F466482

General Info

Members Datasets Scaffolds Average Seq Length
585 379 1170 286

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0016028|Ga0495638_0016028_2214_3191
Length 325
Sequence MTGRFGPRSGRVLGEDGGPGKARGQEIRVGLGSKKEPKMEHLTVQANGAALHVAHMGAGRPLLLLHGWPEFWLTWEPVMTRLADRFTLYAPDLRGFGDSDKPEGLFGPDQQAADMLALMDALGLAQAGIVGHDVGGALMQPLARLAPERIAGLFFFDFVYPGIGRRMAEPERLNNIWYQSFHQMEMAPALVGASRESCRRYIGHFLKAWSHRKHVFDDQLDAFTDNFLKSGNLAGGFAHYRAVHAGRVRMMKGEAPAPAPIGVPTCVRWAEHDPLFPYEWTDRLGETFTNLDLAMFPDVGHFPHREDPDRAASDIAAFFTRIGWH

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
96 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
97 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
287 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
288 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
289 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
290 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
291 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
292 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
293 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
294 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
295 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
296 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
297 2791355199
298 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
299 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
300 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
301 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
302 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
303 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
304 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
305 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
306 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
307 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
308 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
309 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
310 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
311 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
312 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
313 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
314 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
315 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
316 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
317 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
318 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
319 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
320 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
321 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
322 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
323 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
324 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
325 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
326 2922368715
327 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
328 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
329 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
330 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
331 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
332 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
333 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
334 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
335 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
336 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
337 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
338 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
339 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
340 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
341 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
342 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
343 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
344 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
345 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
346 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
347 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
348 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
349 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
350 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
351 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
352 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
353 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
354 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
355 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
356 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
357 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
358 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
359 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
360 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
361 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
362 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
363 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
364 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
365 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
366 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
367 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
368 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
369 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
370 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
371 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
372 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
373 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
374 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
375 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
376 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
377 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
378 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
379 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.56
Metatranscriptomes 0
Isolates 15.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 11.45
Rhizoplane 5.98
Rhizosphere 61.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0016028 3300046460 Bacteria 5022
2 JGI24744J21845_10026689 3300002077 Bacteria 1120
3 JGI25406J46586_10000256 3300003203 Bacteria 23743
4 JGI25160J50197_1010119 3300003354 Bacteria 3436
5 JGI25404J52841_10030083 3300003659 Bacteria 1164
6 Ga0070676_10051365 3300005328 Bacteria 2420
7 Ga0070683_100004493 3300005329 Bacteria 11507
8 Ga0070683_100225276 3300005329 Bacteria 1782
9 Ga0070683_100267135 3300005329 Bacteria 1627
10 Ga0068869_100231800 3300005334 Bacteria 1467
11 Ga0070680_100084955 3300005336 Bacteria 2614
12 Ga0070680_100172832 3300005336 Bacteria 1818
13 Ga0068868_100063413 3300005338 Bacteria 2931
14 Ga0070661_100215637 3300005344 Bacteria 1470
15 Ga0070668_100064385 3300005347 Bacteria 2842
16 Ga0070668_100391541 3300005347 Bacteria 1185
17 Ga0070668_100531356 3300005347 Bacteria 1021
18 Ga0070671_100211609 3300005355 Bacteria 1644
19 Ga0070674_100437666 3300005356 Bacteria 1076
20 Ga0070659_100229930 3300005366 Bacteria 1532
21 Ga0070667_100329723 3300005367 Bacteria 1379
22 Ga0070709_10205373 3300005434 Bacteria 1397
23 Ga0070709_10248826 3300005434 Bacteria 1279
24 Ga0070713_100017781 3300005436 Bacteria 5390
25 Ga0070713_100035194 3300005436 Bacteria 4029
26 Ga0070713_100664969 3300005436 Bacteria 993
27 Ga0070710_10013404 3300005437 Bacteria 4106
28 Ga0070710_10066561 3300005437 Bacteria 2066
29 Ga0070710_10110412 3300005437 Bacteria 1651
30 Ga0070711_100024466 3300005439 Bacteria 3938
31 Ga0070711_100092851 3300005439 Bacteria 2179
32 Ga0070711_100214900 3300005439 Bacteria 1491
33 Ga0070663_100084709 3300005455 Bacteria 2337
34 Ga0070663_100128118 3300005455 Bacteria 1924
35 Ga0070663_100152397 3300005455 Bacteria 1773
36 Ga0070663_100524167 3300005455 Bacteria 987
37 Ga0070678_100068347 3300005456 Bacteria 2648
38 Ga0070678_100088081 3300005456 Bacteria 2372
39 Ga0070678_100098874 3300005456 Bacteria 2257
40 Ga0070678_100409735 3300005456 Bacteria 1179
41 Ga0070681_10004178 3300005458 Bacteria 13672
42 Ga0070681_10506463 3300005458 Bacteria 1120
43 Ga0070707_100254287 3300005468 Bacteria 1709
44 Ga0070698_100296410 3300005471 Bacteria 1548
45 Ga0070679_100085452 3300005530 Bacteria 3142
46 Ga0070679_100143811 3300005530 Bacteria 2363
47 Ga0070684_100008530 3300005535 Bacteria 8019
48 Ga0070684_100017771 3300005535 Bacteria 5843
49 Ga0070672_100274030 3300005543 Bacteria 1425
50 Ga0070672_100311923 3300005543 Bacteria 1335
51 Ga0070696_100092391 3300005546 Bacteria 2157
52 Ga0070665_100007488 3300005548 Bacteria 11101
53 Ga0070665_100056755 3300005548 Bacteria 3926
54 Ga0070665_100164203 3300005548 Bacteria 2223
55 Ga0070665_100309934 3300005548 Bacteria 1582
56 Ga0070665_100556015 3300005548 Bacteria 1160
57 Ga0070665_100604721 3300005548 Bacteria 1109
58 Ga0068855_100142216 3300005563 Bacteria 2733
59 Ga0068855_100321361 3300005563 Bacteria 1711
60 Ga0070664_100070506 3300005564 Bacteria 2993
61 Ga0070664_100233122 3300005564 Bacteria 1650
62 Ga0068857_100262780 3300005577 Bacteria 1584
63 Ga0068856_100158774 3300005614 Bacteria 2271
64 Ga0068856_100167938 3300005614 Bacteria 2205
65 Ga0068856_100171369 3300005614 Bacteria 2182
66 Ga0070702_100082056 3300005615 Bacteria 1934
67 Ga0068852_100088408 3300005616 Bacteria 2767
68 Ga0068852_100237125 3300005616 Bacteria 1741
69 Ga0068852_100332500 3300005616 Bacteria 1479
70 Ga0068864_100055366 3300005618 Bacteria 3424
71 Ga0068861_100248587 3300005719 Bacteria 1516
72 Ga0068861_100253242 3300005719 Bacteria 1503
73 Ga0068851_10132809 3300005834 Bacteria 1348
74 Ga0068863_100169065 3300005841 Bacteria 2096
75 Ga0068858_100137134 3300005842 Bacteria 2296
76 Ga0068860_100012321 3300005843 Bacteria 8425
77 Ga0068860_100650921 3300005843 Bacteria 1061
78 Ga0068862_100083456 3300005844 Bacteria 2774
79 Ga0068862_100185626 3300005844 Bacteria 1868
80 Ga0068862_100383487 3300005844 Bacteria 1311
81 Ga0081455_10013159 3300005937 Bacteria 8199
82 Ga0081455_10102881 3300005937 Bacteria 2289
83 Ga0081455_10195921 3300005937 Bacteria 1517
84 Ga0081455_10228712 3300005937 Bacteria 1374
85 Ga0081540_1002532 3300005983 Bacteria 14825
86 Ga0081540_1004042 3300005983 Bacteria 11359
87 Ga0081540_1005765 3300005983 Bacteria 9169
88 Ga0081540_1012681 3300005983 Bacteria 5529
89 Ga0081540_1026337 3300005983 Bacteria 3322
90 Ga0081540_1030647 3300005983 Bacteria 2975
91 Ga0081540_1030772 3300005983 Bacteria 2966
92 Ga0081540_1033763 3300005983 Bacteria 2772
93 Ga0081540_1043864 3300005983 Bacteria 2289
94 Ga0081540_1100942 3300005983 Bacteria 1243
95 Ga0081539_10000608 3300005985 Bacteria 72799
96 Ga0081539_10002743 3300005985 Bacteria 23762
97 Ga0081539_10015726 3300005985 Bacteria 5476
98 Ga0070717_10071574 3300006028 Bacteria 2893
99 Ga0075365_10055327 3300006038 Bacteria 2633
100 Ga0075365_10156257 3300006038 Bacteria 1587
101 Ga0075368_10020073 3300006042 Bacteria 2527
102 Ga0075363_100027180 3300006048 Bacteria 2932
103 Ga0075363_100067041 3300006048 Bacteria 1944
104 Ga0075363_100123870 3300006048 Bacteria 1445
105 Ga0075364_10176890 3300006051 Bacteria 1443
106 Ga0070716_100011909 3300006173 Bacteria 4394
107 Ga0070716_100178917 3300006173 Bacteria 1390
108 Ga0070712_100003832 3300006175 Bacteria 9259
109 Ga0070712_100205057 3300006175 Bacteria 1551
110 Ga0075362_10139874 3300006177 Bacteria 1156
111 Ga0075367_10219987 3300006178 Bacteria 1188
112 Ga0075369_10145700 3300006186 Bacteria 1081
113 Ga0075370_10063578 3300006353 Bacteria 2104
114 Ga0075370_10066654 3300006353 Bacteria 2054
115 Ga0075370_10190787 3300006353 Bacteria 1207
116 Ga0068871_100275134 3300006358 Bacteria 1471
117 Ga0068871_100312572 3300006358 Bacteria 1381
118 Ga0075428_100609249 3300006844 Bacteria 1166
119 Ga0075433_10337240 3300006852 Bacteria 1333
120 Ga0075434_100272871 3300006871 Bacteria 1710
121 Ga0075434_100502163 3300006871 Bacteria 1234
122 Ga0068865_100026883 3300006881 Bacteria 3797
123 Ga0068865_100190263 3300006881 Bacteria 1586
124 Ga0099825_1041592 3300006941 Bacteria 1311
125 Ga0099824_1010733 3300006942 Bacteria 10649
126 Ga0099823_1024318 3300006944 Bacteria 5485
127 Ga0075435_100278872 3300007076 Bacteria 1427
128 Ga0099794_10039477 3300007265 Bacteria 2241
129 Ga0099794_10042583 3300007265 Bacteria 2165
130 Ga0099794_10166001 3300007265 Bacteria 1124
131 Ga0099795_10033741 3300007788 Bacteria 1779
132 Ga0099795_10058832 3300007788 Bacteria 1420
133 Ga0105240_10083500 3300009093 Bacteria 3919
134 Ga0105240_10107526 3300009093 Bacteria 3381
135 Ga0105240_10481236 3300009093 Bacteria 1384
136 Ga0111539_10395682 3300009094 Bacteria 1609
137 Ga0111539_11021987 3300009094 Bacteria 961
138 Ga0105245_10358380 3300009098 Bacteria 1447
139 Ga0114129_10065816 3300009147 Bacteria 5057
140 Ga0105243_10204135 3300009148 Bacteria 1735
141 Ga0105241_10131574 3300009174 Bacteria 2026
142 Ga0105242_10063484 3300009176 Bacteria 3041
143 Ga0105242_10074820 3300009176 Bacteria 2819
144 Ga0105248_10363041 3300009177 Bacteria 1631
145 Ga0105248_10403707 3300009177 Bacteria 1539
146 Ga0105248_10665248 3300009177 Bacteria 1175
147 Ga0105248_10813745 3300009177 Bacteria 1054
148 Ga0105237_10328542 3300009545 Bacteria 1533
149 Ga0105238_10449372 3300009551 Bacteria 1286
150 Ga0105249_10155359 3300009553 Bacteria 2206
151 Ga0105249_10306303 3300009553 Bacteria 1595
152 Ga0105249_10777957 3300009553 Bacteria 1020
153 Ga0099796_10064718 3300010159 Bacteria 1305
154 Ga0099796_10070882 3300010159 Bacteria 1258
155 Ga0105239_10120748 3300010375 Bacteria 2910
156 Ga0105239_10254404 3300010375 Bacteria 1973
157 Ga0157328_1001009 3300012478 Bacteria 1138
158 Ga0157370_10188253 3300013104 Bacteria 1916
159 Ga0157369_10076832 3300013105 Bacteria 3579
160 Ga0157369_10100287 3300013105 Bacteria 3087
161 Ga0157369_10106771 3300013105 Bacteria 2979
162 Ga0157374_10155243 3300013296 Bacteria 2227
163 Ga0157374_10318837 3300013296 Bacteria 1540
164 Ga0157378_10042708 3300013297 Bacteria 4024
165 Ga0157378_10216804 3300013297 Bacteria 1818
166 Ga0163162_10110451 3300013306 Bacteria 2846
167 Ga0163162_10365186 3300013306 Bacteria 1576
168 Ga0163162_10415051 3300013306 Bacteria 1478
169 Ga0157372_10172224 3300013307 Bacteria 2505
170 Ga0157372_10598202 3300013307 Bacteria 1286
171 Ga0157375_10225207 3300013308 Bacteria 2034
172 Ga0157375_10275017 3300013308 Bacteria 1846
173 Ga0157375_10423671 3300013308 Bacteria 1497
174 Ga0163163_10075527 3300014325 Bacteria 3363
175 Ga0163163_10095036 3300014325 Bacteria 3000
176 Ga0157380_10069744 3300014326 Bacteria 2838
177 Ga0157379_10159655 3300014968 Bacteria 2035
178 Ga0157379_10194410 3300014968 Bacteria 1833
179 Ga0157376_10058496 3300014969 Bacteria 3229
180 Ga0163161_10171795 3300017792 Bacteria 1658
181 Ga0214544_1000665 3300021320 Bacteria 65630
182 Ga0214542_1000486 3300021321 Bacteria 71884
183 Ga0214545_1000307 3300021324 Bacteria 71884
184 Ga0213875_10001636 3300021388 Bacteria 14148
185 Ga0209564_1003322 3300025295 Bacteria 11175
186 Ga0209758_1007720 3300025297 Bacteria 7220
187 Ga0209758_1008227 3300025297 Bacteria 6830
188 Ga0209758_1026917 3300025297 Bacteria 2474
189 Ga0209758_1049406 3300025297 Bacteria 1485
190 Ga0207426_1000227 3300025302 Bacteria 129311
191 Ga0207426_1015497 3300025302 Bacteria 2761
192 Ga0207656_10017867 3300025321 Bacteria 2785
193 Ga0207653_10042857 3300025885 Bacteria 1489
194 Ga0207692_10057636 3300025898 Bacteria 1998
195 Ga0207688_10085686 3300025901 Bacteria 1804
196 Ga0207688_10136080 3300025901 Bacteria 1443
197 Ga0207680_10274061 3300025903 Bacteria 1171
198 Ga0207685_10008828 3300025905 Bacteria 2895
199 Ga0207699_10016829 3300025906 Bacteria 3834
200 Ga0207645_10169027 3300025907 Bacteria 1432
201 Ga0207643_10028484 3300025908 Bacteria 3102
202 Ga0207643_10204988 3300025908 Bacteria 1202
203 Ga0207654_10035660 3300025911 Bacteria 2773
204 Ga0207707_10001922 3300025912 Bacteria 18882
205 Ga0207707_10004003 3300025912 Bacteria 13084
206 Ga0207707_10146040 3300025912 Bacteria 2068
207 Ga0207695_10195102 3300025913 Bacteria 1941
208 Ga0207693_10004965 3300025915 Bacteria 11173
209 Ga0207693_10031046 3300025915 Bacteria 4221
210 Ga0207663_10099686 3300025916 Bacteria 1948
211 Ga0207663_10163013 3300025916 Bacteria 1576
212 Ga0207663_10302644 3300025916 Bacteria 1195
213 Ga0207660_10277349 3300025917 Bacteria 1329
214 Ga0207660_10390337 3300025917 Bacteria 1120
215 Ga0207649_10208901 3300025920 Bacteria 1384
216 Ga0207649_10238119 3300025920 Bacteria 1305
217 Ga0207650_10127360 3300025925 Bacteria 1989
218 Ga0207687_10029203 3300025927 Bacteria 3708
219 Ga0207700_10019075 3300025928 Bacteria 4626
220 Ga0207700_10066757 3300025928 Bacteria 2750
221 Ga0207700_10380321 3300025928 Bacteria 1235
222 Ga0207664_10022137 3300025929 Bacteria 4741
223 Ga0207664_10086456 3300025929 Bacteria 2561
224 Ga0207644_10036883 3300025931 Bacteria 3435
225 Ga0207644_10094104 3300025931 Bacteria 2238
226 Ga0207644_10182793 3300025931 Bacteria 1644
227 Ga0207644_10334960 3300025931 Bacteria 1226
228 Ga0207644_10357459 3300025931 Bacteria 1187
229 Ga0207686_10103139 3300025934 Bacteria 1908
230 Ga0207709_10160378 3300025935 Bacteria 1568
231 Ga0207709_10309115 3300025935 Bacteria 1179
232 Ga0207670_10200708 3300025936 Bacteria 1515
233 Ga0207669_10351900 3300025937 Bacteria 1138
234 Ga0207669_10392569 3300025937 Bacteria 1084
235 Ga0207704_10076792 3300025938 Bacteria 2142
236 Ga0207704_10175380 3300025938 Bacteria 1543
237 Ga0207665_10002143 3300025939 Bacteria 13354
238 Ga0207665_10029872 3300025939 Bacteria 3602
239 Ga0207665_10082302 3300025939 Bacteria 2218
240 Ga0207665_10379223 3300025939 Bacteria 1073
241 Ga0207691_10206849 3300025940 Bacteria 1706
242 Ga0207691_10536211 3300025940 Bacteria 993
243 Ga0207711_10197843 3300025941 Bacteria 1833
244 Ga0207711_10337525 3300025941 Bacteria 1394
245 Ga0207711_10411125 3300025941 Bacteria 1258
246 Ga0207711_10496534 3300025941 Bacteria 1137
247 Ga0207689_10080784 3300025942 Bacteria 2672
248 Ga0207689_10256320 3300025942 Bacteria 1447
249 Ga0207661_10001440 3300025944 Bacteria 16041
250 Ga0207667_10015124 3300025949 Bacteria 8775
251 Ga0207667_10373276 3300025949 Bacteria 1453
252 Ga0207667_10390788 3300025949 Bacteria 1417
253 Ga0207712_10079702 3300025961 Bacteria 2379
254 Ga0207668_10172071 3300025972 Bacteria 1699
255 Ga0207640_10345526 3300025981 Bacteria 1193
256 Ga0207658_10394923 3300025986 Bacteria 1214
257 Ga0207677_10031839 3300026023 Bacteria 3382
258 Ga0207703_10179288 3300026035 Bacteria 1869
259 Ga0207703_10293039 3300026035 Bacteria 1481
260 Ga0207678_10018024 3300026067 Bacteria 6203
261 Ga0207678_10173868 3300026067 Bacteria 1839
262 Ga0207678_10266536 3300026067 Bacteria 1468
263 Ga0207678_10328124 3300026067 Bacteria 1317
264 Ga0207708_10194866 3300026075 Bacteria 1614
265 Ga0207641_10163747 3300026088 Bacteria 2024
266 Ga0207641_10239518 3300026088 Bacteria 1690
267 Ga0207648_10039454 3300026089 Bacteria 4152
268 Ga0207676_10041483 3300026095 Bacteria 3533
269 Ga0207674_10489534 3300026116 Bacteria 1189
270 Ga0207675_100535515 3300026118 Bacteria 1169
271 Ga0207683_10137722 3300026121 Bacteria 2198
272 Ga0207683_10264107 3300026121 Bacteria 1572
273 Ga0209389_1000102 3300027296 Bacteria 78475
274 Ga0209489_100404 3300027361 Bacteria 78473
275 Ga0209700_100408 3300027363 Bacteria 78496
276 Ga0209588_1020217 3300027671 Bacteria 2084
277 Ga0268266_10001335 3300028379 Bacteria 29884
278 Ga0268266_10007399 3300028379 Bacteria 9916
279 Ga0268266_10041505 3300028379 Bacteria 3926
280 Ga0268266_10131781 3300028379 Bacteria 2236
281 Ga0268266_10268529 3300028379 Bacteria 1583
282 Ga0268266_10403715 3300028379 Bacteria 1292
283 Ga0268265_10351825 3300028380 Bacteria 1345
284 Ga0268265_10393734 3300028380 Bacteria 1278
285 Ga0268265_10663750 3300028380 Bacteria 1003
286 Ga0307517_10000232 3300028786 Bacteria 94332
287 Ga0307517_10235784 3300028786 Bacteria 1092
288 Ga0307515_10014473 3300028794 Bacteria 14620
289 Ga0307515_10227436 3300028794 Bacteria 1667
290 Ga0307513_10228685 3300031456 Bacteria 1674
291 Ga0307508_10337453 3300031616 Bacteria 1099
292 Ga0307508_10362687 3300031616 Bacteria 1040
293 Ga0307516_10003539 3300031730 Bacteria 19976
294 Ga0307516_10189204 3300031730 Bacteria 1785
295 Ga0307407_10119493 3300031903 Bacteria 1668
296 Ga0307415_100059673 3300032126 Bacteria 2632
297 Ga0307510_10006006 3300033180 Bacteria 14485
298 Ga0307510_10031035 3300033180 Bacteria 6045
299 Ga0373923_0002828 3300035111 Bacteria 5435
300 Ga0373936_0114110 3300035113 Bacteria 1149
301 Ga0373945_0116258 3300035116 Bacteria 1060
302 Ga0373924_0059621 3300035410 Bacteria 1594
303 Ga0373931_0011946 3300035691 Bacteria 4201
304 Ga0373931_0116542 3300035691 Bacteria 1522
305 Ga0373931_0181362 3300035691 Bacteria 1247
306 Ga0373927_0056083 3300035695 Bacteria 2547
307 Ga0373927_0131622 3300035695 Bacteria 1634
308 Ga0373933_0109287 3300035724 Bacteria 1723
309 Ga0373947_0073801 3300035725 Bacteria 2097
310 Ga0373937_0299585 3300036401 Bacteria 1519
311 Ga0373925_0007366 3300037068 Bacteria 8029
312 Ga0373925_0432033 3300037068 Bacteria 1077
313 Ga0395900_0013918 3300037418 Bacteria 8211
314 Ga0395898_0216683 3300037466 Bacteria 1826
315 Ga0395898_0233678 3300037466 Bacteria 1753
316 Ga0395905_0005023 3300037471 Bacteria 13625
317 Ga0395905_0092570 3300037471 Bacteria 2835
318 Ga0436364_1210479 3300037853 Bacteria 6917
319 Ga0436364_1557054 3300037853 Bacteria 23701
320 Ga0395901_0061354 3300038443 Bacteria 3912
321 Ga0436365_1053579 3300039437 Bacteria 3004
322 Ga0436365_1552613 3300039437 Bacteria 2091
323 Ga0436360_0314278 3300039438 Bacteria 1102
324 Ga0436361_0065851 3300039447 Bacteria 5607
325 Ga0436361_0203807 3300039447 Bacteria 2005
326 Ga0436363_1615506 3300039450 Bacteria 3328
327 Ga0439465_0090232 3300041413 Bacteria 1048
328 Ga0451853_0630845 3300041512 Bacteria 1143
329 Ga0466963_0074583 3300044694 Bacteria 2288
330 Ga0466964_0125131 3300044706 Bacteria 1164
331 Ga0466960_0083184 3300044901 Bacteria 1617
332 Ga0466960_0084589 3300044901 Bacteria 1605
333 Ga0495592_0086820 3300046454 Bacteria 2252
334 Ga0495603_0026994 3300046455 Bacteria 3467
335 Ga0495603_0038286 3300046455 Bacteria 2876
336 Ga0495603_0152586 3300046455 Bacteria 1341
337 Ga0495629_0069802 3300046459 Bacteria 2452
338 Ga0495638_0000880 3300046460 Bacteria 30953
339 Ga0495650_0120184 3300046471 Bacteria 968
340 Ga0495580_0008306 3300046472 Bacteria 8262
341 Ga0495582_0125826 3300046473 Bacteria 1446
342 Ga0495639_0174414 3300046475 Bacteria 1045
343 Ga0495664_0076788 3300046477 Bacteria 1999
344 Ga0495664_0196285 3300046477 Bacteria 1223
345 Ga0495607_0046038 3300046501 Bacteria 2564
346 Ga0495606_0027491 3300046507 Bacteria 4033
347 Ga0495606_0177447 3300046507 Bacteria 1231
348 Ga0495606_0233003 3300046507 Bacteria 1031
349 Ga0495608_0097163 3300046511 Bacteria 1901
350 Ga0495618_0217781 3300046514 Bacteria 1205
351 Ga0495628_0039866 3300046516 Bacteria 3756
352 Ga0495630_0245660 3300046517 Bacteria 1367
353 Ga0495630_0300701 3300046517 Bacteria 1226
354 Ga0495631_0044402 3300046518 Bacteria 1958
355 Ga0495648_0166067 3300046524 Bacteria 1136
356 Ga0495648_0251686 3300046524 Bacteria 852
357 Ga0495666_0184384 3300046526 Bacteria 963
358 Ga0495665_0059931 3300046531 Bacteria 2009
359 Ga0495640_0094732 3300046533 Bacteria 1966
360 Ga0495586_0066391 3300046535 Bacteria 1967
361 Ga0495645_0235879 3300046543 Bacteria 1223
362 Ga0495622_0134533 3300046557 Bacteria 1124
363 Ga0495633_0163055 3300046558 Bacteria 1028
364 Ga0495667_0254202 3300046559 Bacteria 1118
365 Ga0495668_0041407 3300046616 Bacteria 2566
366 Ga0495668_0072360 3300046616 Bacteria 1894
367 Ga0495668_0095614 3300046616 Bacteria 1626
368 Ga0495668_0112011 3300046616 Bacteria 1492
369 Ga0495634_0007375 3300046642 Bacteria 8275
370 Ga0495635_0038630 3300046663 Bacteria 3304
371 Ga0495588_0048023 3300046674 Bacteria 2193
372 Ga0495599_0103854 3300046678 Bacteria 1771
373 Ga0495623_0135665 3300046679 Bacteria 1469
374 Ga0495647_0047425 3300046681 Bacteria 1658
375 Ga0495658_0082202 3300046683 Bacteria 1892
376 Ga0495658_0228587 3300046683 Bacteria 1166
377 Ga0495669_0124823 3300046684 Bacteria 1209
378 Ga0495669_0152493 3300046684 Bacteria 1094
379 Ga0495670_0158017 3300046691 Bacteria 1190
380 Ga0495600_0105711 3300046809 Bacteria 1834
381 Ga0495660_0135853 3300046810 Bacteria 1229
382 Ga0495604_0152879 3300047317 Bacteria 1638
383 Ga0495604_0170620 3300047317 Bacteria 1530
384 Ga0495674_0030756 3300047319 Bacteria 4879
385 Ga0495674_0355654 3300047319 Bacteria 1188
386 Ga0495676_0114377 3300047321 Bacteria 1974
387 Ga0495680_0033981 3300047322 Bacteria 4125
388 Ga0495683_0084414 3300047323 Bacteria 1545
389 Ga0495673_0059562 3300047469 Bacteria 1641
390 Ga0495684_0046672 3300047471 Bacteria 3313
391 Ga0495686_0035021 3300047472 Bacteria 3230
392 Ga0495686_0065554 3300047472 Bacteria 2245
393 Ga0495686_0206115 3300047472 Bacteria 1126
394 Ga0496101_0052618 3300048904 Bacteria 2936
395 Ga0496101_0064543 3300048904 Bacteria 2667
396 Ga0496101_0142579 3300048904 Bacteria 1827
397 Ga0496101_0483125 3300048904 Bacteria 978
398 Ga0496102_0086858 3300048905 Bacteria 2889
399 Ga0496102_0154865 3300048905 Bacteria 2154
400 Ga0496102_0276551 3300048905 Bacteria 1582
401 Ga0496102_0760026 3300048905 Bacteria 892
402 Ga0496103_0007418 3300048906 Bacteria 6536
403 Ga0496103_0166258 3300048906 Bacteria 1415
404 Ga0496104_0116558 3300048907 Bacteria 2563
405 Ga0496105_0076445 3300048908 Bacteria 2764
406 Ga0496106_0108762 3300048909 Bacteria 2156
407 Ga0496106_0166362 3300048909 Bacteria 1746
408 Ga0496107_0014960 3300048910 Bacteria 5434
409 Ga0496107_0039070 3300048910 Bacteria 3404
410 Ga0496107_0246619 3300048910 Bacteria 1329
411 Ga0496107_0273407 3300048910 Bacteria 1257
412 Ga0496107_0340372 3300048910 Bacteria 1116
413 Ga0496108_0019609 3300048911 Bacteria 5555
414 Ga0496109_0033949 3300048912 Bacteria 4591
415 Ga0496110_0026542 3300048913 Bacteria 4958
416 Ga0496110_0072012 3300048913 Bacteria 3066
417 Ga0496110_0373117 3300048913 Bacteria 1300
418 Ga0496112_0015093 3300048915 Bacteria 7195
419 Ga0496112_0086931 3300048915 Bacteria 3093
420 Ga0496112_0329513 3300048915 Bacteria 1471
421 Ga0496112_0493312 3300048915 Bacteria 1160
422 Ga0496113_0043069 3300048916 Bacteria 3338
423 Ga0496113_0158851 3300048916 Bacteria 1786
424 Ga0496113_0198708 3300048916 Bacteria 1593
425 Ga0496113_0696067 3300048916 Bacteria 811
426 Ga0496114_0156448 3300048917 Bacteria 1979
427 Ga0496114_0334799 3300048917 Bacteria 1338
428 Ga0496115_0035724 3300048918 Bacteria 3933
429 Ga0496117_0217221 3300048920 Bacteria 1067
430 Ga0496118_0130421 3300048921 Bacteria 1615
431 Ga0496119_0044301 3300048922 Bacteria 2803
432 Ga0496121_0000278 3300048924 Bacteria 106838
433 Ga0496121_0122719 3300048924 Bacteria 1959
434 Ga0496121_0284956 3300048924 Bacteria 1128
435 Ga0496122_0151453 3300048925 Bacteria 1431
436 Ga0496124_0305261 3300048927 Bacteria 1147
437 Ga0496125_0037843 3300048928 Bacteria 4189
438 Ga0496125_0120877 3300048928 Bacteria 1869
439 Ga0496126_0009449 3300048929 Bacteria 10350
440 Ga0496126_0012242 3300048929 Bacteria 8800
441 Ga0496126_0050659 3300048929 Bacteria 3783
442 Ga0496126_0057355 3300048929 Bacteria 3516
443 Ga0496126_0074141 3300048929 Bacteria 3023
444 Ga0496126_0127219 3300048929 Bacteria 2204
445 Ga0496126_0170929 3300048929 Bacteria 1852
446 Ga0496126_0223286 3300048929 Bacteria 1581
447 Ga0496126_0229433 3300048929 Bacteria 1556
448 Ga0496126_0313338 3300048929 Bacteria 1291
449 Ga0496126_0446454 3300048929 Bacteria 1042
450 Ga0501040_0254531 3300049576 Bacteria 1253
451 Ga0501047_0023892 3300049581 Bacteria 5870
452 Ga0501070_0380293 3300049586 Bacteria 1144
453 Ga0501076_0058517 3300049592 Bacteria 3064
454 Ga0501076_0331795 3300049592 Bacteria 1248
455 Ga0501080_0016386 3300049742 Bacteria 6845
456 Ga0501044_0017585 3300049823 Bacteria 7669
457 nmdc:mga03n38_12446_c1 3300050490 Bacteria 3202
458 nmdc:mga00v17_91427_c1 3300050491 Bacteria 1912
459 nmdc:mga0yw44_284956_c1 3300050492 Bacteria 1105
460 nmdc:mga0yw44_31098_c1 3300050492 Bacteria 3101
461 nmdc:mga0k408_14290_c1 3300050493 Bacteria 4371
462 nmdc:mga06z11_10188_c1 3300050494 Bacteria 3993
463 nmdc:mga07m45_11611_c1 3300050496 Bacteria 4631
464 nmdc:mga07m45_131205_c1 3300050496 Bacteria 1450
465 nmdc:mga07m45_44347_c1 3300050496 Bacteria 2496
466 nmdc:mga05p37_366330_c1 3300050507 Bacteria 1692
467 nmdc:mga0n895_193078_c1 3300050512 Bacteria 2067
468 nmdc:mga0rr50_206933_c1 3300050513 Bacteria 1615
469 nmdc:mga08x19_70835_c1 3300050514 Bacteria 2272
470 nmdc:mga0a205_274433_c1 3300050515 Bacteria 1562
471 nmdc:mga0sz30_97188_c2 3300050516 Bacteria 1034
472 Ga0495619_0075885 3300053085 Bacteria 2256
473 Ga0500643_000112 3300053087 Bacteria 84793
474 Ga0500566_0000262 3300053094 Bacteria 28125
475 Ga0500566_0001195 3300053094 Bacteria 15155
476 Ga0500566_0043727 3300053094 Bacteria 2580
477 Ga0500641_0053787 3300053096 Bacteria 1663
478 Ga0500555_049746 3300053103 Bacteria 1149
479 Ga0500556_0013991 3300053104 Bacteria 2441
480 Ga0500569_020432 3300053109 Bacteria 1738
481 Ga0500572_004331 3300053111 Bacteria 3222
482 Ga0500595_000510 3300053119 Bacteria 23431
483 Ga0500595_006468 3300053119 Bacteria 4966
484 Ga0500595_007359 3300053119 Bacteria 4572
485 Ga0500621_133385 3300053126 Bacteria 950
486 Ga0500568_0024502 3300053139 Bacteria 2555
487 Ga0500603_034509 3300053150 Bacteria 1322
488 Ga0500604_0051318 3300053151 Bacteria 1274
489 Ga0500616_0051130 3300053153 Bacteria 2179
490 Ga0500622_0018162 3300053156 Bacteria 3740
491 Ga0500637_0033859 3300053178 Bacteria 2855
492 Ga0500596_002288 3300053735 Bacteria 3790
493 Ga0500601_000103 3300053737 Bacteria 17658
494 2513623888 2513237092 Bacteria 8341956
495 2517889085 2517572143 Bacteria 9484767
496 2524441478 2524023205 Bacteria 8918781
497 2528852695 2528768022 Bacteria 10457665
498 2596375655 2595698237 Bacteria 6712432
499 2617373494 2617270741 Bacteria 8201522
500 2728755251 2728368998 Bacteria 8720350
501 2745077612 2744054633 Bacteria 8678936
502 2793072674 2791355197 Bacteria 8420563
503 2793078265
504 2824656333 2824653114 Bacteria 8493680
505 2824684703 2824679649 Bacteria 8248951
506 2824710353 2824704595 Bacteria 9667483
507 2824737653 2824732956 Bacteria 7810675
508 2824751175 2824746037 Bacteria 7911610
509 2824760689 2824753945 Bacteria 9787441
510 2824768493 2824763712 Bacteria 9792355
511 2841965310 2841957949 Bacteria 8652217
512 2847931284 2847930680 Bacteria 9342022
513 2857516316 2857509624 Bacteria 7472071
514 2861695531 2861691609 Bacteria 5628931
515 2874618680 2874612657 Bacteria 8252029
516 2874628566 2874628541 Bacteria 8630250
517 2879083807 2879083081 Bacteria 8587928
518 2879113269 2879110137 Bacteria 8907982
519 2881368963 2881364244 Bacteria 7710352
520 2881666522 2881665667 Bacteria 8175609
521 2885377593 2885374607 Bacteria 8927485
522 2885385892 2885383462 Bacteria 9473874
523 2885417958 2885409591 Bacteria 9235467
524 2888390464 2888388044 Bacteria 7304136
525 2888420084 2888419890 Bacteria 7857137
526 2889035267 2889033259 Bacteria 9099371
527 2904716291 2904711408 Bacteria 9771557
528 2906648373 2906643746 Bacteria 8722424
529 2908747690 2908739725 Bacteria 8628932
530 2908757027 2908756301 Bacteria 8864324
531 2908775965 2908775508 Bacteria 8092255
532 2922369345
533 2922396544 2922393267 Bacteria 8285685
534 2928130153 2928125067 Bacteria 5937560
535 2929203046 2929199973 Bacteria 7260745
536 2929618827 2929615660 Bacteria 9193770
537 2929628488 2929624759 Bacteria 9339455
538 2932791004 2932784394 Bacteria 9704911
539 2932794107 2932794094 Bacteria 7915132
540 2932809182 2932801729 Bacteria 7987968
541 2932833720 2932828146 Bacteria 9745859
542 2933580463 2933577622 Bacteria 9116884
543 2935623247 2935616580 Bacteria 9032984
544 2935636004 2935630451 Bacteria 8169952
545 2935644321 2935638405 Bacteria 10015038
546 2935674962 2935665750 Bacteria 9571747
547 2935679380 2935675223 Bacteria 9928132
548 2935686622 2935684952 Bacteria 9590419
549 2935700405 2935694250 Bacteria 9291695
550 2935710354 2935703347 Bacteria 10242284
551 2935716310 2935713505 Bacteria 9608509
552 2935723566 2935722832 Bacteria 9608746
553 2935735121 2935732158 Bacteria 9706831
554 2935744088 2935741537 Bacteria 9707219
555 2935752588 2935750917 Bacteria 9590372
556 2935808345 2935801545 Bacteria 9301974
557 2935833435 2935827899 Bacteria 10038562
558 2935846007 2935837841 Bacteria 9454360
559 2935861495 2935855204 Bacteria 9035059
560 2935869614 2935864058 Bacteria 9784707
561 2935879943 2935873716 Bacteria 9632195
562 2935889134 2935883170 Bacteria 7964738
563 2935966680 2935959822 Bacteria 7869783
564 2935997835 2935992306 Bacteria 9802711
565 2936008900 2936002035 Bacteria 9362176
566 2940558501 2940556831 Bacteria 9590747
567 2941512692 2941507105 Bacteria 8166816
568 2941520470 2941515067 Bacteria 8166720
569 2941528484 2941523033 Bacteria 8169134
570 2941547112 2941538514 Bacteria 9402094
571 3005486636 3005483717 Bacteria 7877331
572 3005593255 3005587118 Bacteria 7794411
573 3005595273 3005594810 Bacteria 8716512
574 3005718520 3005718088 Bacteria 8283608
575 8006927287 8006926726 Bacteria 6749210
576 8006991143 8006984368 Bacteria 9651211
577 8016517950 8016511872 Bacteria 9921665
578 8017058688 8017057580 Bacteria 10023680
579 8019576966 8019576017 Bacteria 10049540
580 8019595032 8019586578 Bacteria 10212056
581 8019606712 8019597564 Bacteria 10041141
582 8019611798 8019608314 Bacteria 10042931
583 8019652241 8019648815 Bacteria 10014479
584 8055742676 8055742211 Bacteria 9226248
585 8055912808 8055909800 Bacteria 7278581
586 Ga0495638_0016028
587 JGI24744J21845_10026689
588 JGI25406J46586_10000256
589 JGI25160J50197_1010119
590 JGI25404J52841_10030083
591 Ga0070676_10051365
592 Ga0070683_100004493
593 Ga0070683_100225276
594 Ga0070683_100267135
595 Ga0068869_100231800
596 Ga0070680_100084955
597 Ga0070680_100172832
598 Ga0068868_100063413
599 Ga0070661_100215637
600 Ga0070668_100064385
601 Ga0070668_100391541
602 Ga0070668_100531356
603 Ga0070671_100211609
604 Ga0070674_100437666
605 Ga0070659_100229930
606 Ga0070667_100329723
607 Ga0070709_10205373
608 Ga0070709_10248826
609 Ga0070713_100017781
610 Ga0070713_100035194
611 Ga0070713_100664969
612 Ga0070710_10013404
613 Ga0070710_10066561
614 Ga0070710_10110412
615 Ga0070711_100024466
616 Ga0070711_100092851
617 Ga0070711_100214900
618 Ga0070663_100084709
619 Ga0070663_100128118
620 Ga0070663_100152397
621 Ga0070663_100524167
622 Ga0070678_100068347
623 Ga0070678_100088081
624 Ga0070678_100098874
625 Ga0070678_100409735
626 Ga0070681_10004178
627 Ga0070681_10506463
628 Ga0070707_100254287
629 Ga0070698_100296410
630 Ga0070679_100085452
631 Ga0070679_100143811
632 Ga0070684_100008530
633 Ga0070684_100017771
634 Ga0070672_100274030
635 Ga0070672_100311923
636 Ga0070696_100092391
637 Ga0070665_100007488
638 Ga0070665_100056755
639 Ga0070665_100164203
640 Ga0070665_100309934
641 Ga0070665_100556015
642 Ga0070665_100604721
643 Ga0068855_100142216
644 Ga0068855_100321361
645 Ga0070664_100070506
646 Ga0070664_100233122
647 Ga0068857_100262780
648 Ga0068856_100158774
649 Ga0068856_100167938
650 Ga0068856_100171369
651 Ga0070702_100082056
652 Ga0068852_100088408
653 Ga0068852_100237125
654 Ga0068852_100332500
655 Ga0068864_100055366
656 Ga0068861_100248587
657 Ga0068861_100253242
658 Ga0068851_10132809
659 Ga0068863_100169065
660 Ga0068858_100137134
661 Ga0068860_100012321
662 Ga0068860_100650921
663 Ga0068862_100083456
664 Ga0068862_100185626
665 Ga0068862_100383487
666 Ga0081455_10013159
667 Ga0081455_10102881
668 Ga0081455_10195921
669 Ga0081455_10228712
670 Ga0081540_1002532
671 Ga0081540_1004042
672 Ga0081540_1005765
673 Ga0081540_1012681
674 Ga0081540_1026337
675 Ga0081540_1030647
676 Ga0081540_1030772
677 Ga0081540_1033763
678 Ga0081540_1043864
679 Ga0081540_1100942
680 Ga0081539_10000608
681 Ga0081539_10002743
682 Ga0081539_10015726
683 Ga0070717_10071574
684 Ga0075365_10055327
685 Ga0075365_10156257
686 Ga0075368_10020073
687 Ga0075363_100027180
688 Ga0075363_100067041
689 Ga0075363_100123870
690 Ga0075364_10176890
691 Ga0070716_100011909
692 Ga0070716_100178917
693 Ga0070712_100003832
694 Ga0070712_100205057
695 Ga0075362_10139874
696 Ga0075367_10219987
697 Ga0075369_10145700
698 Ga0075370_10063578
699 Ga0075370_10066654
700 Ga0075370_10190787
701 Ga0068871_100275134
702 Ga0068871_100312572
703 Ga0075428_100609249
704 Ga0075433_10337240
705 Ga0075434_100272871
706 Ga0075434_100502163
707 Ga0068865_100026883
708 Ga0068865_100190263
709 Ga0099825_1041592
710 Ga0099824_1010733
711 Ga0099823_1024318
712 Ga0075435_100278872
713 Ga0099794_10039477
714 Ga0099794_10042583
715 Ga0099794_10166001
716 Ga0099795_10033741
717 Ga0099795_10058832
718 Ga0105240_10083500
719 Ga0105240_10107526
720 Ga0105240_10481236
721 Ga0111539_10395682
722 Ga0111539_11021987
723 Ga0105245_10358380
724 Ga0114129_10065816
725 Ga0105243_10204135
726 Ga0105241_10131574
727 Ga0105242_10063484
728 Ga0105242_10074820
729 Ga0105248_10363041
730 Ga0105248_10403707
731 Ga0105248_10665248
732 Ga0105248_10813745
733 Ga0105237_10328542
734 Ga0105238_10449372
735 Ga0105249_10155359
736 Ga0105249_10306303
737 Ga0105249_10777957
738 Ga0099796_10064718
739 Ga0099796_10070882
740 Ga0105239_10120748
741 Ga0105239_10254404
742 Ga0157328_1001009
743 Ga0157370_10188253
744 Ga0157369_10076832
745 Ga0157369_10100287
746 Ga0157369_10106771
747 Ga0157374_10155243
748 Ga0157374_10318837
749 Ga0157378_10042708
750 Ga0157378_10216804
751 Ga0163162_10110451
752 Ga0163162_10365186
753 Ga0163162_10415051
754 Ga0157372_10172224
755 Ga0157372_10598202
756 Ga0157375_10225207
757 Ga0157375_10275017
758 Ga0157375_10423671
759 Ga0163163_10075527
760 Ga0163163_10095036
761 Ga0157380_10069744
762 Ga0157379_10159655
763 Ga0157379_10194410
764 Ga0157376_10058496
765 Ga0163161_10171795
766 Ga0214544_1000665
767 Ga0214542_1000486
768 Ga0214545_1000307
769 Ga0213875_10001636
770 Ga0209564_1003322
771 Ga0209758_1007720
772 Ga0209758_1008227
773 Ga0209758_1026917
774 Ga0209758_1049406
775 Ga0207426_1000227
776 Ga0207426_1015497
777 Ga0207656_10017867
778 Ga0207653_10042857
779 Ga0207692_10057636
780 Ga0207688_10085686
781 Ga0207688_10136080
782 Ga0207680_10274061
783 Ga0207685_10008828
784 Ga0207699_10016829
785 Ga0207645_10169027
786 Ga0207643_10028484
787 Ga0207643_10204988
788 Ga0207654_10035660
789 Ga0207707_10001922
790 Ga0207707_10004003
791 Ga0207707_10146040
792 Ga0207695_10195102
793 Ga0207693_10004965
794 Ga0207693_10031046
795 Ga0207663_10099686
796 Ga0207663_10163013
797 Ga0207663_10302644
798 Ga0207660_10277349
799 Ga0207660_10390337
800 Ga0207649_10208901
801 Ga0207649_10238119
802 Ga0207650_10127360
803 Ga0207687_10029203
804 Ga0207700_10019075
805 Ga0207700_10066757
806 Ga0207700_10380321
807 Ga0207664_10022137
808 Ga0207664_10086456
809 Ga0207644_10036883
810 Ga0207644_10094104
811 Ga0207644_10182793
812 Ga0207644_10334960
813 Ga0207644_10357459
814 Ga0207686_10103139
815 Ga0207709_10160378
816 Ga0207709_10309115
817 Ga0207670_10200708
818 Ga0207669_10351900
819 Ga0207669_10392569
820 Ga0207704_10076792
821 Ga0207704_10175380
822 Ga0207665_10002143
823 Ga0207665_10029872
824 Ga0207665_10082302
825 Ga0207665_10379223
826 Ga0207691_10206849
827 Ga0207691_10536211
828 Ga0207711_10197843
829 Ga0207711_10337525
830 Ga0207711_10411125
831 Ga0207711_10496534
832 Ga0207689_10080784
833 Ga0207689_10256320
834 Ga0207661_10001440
835 Ga0207667_10015124
836 Ga0207667_10373276
837 Ga0207667_10390788
838 Ga0207712_10079702
839 Ga0207668_10172071
840 Ga0207640_10345526
841 Ga0207658_10394923
842 Ga0207677_10031839
843 Ga0207703_10179288
844 Ga0207703_10293039
845 Ga0207678_10018024
846 Ga0207678_10173868
847 Ga0207678_10266536
848 Ga0207678_10328124
849 Ga0207708_10194866
850 Ga0207641_10163747
851 Ga0207641_10239518
852 Ga0207648_10039454
853 Ga0207676_10041483
854 Ga0207674_10489534
855 Ga0207675_100535515
856 Ga0207683_10137722
857 Ga0207683_10264107
858 Ga0209389_1000102
859 Ga0209489_100404
860 Ga0209700_100408
861 Ga0209588_1020217
862 Ga0268266_10001335
863 Ga0268266_10007399
864 Ga0268266_10041505
865 Ga0268266_10131781
866 Ga0268266_10268529
867 Ga0268266_10403715
868 Ga0268265_10351825
869 Ga0268265_10393734
870 Ga0268265_10663750
871 Ga0307517_10000232
872 Ga0307517_10235784
873 Ga0307515_10014473
874 Ga0307515_10227436
875 Ga0307513_10228685
876 Ga0307508_10337453
877 Ga0307508_10362687
878 Ga0307516_10003539
879 Ga0307516_10189204
880 Ga0307407_10119493
881 Ga0307415_100059673
882 Ga0307510_10006006
883 Ga0307510_10031035
884 Ga0373923_0002828
885 Ga0373936_0114110
886 Ga0373945_0116258
887 Ga0373924_0059621
888 Ga0373931_0011946
889 Ga0373931_0116542
890 Ga0373931_0181362
891 Ga0373927_0056083
892 Ga0373927_0131622
893 Ga0373933_0109287
894 Ga0373947_0073801
895 Ga0373937_0299585
896 Ga0373925_0007366
897 Ga0373925_0432033
898 Ga0395900_0013918
899 Ga0395898_0216683
900 Ga0395898_0233678
901 Ga0395905_0005023
902 Ga0395905_0092570
903 Ga0436364_1210479
904 Ga0436364_1557054
905 Ga0395901_0061354
906 Ga0436365_1053579
907 Ga0436365_1552613
908 Ga0436360_0314278
909 Ga0436361_0065851
910 Ga0436361_0203807
911 Ga0436363_1615506
912 Ga0439465_0090232
913 Ga0451853_0630845
914 Ga0466963_0074583
915 Ga0466964_0125131
916 Ga0466960_0083184
917 Ga0466960_0084589
918 Ga0495592_0086820
919 Ga0495603_0026994
920 Ga0495603_0038286
921 Ga0495603_0152586
922 Ga0495629_0069802
923 Ga0495638_0000880
924 Ga0495650_0120184
925 Ga0495580_0008306
926 Ga0495582_0125826
927 Ga0495639_0174414
928 Ga0495664_0076788
929 Ga0495664_0196285
930 Ga0495607_0046038
931 Ga0495606_0027491
932 Ga0495606_0177447
933 Ga0495606_0233003
934 Ga0495608_0097163
935 Ga0495618_0217781
936 Ga0495628_0039866
937 Ga0495630_0245660
938 Ga0495630_0300701
939 Ga0495631_0044402
940 Ga0495648_0166067
941 Ga0495648_0251686
942 Ga0495666_0184384
943 Ga0495665_0059931
944 Ga0495640_0094732
945 Ga0495586_0066391
946 Ga0495645_0235879
947 Ga0495622_0134533
948 Ga0495633_0163055
949 Ga0495667_0254202
950 Ga0495668_0041407
951 Ga0495668_0072360
952 Ga0495668_0095614
953 Ga0495668_0112011
954 Ga0495634_0007375
955 Ga0495635_0038630
956 Ga0495588_0048023
957 Ga0495599_0103854
958 Ga0495623_0135665
959 Ga0495647_0047425
960 Ga0495658_0082202
961 Ga0495658_0228587
962 Ga0495669_0124823
963 Ga0495669_0152493
964 Ga0495670_0158017
965 Ga0495600_0105711
966 Ga0495660_0135853
967 Ga0495604_0152879
968 Ga0495604_0170620
969 Ga0495674_0030756
970 Ga0495674_0355654
971 Ga0495676_0114377
972 Ga0495680_0033981
973 Ga0495683_0084414
974 Ga0495673_0059562
975 Ga0495684_0046672
976 Ga0495686_0035021
977 Ga0495686_0065554
978 Ga0495686_0206115
979 Ga0496101_0052618
980 Ga0496101_0064543
981 Ga0496101_0142579
982 Ga0496101_0483125
983 Ga0496102_0086858
984 Ga0496102_0154865
985 Ga0496102_0276551
986 Ga0496102_0760026
987 Ga0496103_0007418
988 Ga0496103_0166258
989 Ga0496104_0116558
990 Ga0496105_0076445
991 Ga0496106_0108762
992 Ga0496106_0166362
993 Ga0496107_0014960
994 Ga0496107_0039070
995 Ga0496107_0246619
996 Ga0496107_0273407
997 Ga0496107_0340372
998 Ga0496108_0019609
999 Ga0496109_0033949
1000 Ga0496110_0026542
1001 Ga0496110_0072012
1002 Ga0496110_0373117
1003 Ga0496112_0015093
1004 Ga0496112_0086931
1005 Ga0496112_0329513
1006 Ga0496112_0493312
1007 Ga0496113_0043069
1008 Ga0496113_0158851
1009 Ga0496113_0198708
1010 Ga0496113_0696067
1011 Ga0496114_0156448
1012 Ga0496114_0334799
1013 Ga0496115_0035724
1014 Ga0496117_0217221
1015 Ga0496118_0130421
1016 Ga0496119_0044301
1017 Ga0496121_0000278
1018 Ga0496121_0122719
1019 Ga0496121_0284956
1020 Ga0496122_0151453
1021 Ga0496124_0305261
1022 Ga0496125_0037843
1023 Ga0496125_0120877
1024 Ga0496126_0009449
1025 Ga0496126_0012242
1026 Ga0496126_0050659
1027 Ga0496126_0057355
1028 Ga0496126_0074141
1029 Ga0496126_0127219
1030 Ga0496126_0170929
1031 Ga0496126_0223286
1032 Ga0496126_0229433
1033 Ga0496126_0313338
1034 Ga0496126_0446454
1035 Ga0501040_0254531
1036 Ga0501047_0023892
1037 Ga0501070_0380293
1038 Ga0501076_0058517
1039 Ga0501076_0331795
1040 Ga0501080_0016386
1041 Ga0501044_0017585
1042 nmdc:mga03n38_12446_c1
1043 nmdc:mga00v17_91427_c1
1044 nmdc:mga0yw44_284956_c1
1045 nmdc:mga0yw44_31098_c1
1046 nmdc:mga0k408_14290_c1
1047 nmdc:mga06z11_10188_c1
1048 nmdc:mga07m45_11611_c1
1049 nmdc:mga07m45_131205_c1
1050 nmdc:mga07m45_44347_c1
1051 nmdc:mga05p37_366330_c1
1052 nmdc:mga0n895_193078_c1
1053 nmdc:mga0rr50_206933_c1
1054 nmdc:mga08x19_70835_c1
1055 nmdc:mga0a205_274433_c1
1056 nmdc:mga0sz30_97188_c2
1057 Ga0495619_0075885
1058 Ga0500643_000112
1059 Ga0500566_0000262
1060 Ga0500566_0001195
1061 Ga0500566_0043727
1062 Ga0500641_0053787
1063 Ga0500555_049746
1064 Ga0500556_0013991
1065 Ga0500569_020432
1066 Ga0500572_004331
1067 Ga0500595_000510
1068 Ga0500595_006468
1069 Ga0500595_007359
1070 Ga0500621_133385
1071 Ga0500568_0024502
1072 Ga0500603_034509
1073 Ga0500604_0051318
1074 Ga0500616_0051130
1075 Ga0500622_0018162
1076 Ga0500637_0033859
1077 Ga0500596_002288
1078 Ga0500601_000103
1079 2513623888
1080 2517889085
1081 2524441478
1082 2528852695
1083 2596375655
1084 2617373494
1085 2728755251
1086 2745077612
1087 2793072674
1088 2793078265
1089 2824656333
1090 2824684703
1091 2824710353
1092 2824737653
1093 2824751175
1094 2824760689
1095 2824768493
1096 2841965310
1097 2847931284
1098 2857516316
1099 2861695531
1100 2874618680
1101 2874628566
1102 2879083807
1103 2879113269
1104 2881368963
1105 2881666522
1106 2885377593
1107 2885385892
1108 2885417958
1109 2888390464
1110 2888420084
1111 2889035267
1112 2904716291
1113 2906648373
1114 2908747690
1115 2908757027
1116 2908775965
1117 2922369345
1118 2922396544
1119 2928130153
1120 2929203046
1121 2929618827
1122 2929628488
1123 2932791004
1124 2932794107
1125 2932809182
1126 2932833720
1127 2933580463
1128 2935623247
1129 2935636004
1130 2935644321
1131 2935674962
1132 2935679380
1133 2935686622
1134 2935700405
1135 2935710354
1136 2935716310
1137 2935723566
1138 2935735121
1139 2935744088
1140 2935752588
1141 2935808345
1142 2935833435
1143 2935846007
1144 2935861495
1145 2935869614
1146 2935879943
1147 2935889134
1148 2935966680
1149 2935997835
1150 2936008900
1151 2940558501
1152 2941512692
1153 2941520470
1154 2941528484
1155 2941547112
1156 3005486636
1157 3005593255
1158 3005595273
1159 3005718520
1160 8006927287
1161 8006991143
1162 8016517950
1163 8017058688
1164 8019576966
1165 8019595032
1166 8019606712
1167 8019611798
1168 8019652241
1169 8055742676
1170 8055912808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

308

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

314

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hgu-assembly1.cif.gz_B epoxide hydrolase from bosea sp. pamc 26642 0.9789 2 281
8hgu-assembly1.cif.gz_B epoxide hydrolase from bosea sp. pamc 26642 0.952 2 281
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9179 2 123
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9165 2 123
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9145 2 121
ID Description Score Start End Superfamily
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9391 11 121 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9315 2 122 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9119 2 85 3.40.50.12270
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9078 2 283 3.40.50.1820
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8936 2 281 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0R3BR81-F1-model_v4 deleted 0.998 1 287
AF-A0A7S7Z0V4-F1-model_v4 Alpha/beta hydrolase 0.9976 1 287 GO:0016787
AF-A0A0S6UKJ3-F1-model_v4 Soluble epoxide hydrolase 0.9965 1 287 GO:0016787
AF-A0A0S6UKJ3-F1-model_v4 Soluble epoxide hydrolase 0.9931 1 287 GO:0016787
AF-A7IG07-F1-model_v4 Alpha/beta hydrolase fold 0.9872 2 284 GO:0016787

Map