278
149 3300005262 Ga0065165_1017065 Ga0065165_10170652 278
150 3300005289 Ga0065704_10139897 Ga0065704_101398972 278
151 3300005335 Ga0070666_10245822 Ga0070666_102458221 278
152 3300005355 Ga0070671_100008076 Ga0070671_1000080764 278
153 3300005356 Ga0070674_100063572 Ga0070674_1000635722 278
154 3300005364 Ga0070673_100306768 Ga0070673_1003067682 278
155 3300005366 Ga0070659_100226068 Ga0070659_1002260682 278
156 3300005539 Ga0068853_100048143 Ga0068853_1000481432 278
157 3300005539 Ga0068853_100262739 Ga0068853_1002627393 278
158 3300005548 Ga0070665_100049015 Ga0070665_1000490156 278
159 3300005548 Ga0070665_100533331 Ga0070665_1005333311 278
160 3300005563 Ga0068855_100262226 Ga0068855_1002622262 278
161 3300005564 Ga0070664_100030827 Ga0070664_1000308273 278
162 3300005616 Ga0068852_100090091 Ga0068852_1000900914 278
163 3300005834 Ga0068851_10004978 Ga0068851_100049784 278
164 3300005844 Ga0068862_100058338 Ga0068862_1000583382 278
165 3300006038 Ga0075365_10112360 Ga0075365_101123602 278
166 3300006048 Ga0075363_100034458 Ga0075363_1000344582 278
167 3300006177 Ga0075362_10053558 Ga0075362_100535582 278
168 3300006178 Ga0075367_10017997 Ga0075367_100179974 278
169 3300006195 Ga0075366_10001289 Ga0075366_1000128910 278
170 3300006195 Ga0075366_10001659 Ga0075366_100016597 278
171 3300006195 Ga0075366_10047468 Ga0075366_100474682 278
172 3300006195 Ga0075366_10050258 Ga0075366_100502583 278
173 3300006237 Ga0097621_100182553 Ga0097621_1001825532 278
174 3300006353 Ga0075370_10001611 Ga0075370_100016114 278
175 3300006358 Ga0068871_100065069 Ga0068871_1000650694 278
176 3300006948 Ga0099826_10019049 Ga0099826_100190492 278
177 3300006948 Ga0099826_10218783 Ga0099826_102187831 278
178 3300009148 Ga0105243_10003130 Ga0105243_1000313013 278
179 3300009177 Ga0105248_10004242 Ga0105248_100042424 278
180 3300009545 Ga0105237_10065919 Ga0105237_100659193 278
181 3300009551 Ga0105238_10071854 Ga0105238_100718542 278
182 3300013104 Ga0157370_10423524 Ga0157370_104235241 278
183 3300013105 Ga0157369_10025878 Ga0157369_100258784 278
184 3300013297 Ga0157378_10431660 Ga0157378_104316602 278
185 3300014968 Ga0157379_10112290 Ga0157379_101122903 278
186 3300014969 Ga0157376_10158068 Ga0157376_101580683 278
187 3300015265 Ga0182005_1038226 Ga0182005_10382261 278
188 3300017792 Ga0163161_10149356 Ga0163161_101493562 278
189 3300025208 Ga0209436_104908 Ga0209436_1049082 278
190 3300025228 Ga0209672_100504 Ga0209672_1005044 278
191 3300025229 Ga0209147_100795 Ga0209147_1007952 278
192 3300025230 Ga0209563_100005 Ga0209563_1000051148 278
193 3300025242 Ga0209258_100154 Ga0209258_10015457 278
194 3300025245 Ga0207425_1000267 Ga0207425_10002672 278
195 3300025245 Ga0207425_1002352 Ga0207425_10023522 278
196 3300025254 Ga0209148_1000145 Ga0209148_100014557 278
197 3300025258 Ga0209129_1000054 Ga0209129_100005496 278
198 3300025258 Ga0209129_1003624 Ga0209129_10036247 278
199 3300025258 Ga0209129_1005213 Ga0209129_10052132 278
200 3300025263 Ga0209565_1000067 Ga0209565_1000067121 278
201 3300025263 Ga0209565_1000185 Ga0209565_100018531 278
202 3300025263 Ga0209565_1003383 Ga0209565_10033834 278
203 3300025273 Ga0209673_1000097 Ga0209673_1000097123 278
204 3300025273 Ga0209673_1000172 Ga0209673_1000172102 278
205 3300025273 Ga0209673_1000548 Ga0209673_10005489 278
206 3300025273 Ga0209673_1000885 Ga0209673_10008856 278
207 3300025284 Ga0209130_1000260 Ga0209130_10002602 278
208 3300025284 Ga0209130_1000851 Ga0209130_100085117 278
209 3300025291 Ga0209675_1000038 Ga0209675_1000038123 278
210 3300025291 Ga0209675_1000368 Ga0209675_100036841 278
211 3300025291 Ga0209675_1002962 Ga0209675_10029627 278
212 3300025291 Ga0209675_1005682 Ga0209675_10056822 278
213 3300025292 Ga0209676_1000103 Ga0209676_100010343 278
214 3300025292 Ga0209676_1001503 Ga0209676_100150314 278
215 3300025292 Ga0209676_1007398 Ga0209676_10073983 278
216 3300025292 Ga0209676_1017857 Ga0209676_10178572 278
217 3300025294 Ga0209025_1000185 Ga0209025_1000185131 278
218 3300025294 Ga0209025_1000310 Ga0209025_100031047 278
219 3300025294 Ga0209025_1000474 Ga0209025_100047433 278
220 3300025294 Ga0209025_1001798 Ga0209025_100179823 278
221 3300025295 Ga0209564_1000241 Ga0209564_100024140 278
222 3300025295 Ga0209564_1000629 Ga0209564_100062957 278
223 3300025295 Ga0209564_1005185 Ga0209564_10051855 278
224 3300025297 Ga0209758_1000034 Ga0209758_1000034342 278
225 3300025297 Ga0209758_1011657 Ga0209758_10116572 278
226 3300025298 Ga0209050_1000012 Ga0209050_1000012428 278
227 3300025298 Ga0209050_1000294 Ga0209050_100029444 278
228 3300025298 Ga0209050_1001718 Ga0209050_100171812 278
229 3300025298 Ga0209050_1021084 Ga0209050_10210843 278
230 3300025299 Ga0209256_1000103 Ga0209256_100010398 278
231 3300025299 Ga0209256_1000165 Ga0209256_100016557 278
232 3300025302 Ga0207426_1000058 Ga0207426_1000058226 278
233 3300025302 Ga0207426_1000067 Ga0207426_1000067231 278
234 3300025303 Ga0209051_1000019 Ga0209051_1000019347 278
235 3300025303 Ga0209051_1000235 Ga0209051_10002357 278
236 3300025303 Ga0209051_1000985 Ga0209051_100098514 278
237 3300025303 Ga0209051_1002215 Ga0209051_10022152 278
238 3300025304 Ga0209257_1000024 Ga0209257_1000024374 278
239 3300025304 Ga0209257_1000057 Ga0209257_1000057286 278
240 3300025304 Ga0209257_1011116 Ga0209257_10111162 278
241 3300025304 Ga0209257_1037541 Ga0209257_10375412 278
242 3300025321 Ga0207656_10015115 Ga0207656_100151154 278
243 3300025728 Ga0207655_1001822 Ga0207655_10018227 278
244 3300025920 Ga0207649_10401289 Ga0207649_104012891 278
245 3300025925 Ga0207650_10418240 Ga0207650_104182402 278
246 3300025931 Ga0207644_10093394 Ga0207644_100933942 278
247 3300025933 Ga0207706_10032308 Ga0207706_100323084 278
248 3300025935 Ga0207709_10000215 Ga0207709_1000021542 278
249 3300025935 Ga0207709_10004503 Ga0207709_100045037 278
250 3300025949 Ga0207667_10135943 Ga0207667_101359434 278
251 3300025960 Ga0207651_10255054 Ga0207651_102550542 278
252 3300026041 Ga0207639_10034938 Ga0207639_100349384 278
253 3300026089 Ga0207648_10073604 Ga0207648_100736044 278
254 3300027666 Ga0209282_1018296 Ga0209282_10182964 278
255 3300027876 Ga0209974_10007016 Ga0209974_100070163 278
256 3300028379 Ga0268266_10034388 Ga0268266_100343886 278
257 3300028380 Ga0268265_10061117 Ga0268265_100611172 278
258 3300028794 Ga0307515_10263510 Ga0307515_102635102 278
259 3300030732 Ga0316176_1136684 Ga0316176_11366841 278
260 3300030735 Ga0316178_1136766 Ga0316178_11367664 278
261 3300030742 Ga0316183_1004302 Ga0316183_10043022 278
262 3300030744 Ga0316181_1021652 Ga0316181_10216522 278
263 3300030745 Ga0316182_1070586 Ga0316182_10705862 278
264 3300031548 Ga0307408_100169177 Ga0307408_1001691771 278
265 3300031649 Ga0307514_10024525 Ga0307514_100245254 278
266 3300031901 Ga0307406_10001114 Ga0307406_100011142 278
267 3300031901 Ga0307406_10370817 Ga0307406_103708172 278
268 3300032002 Ga0307416_100730581 Ga0307416_1007305812 278
269 3300032004 Ga0307414_10487371 Ga0307414_104873712 278
270 3300032004 Ga0307414_10659947 Ga0307414_106599471 278
271 3300032005 Ga0307411_10085391 Ga0307411_100853912 278
272 3300035088 Ga0373940_0003724 Ga0373940_0003724_1876_2718 278
273 3300035114 Ga0373939_0000140 Ga0373939_0000140_11171_12013 278
274 3300035691 Ga0373931_0000353 Ga0373931_0000353_13560_14402 278
275 3300037471 Ga0395905_0005270 Ga0395905_0005270_7048_7887 278
276 3300041404 Ga0439436_0014006 Ga0439436_0014006_775_1611 278
277 3300042002 Ga0439442_005071 Ga0439442_005071_838_1674 278
278 3300042121 Ga0450919_005461 Ga0450919_005461_137_973 278
279 3300042122 Ga0450920_005154 Ga0450920_005154_498_1334 278
280 3300042123 Ga0450921_000038 Ga0450921_000038_1702_2538 278
281 3300042125 Ga0450923_041023 Ga0450923_041023_106_942 278
282 3300042131 Ga0450894_003218 Ga0450894_003218_960_1796 278
283 3300042145 Ga0450906_004756 Ga0450906_004756_749_1585 278
284 3300042156 Ga0439446_0000431 Ga0439446_0000431_295_1131 278
285 3300042184 Ga0450908_000667 Ga0450908_000667_4912_5748 278
286 3300042435 Ga0439434_0010056 Ga0439434_0010056_416_1252 278
287 3300042531 Ga0450918_001718 Ga0450918_001718_1054_1890 278
288 3300042876 Ga0451577_0013885 Ga0451577_0013885_6193_7068 278
289 3300044712 Ga0453684_0006446 Ga0453684_0006446_17834_18685 278
290 3300044712 Ga0453684_0342741 Ga0453684_0342741_227_1102 278
291 3300045051 Ga0451576_0003864 Ga0451576_0003864_14572_15447 278
292 3300046453 Ga0495627_016496 Ga0495627_016496_879_1715 278
293 3300046471 Ga0495650_0001967 Ga0495650_0001967_638_1525 278
294 3300046512 Ga0495610_0047230 Ga0495610_0047230_324_1160 278
295 3300046518 Ga0495631_0000123 Ga0495631_0000123_676_1512 278
296 3300046524 Ga0495648_0138357 Ga0495648_0138357_59_895 278
297 3300046660 Ga0495625_0000661 Ga0495625_0000661_1094_1930 278
298 3300046660 Ga0495625_0052337 Ga0495625_0052337_1291_2127 278
299 3300047321 Ga0495676_0228971 Ga0495676_0228971_411_1247 278
300 3300047673 Ga0495593_0035411 Ga0495593_0035411_542_1378 278
301 3300048904 Ga0496101_0015984 Ga0496101_0015984_908_1744 278
302 3300048905 Ga0496102_0078740 Ga0496102_0078740_353_1189 278
303 3300048907 Ga0496104_0031140 Ga0496104_0031140_1602_2465 278
304 3300048916 Ga0496113_0230364 Ga0496113_0230364_286_1149 278
305 3300048920 Ga0496117_0021380 Ga0496117_0021380_1998_2834 278
306 3300048920 Ga0496117_0081878 Ga0496117_0081878_1112_1948 278
307 3300048921 Ga0496118_0136960 Ga0496118_0136960_701_1537 278
308 3300048925 Ga0496122_0000204 Ga0496122_0000204_97253_98098 278
309 3300048926 Ga0496123_0001226 Ga0496123_0001226_3081_3926 278
310 3300048926 Ga0496123_0222030 Ga0496123_0222030_88_924 278
311 3300048927 Ga0496124_0094008 Ga0496124_0094008_1137_1982 278
312 3300048927 Ga0496124_0117231 Ga0496124_0117231_887_1723 278
313 3300048928 Ga0496125_0033202 Ga0496125_0033202_1524_2360 278
314 3300050490 nmdc:mga03n38_53415_c1 nmdc:mga03n38_53415_c1_912_1748 278
315 3300050491 nmdc:mga00v17_44916_c1 nmdc:mga00v17_44916_c1_341_1177 278
316 3300050492 nmdc:mga0yw44_36273_c1 nmdc:mga0yw44_36273_c1_1087_1923 278
317 3300050493 nmdc:mga0k408_108688_c1 nmdc:mga0k408_108688_c1_605_1459 278
318 3300050493 nmdc:mga0k408_13895_c1 nmdc:mga0k408_13895_c1_729_1580 278
319 3300050493 nmdc:mga0k408_194977_c1 nmdc:mga0k408_194977_c1_280_1122 278
320 3300050493 nmdc:mga0k408_25013_c1 nmdc:mga0k408_25013_c1_1500_2336 278
321 3300050493 nmdc:mga0k408_31573_c2 nmdc:mga0k408_31573_c2_20_883 278
322 3300050493 nmdc:mga0k408_62154_c1 nmdc:mga0k408_62154_c1_304_1143 278
323 3300050496 nmdc:mga07m45_1804_c1 nmdc:mga07m45_1804_c1_6882_7718 278
324 3300050496 nmdc:mga07m45_2760_c1 nmdc:mga07m45_2760_c1_1958_2794 278
325 3300050496 nmdc:mga07m45_3914_c1 nmdc:mga07m45_3914_c1_5278_6114 278
326 3300053090 Ga0500646_0026432 Ga0500646_0026432_16_861 278
327 3300053093 Ga0500651_0000587 Ga0500651_0000587_1009_1845 278
328 3300053108 Ga0500562_009992 Ga0500562_009992_57_893 278
329 3300053110 Ga0500571_000163 Ga0500571_000163_4559_5395 278
330 3300053121 Ga0500607_007342 Ga0500607_007342_680_1516 278
331 3300053122 Ga0500608_017874 Ga0500608_017874_177_1013 278
332 3300053125 Ga0500618_029850 Ga0500618_029850_314_1150 278
333 3300053128 Ga0500626_038011 Ga0500626_038011_732_1568 278
334 3300053133 Ga0500655_006237 Ga0500655_006237_749_1585 278
335 3300053134 Ga0500658_0000314 Ga0500658_0000314_1993_2829 278
336 3300053134 Ga0500658_0000476 Ga0500658_0000476_15246_16082 278
337 3300053136 Ga0500559_0018106 Ga0500559_0018106_986_1831 278
338 3300053139 Ga0500568_0001888 Ga0500568_0001888_2150_2986 278
339 3300053141 Ga0500574_002257 Ga0500574_002257_1206_2042 278
340 3300053153 Ga0500616_0005383 Ga0500616_0005383_380_1216 278
341 3300053156 Ga0500622_0066694 Ga0500622_0066694_676_1521 278
342 3300053158 Ga0500627_0000392 Ga0500627_0000392_9815_10651 278
343 3300053162 Ga0500638_007950 Ga0500638_007950_3402_4238 278
344 iso_pu_bacteria 2511231002 2511244554 278
345 iso_pu_bacteria 2643221660 2644340373 278
346 iso_pu_bacteria 2739367655 2739610117 278
347 iso_pu_bacteria 2881927736 2881930728 278
348 iso_pu_bacteria 2887375801 2887376866 278
349 iso_pu_bacteria 2895511927 2895516203 278
350 iso_pu_bacteria 2928115317 2928120712 278
351 3300005548 Ga0070665_100183575 Ga0070665_1001835752 279
352 3300005617 Ga0068859_100456040 Ga0068859_1004560401 279
353 3300005618 Ga0068864_100077325 Ga0068864_1000773252 279
354 3300005719 Ga0068861_100058020 Ga0068861_1000580202 279
355 3300005843 Ga0068860_100067497 Ga0068860_1000674974 279
356 3300006058 Ga0075432_10020524 Ga0075432_100205244 279
357 3300006931 Ga0097620_100456048 Ga0097620_1004560481 279
358 3300014968 Ga0157379_10082217 Ga0157379_100822173 279
359 3300027876 Ga0209974_10032851 Ga0209974_100328512 279
360 3300027907 Ga0207428_10093873 Ga0207428_100938732 279
361 3300028381 Ga0268264_10387656 Ga0268264_103876563 279
362 3300053117 Ga0500593_008058 Ga0500593_008058_97_978 279
363 iso_pu_bacteria 2738543013 2739248335 279
364 3300003784 Ga0055534_1001503 Ga0055534_10015031 280
365 3300005530 Ga0070679_100007196 Ga0070679_10000719610 280
366 3300006038 Ga0075365_10006008 Ga0075365_100060086 280
367 3300009093 Ga0105240_10006435 Ga0105240_100064355 280
368 3300025284 Ga0209130_1002520 Ga0209130_10025202 280
369 3300025291 Ga0209675_1002902 Ga0209675_10029025 280
370 3300025292 Ga0209676_1013182 Ga0209676_10131824 280
371 3300025298 Ga0209050_1009957 Ga0209050_10099575 280
372 3300028794 Ga0307515_10003296 Ga0307515_1000329633 280
373 3300031456 Ga0307513_10036523 Ga0307513_100365235 280
374 3300031649 Ga0307514_10000641 Ga0307514_1000064131 280
375 3300049571 Ga0501034_0061426 Ga0501034_0061426_2718_3578 280
376 3300005563 Ga0068855_100001682 Ga0068855_1000016826 281
377 3300005618 Ga0068864_100137165 Ga0068864_1001371652 281
378 3300005844 Ga0068862_100386180 Ga0068862_1003861802 281
379 3300009177 Ga0105248_10362712 Ga0105248_103627122 281
380 3300025925 Ga0207650_10171448 Ga0207650_101714483 281
381 3300025929 Ga0207664_10117144 Ga0207664_101171443 281
382 3300025941 Ga0207711_10290896 Ga0207711_102908962 281
383 3300026088 Ga0207641_10173452 Ga0207641_101734522 281
384 3300037471 Ga0395905_0042923 Ga0395905_0042923_193_1047 281
385 3300049568 Ga0501031_0148380 Ga0501031_0148380_550_1422 281
386 3300050489 nmdc:mga03683_190646_c1 nmdc:mga03683_190646_c1_43_897 281
387 iso_pu_bacteria 2885192300 2885196881 281
388 3300002705 JGI25156J39149_1000005 JGI25156J39149_100000516 282
389 3300002738 JGI25154J39366_1000017 JGI25154J39366_10000178 282
390 3300002738 JGI25154J39366_1000144 JGI25154J39366_100014444 282
391 3300002741 JGI25157J39369_1000003 JGI25157J39369_100000324 282
392 3300002987 JGI25159J45721_1006405 JGI25159J45721_10064052 282
393 3300003771 Ga0055526_1000806 Ga0055526_10008066 282
394 3300003773 Ga0055537_1000115 Ga0055537_100011519 282
395 3300003775 Ga0055524_1000186 Ga0055524_100018618 282
396 3300003781 Ga0055536_1001432 Ga0055536_10014328 282
397 3300003784 Ga0055534_1001499 Ga0055534_10014992 282
398 3300003791 Ga0055530_10000208 Ga0055530_1000020850 282
399 3300003792 Ga0055540_1000037 Ga0055540_1000037159 282
400 3300003792 Ga0055540_1000208 Ga0055540_100020828 282
401 3300003794 Ga0055531_10000112 Ga0055531_100001128 282
402 3300005328 Ga0070676_10153765 Ga0070676_101537652 282
403 3300005338 Ga0068868_100225443 Ga0068868_1002254432 282
404 3300005563 Ga0068855_100229984 Ga0068855_1002299842 282
405 3300009098 Ga0105245_10024118 Ga0105245_100241185 282
406 3300010375 Ga0105239_10337179 Ga0105239_103371793 282
407 3300012513 Ga0157326_1003322 Ga0157326_10033222 282
408 3300014969 Ga0157376_10004660 Ga0157376_100046601 282
409 3300025206 Ga0209435_100002 Ga0209435_100002131 282
410 3300025245 Ga0207425_1002461 Ga0207425_10024614 282
411 3300025246 Ga0209646_1000001 Ga0209646_10000012274 282
412 3300025250 Ga0209026_1000001 Ga0209026_1000001931 282
413 3300025256 Ga0209759_1000001 Ga0209759_10000011905 282
414 3300025263 Ga0209565_1000143 Ga0209565_100014349 282
415 3300025273 Ga0209673_1000008 Ga0209673_1000008180 282
416 3300025284 Ga0209130_1000305 Ga0209130_100030545 282
417 3300025291 Ga0209675_1000820 Ga0209675_100082011 282
418 3300025292 Ga0209676_1000023 Ga0209676_1000023253 282
419 3300025294 Ga0209025_1009542 Ga0209025_10095424 282
420 3300025295 Ga0209564_1000435 Ga0209564_10004357 282
421 3300025295 Ga0209564_1001509 Ga0209564_10015096 282
422 3300025298 Ga0209050_1000022 Ga0209050_1000022235 282
423 3300025299 Ga0209256_1000001 Ga0209256_10000011721 282
424 3300025303 Ga0209051_1000013 Ga0209051_1000013235 282
425 3300025304 Ga0209257_1000042 Ga0209257_1000042251 282
426 3300031242 Ga0265329_10015932 Ga0265329_100159322 282
427 3300031548 Ga0307408_100110292 Ga0307408_1001102923 282
428 3300031711 Ga0265314_10001279 Ga0265314_1000127927 282
429 3300031711 Ga0265314_10048181 Ga0265314_100481812 282
430 3300031712 Ga0265342_10040873 Ga0265342_100408733 282
431 3300031712 Ga0265342_10164581 Ga0265342_101645812 282
432 3300031995 Ga0307409_100521335 Ga0307409_1005213352 282
433 3300037312 Ga0395899_0011767 Ga0395899_0011767_936_1793 282
434 3300037312 Ga0395899_0044197 Ga0395899_0044197_754_1611 282
435 3300037418 Ga0395900_0029407 Ga0395900_0029407_3799_4656 282
436 3300037418 Ga0395900_0059608 Ga0395900_0059608_1000_1857 282
437 3300037466 Ga0395898_0003443 Ga0395898_0003443_11079_11936 282
438 3300037466 Ga0395898_0018549 Ga0395898_0018549_397_1254 282
439 3300037471 Ga0395905_0000043 Ga0395905_0000043_223432_224289 282
440 3300037471 Ga0395905_0040202 Ga0395905_0040202_1150_2007 282
441 3300037471 Ga0395905_0051564 Ga0395905_0051564_966_1823 282
442 3300038443 Ga0395901_0033252 Ga0395901_0033252_1729_2586 282
443 3300038443 Ga0395901_0066417 Ga0395901_0066417_2534_3391 282
444 3300042532 Ga0450893_0001655 Ga0450893_0001655_2549_3403 282
445 3300045049 Ga0466959_0241873 Ga0466959_0241873_319_1185 282
446 3300045051 Ga0451576_0352393 Ga0451576_0352393_241_1095 282
447 3300046615 Ga0495656_0067992 Ga0495656_0067992_369_1226 282
448 3300046810 Ga0495660_0073063 Ga0495660_0073063_124_981 282
449 3300049575 Ga0501039_0092947 Ga0501039_0092947_31_909 282
450 3300049592 Ga0501076_0085483 Ga0501076_0085483_814_1692 282
451 3300049822 Ga0501035_0228395 Ga0501035_0228395_17_895 282
452 3300049824 Ga0501045_0072768 Ga0501045_0072768_1451_2329 282
453 3300053730 Ga0500645_004482 Ga0500645_004482_2297_3178 282
454 3300006195 Ga0075366_10002790 Ga0075366_100027901 284
455 3300041404 Ga0439436_0001226 Ga0439436_0001226_1321_2190 284
456 3300041411 Ga0439466_0004836 Ga0439466_0004836_2700_3569 284
457 3300041413 Ga0439465_0001421 Ga0439465_0001421_2417_3286 284
458 3300041997 Ga0439431_0000611 Ga0439431_0000611_726_1595 284
459 3300041999 Ga0439433_0000817 Ga0439433_0000817_1050_1919 284
460 3300042004 Ga0439445_0001029 Ga0439445_0001029_1829_2698 284
461 3300042006 Ga0439432_001181 Ga0439432_001181_6772_7641 284
462 3300042007 Ga0439449_0002198 Ga0439449_0002198_5007_5876 284
463 3300042007 Ga0439449_0026391 Ga0439449_0026391_131_1000 284
464 3300042015 Ga0439462_0000785 Ga0439462_0000785_2856_3725 284
465 3300042156 Ga0439446_0026018 Ga0439446_0026018_313_1182 284
466 3300042532 Ga0450893_0007459 Ga0450893_0007459_889_1758 284
467 3300042876 Ga0451577_0087490 Ga0451577_0087490_323_1213 284
468 3300042876 Ga0451577_0341639 Ga0451577_0341639_262_1140 284
469 3300044712 Ga0453684_0207043 Ga0453684_0207043_957_1847 284
470 3300046501 Ga0495607_0000480 Ga0495607_0000480_31650_32528 284
471 3300046558 Ga0495633_0000458 Ga0495633_0000458_12557_13417 284
472 3300050493 nmdc:mga0k408_95453_c1 nmdc:mga0k408_95453_c1_175_1041 284
473 3300050496 nmdc:mga07m45_141636_c1 nmdc:mga07m45_141636_c1_486_1352 284
474 3300006195 Ga0075366_10044935 Ga0075366_100449354 285
475 3300006353 Ga0075370_10003703 Ga0075370_100037037 285
476 3300015262 Ga0182007_10000289 Ga0182007_1000028934 285
477 3300026121 Ga0207683_10036652 Ga0207683_100366526 285
478 3300031911 Ga0307412_10041871 Ga0307412_100418712 285
479 3300041411 Ga0439466_0010808 Ga0439466_0010808_168_1073 285
480 3300042007 Ga0439449_0000581 Ga0439449_0000581_783_1688 285
481 3300042010 Ga0439452_012398 Ga0439452_012398_1107_2012 285
482 3300042014 Ga0439457_010018 Ga0439457_010018_412_1317 285
483 3300042015 Ga0439462_0005369 Ga0439462_0005369_615_1520 285
484 3300044683 Ga0466965_0008623 Ga0466965_0008623_738_1643 285
485 3300044693 Ga0466961_0079017 Ga0466961_0079017_519_1385 285
486 3300044901 Ga0466960_0019788 Ga0466960_0019788_1383_2288 285
487 3300048910 Ga0496107_0102781 Ga0496107_0102781_1007_1927 285
488 3300005367 Ga0070667_100021114 Ga0070667_1000211142 286
489 3300017792 Ga0163161_10304929 Ga0163161_103049292 286
490 3300025940 Ga0207691_10062589 Ga0207691_100625893 286
491 3300028794 Ga0307515_10000472 Ga0307515_1000047238 286
492 3300031251 Ga0265327_10075923 Ga0265327_100759232 286
493 3300046475 Ga0495639_0002555 Ga0495639_0002555_2859_3782 286
494 3300046615 Ga0495656_0034791 Ga0495656_0034791_461_1384 286
495 3300048903 Ga0496100_0019529 Ga0496100_0019529_481_1404 286
496 3300048904 Ga0496101_0008376 Ga0496101_0008376_4447_5370 286
497 3300048905 Ga0496102_0004638 Ga0496102_0004638_2962_3885 286
498 3300048906 Ga0496103_0112725 Ga0496103_0112725_218_1141 286
499 3300048907 Ga0496104_0002111 Ga0496104_0002111_6426_7349 286
500 3300048913 Ga0496110_0130673 Ga0496110_0130673_377_1300 286
501 3300048917 Ga0496114_0125020 Ga0496114_0125020_458_1381 286
502 iso_pu_bacteria 2519103095 2519459491 286
503 iso_pu_bacteria 2582581311 2585291078 286
504 iso_pu_bacteria 2599185239 2599738536 286
505 iso_pu_bacteria 2599185240 2599748245 286
506 iso_pu_bacteria 2599185355 2600210071 286
507 iso_pu_bacteria 2675903129 2676746429 286
508 iso_pu_bacteria 2816332253 2817261773 286
509 iso_pu_bacteria 2816332256 2817279457 286
510 iso_pu_bacteria 2816332286 2817456787 286
511 iso_pu_bacteria 2818991452 2819633326 286
512 iso_pu_bacteria 2863421361 2863425761 286
513 iso_pu_bacteria 2870068957 2870070516 286
514 iso_pu_bacteria 2904564687 2904569131 286
515 iso_pu_bacteria 2904571731 2904576561 286
516 iso_pu_bacteria 2928157003 2928161446 286
517 iso_pu_bacteria 2928163908 2928168274 286
518 iso_pu_bacteria 2928170801 2928175016 286
519 iso_pu_bacteria 2928536128 2928541739 286
520 iso_pu_bacteria 2981990288 2981993387 286
521 iso_pu_bacteria 641736154 642419294 286
522 iso_pu_bacteria 8018845410 8018849928 286
523 iso_pu_bacteria 8020807995 8020813043 286
524 iso_pu_bacteria 8020938398 8020938764 286
525 iso_pu_bacteria 8020945358 8020949274 286
526 iso_pu_bacteria 8020953355 8020959138 286
527 iso_pu_bacteria 8021120328 8021125374 286
528 iso_pu_bacteria 8039098773 8039100753 286
529 iso_pu_bacteria 8040167225 8040169123 286
530 iso_pu_bacteria 8040173305 8040179415 286
531 3300009093 Ga0105240_10133801 Ga0105240_101338014 288
532 3300046692 Ga0495671_0101776 Ga0495671_0101776_448_1323 288
533 iso_pu_bacteria 2501025502 2501081376 288
534 iso_pu_bacteria 2510917013 2511089222 288
535 3300001915 JGI24741J21665_1018016 JGI24741J21665_10180162 290
536 3300003758 Ga0055532_1001133 Ga0055532_10011333 290
537 3300003758 Ga0055532_1007692 Ga0055532_10076922 290
538 3300003758 Ga0055532_1007879 Ga0055532_10078792 290
539 3300003760 Ga0055527_1000483 Ga0055527_10004835 290
540 3300003760 Ga0055527_1000486 Ga0055527_10004865 290
541 3300003761 Ga0055535_1001227 Ga0055535_10012275 290
542 3300003761 Ga0055535_1001232 Ga0055535_10012325 290
543 3300003762 Ga0055542_1001223 Ga0055542_10012235 290
544 3300003762 Ga0055542_1001936 Ga0055542_10019364 290
545 3300003763 Ga0055529_1000553 Ga0055529_100055329 290
546 3300005327 Ga0070658_10042072 Ga0070658_100420723 290
547 3300005339 Ga0070660_100000037 Ga0070660_1000000374 290
548 3300005366 Ga0070659_100000121 Ga0070659_10000012159 290
549 3300005455 Ga0070663_100041081 Ga0070663_1000410812 290
550 3300005563 Ga0068855_100059644 Ga0068855_1000596444 290
551 3300005616 Ga0068852_100055022 Ga0068852_1000550224 290
552 3300009092 Ga0105250_10003602 Ga0105250_100036029 290
553 3300009093 Ga0105240_10247038 Ga0105240_102470383 290
554 3300009551 Ga0105238_10005085 Ga0105238_100050854 290
555 3300010375 Ga0105239_10043839 Ga0105239_100438392 290
556 3300013100 Ga0157373_10121768 Ga0157373_101217683 290
557 3300025225 Ga0209566_101026 Ga0209566_1010264 290
558 3300025228 Ga0209672_100033 Ga0209672_100033217 290
559 3300025228 Ga0209672_100034 Ga0209672_10003475 290
560 3300025229 Ga0209147_100089 Ga0209147_10008986 290
561 3300025229 Ga0209147_100191 Ga0209147_10019167 290
562 3300025229 Ga0209147_101268 Ga0209147_1012682 290
563 3300025242 Ga0209258_100023 Ga0209258_10002310 290
564 3300025242 Ga0209258_100242 Ga0209258_10024210 290
565 3300025254 Ga0209148_1000029 Ga0209148_100002975 290
566 3300025254 Ga0209148_1001246 Ga0209148_10012468 290
567 3300025256 Ga0209759_1002254 Ga0209759_10022548 290
568 3300025272 Ga0209455_1000123 Ga0209455_100012375 290
569 3300025272 Ga0209455_1000756 Ga0209455_10007568 290
570 3300025273 Ga0209673_1000075 Ga0209673_100007596 290
571 3300025904 Ga0207647_10002981 Ga0207647_100029819 290
572 3300025909 Ga0207705_10044566 Ga0207705_100445663 290
573 3300025913 Ga0207695_10001130 Ga0207695_1000113019 290
574 3300025913 Ga0207695_10122107 Ga0207695_101221072 290
575 3300025914 Ga0207671_10012673 Ga0207671_100126733 290
576 3300025919 Ga0207657_10000098 Ga0207657_100000984 290
577 3300025932 Ga0207690_10000055 Ga0207690_100000555 290
578 3300025949 Ga0207667_10053384 Ga0207667_100533843 290
579 3300026067 Ga0207678_10000238 Ga0207678_1000023821 290
580 3300026078 Ga0207702_10154399 Ga0207702_101543991 290
581 3300026142 Ga0207698_10002821 Ga0207698_100028213 290
582 3300027312 Ga0209371_1001116 Ga0209371_10011164 290
583 3300030500 Ga0268256_1000946 Ga0268256_100094620 290
584 3300039437 Ga0436365_0238213 Ga0436365_0238213_1594_2466 290
585 3300048919 Ga0496116_0098545 Ga0496116_0098545_690_1562 290
586 3300048920 Ga0496117_0050367 Ga0496117_0050367_596_1468 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02616

SMC_ScpA

Segregation and condensation protein ScpA

98

310

0.85

Feature Viewer

pLDDT pTM Quality
72.52 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map