F466451

General Info

Members Datasets Scaffolds Average Seq Length
585 287 1170 117

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10069651|Ga0157378_100696514
Length 140
Sequence MSKSAPIERLPCKPFNPTGENSMKYLCLIYDDQSVWAKMPKGESDKMMEEYFAFTEGIKQSGHLIKGDALQPTSTATTVRVRNGKIGTTDGPFAETKEQLGGYYLIEAKDLNDAIQVAAKIPSARFGSIEVRPVVEFNQQ

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0.51
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10069651 3300013297 Bacteria 3156
2 Ga0065704_10816709 3300005289 Bacteria 520
3 Ga0065715_10265833 3300005293 Bacteria 1125
4 Ga0065715_10372621 3300005293 Bacteria 919
5 Ga0065707_10100072 3300005295 Bacteria 2957
6 Ga0065707_10145037 3300005295 Unclassified 1724
7 Ga0065707_10545111 3300005295 Bacteria 717
8 Ga0065707_10590991 3300005295 Bacteria 696
9 Ga0065707_10936058 3300005295 Bacteria 556
10 Ga0070676_10961662 3300005328 Unclassified 639
11 Ga0070690_100118109 3300005330 Bacteria 1777
12 Ga0070690_101240040 3300005330 Bacteria 596
13 Ga0070670_100026938 3300005331 Bacteria 4945
14 Ga0070670_100519515 3300005331 Bacteria 1060
15 Ga0070670_101595452 3300005331 Bacteria 600
16 Ga0070670_102270400 3300005331 Bacteria 500
17 Ga0068869_100066339 3300005334 Bacteria 2659
18 Ga0068869_100182210 3300005334 Bacteria 1647
19 Ga0068869_100347199 3300005334 Bacteria 1209
20 Ga0068869_100962913 3300005334 Bacteria 741
21 Ga0068869_101412796 3300005334 Bacteria 616
22 Ga0070666_10382715 3300005335 Bacteria 1010
23 Ga0070680_101564708 3300005336 Unclassified 571
24 Ga0070689_100027509 3300005340 Bacteria 4288
25 Ga0070689_100142868 3300005340 Bacteria 1926
26 Ga0070689_100740861 3300005340 Bacteria 861
27 Ga0070689_101105506 3300005340 Bacteria 709
28 Ga0070691_10000196 3300005341 Bacteria 20245
29 Ga0070687_101251635 3300005343 Bacteria 549
30 Ga0070661_100805505 3300005344 Bacteria 771
31 Ga0070692_10123854 3300005345 Bacteria 1445
32 Ga0070668_100738321 3300005347 Bacteria 871
33 Ga0070669_101597087 3300005353 Bacteria 568
34 Ga0070675_100421266 3300005354 Bacteria 1194
35 Ga0070675_101356264 3300005354 Unclassified 656
36 Ga0070671_100199461 3300005355 Bacteria 1697
37 Ga0070673_100102236 3300005364 Bacteria 2362
38 Ga0070673_100277034 3300005364 Bacteria 1470
39 Ga0070673_100400622 3300005364 Bacteria 1227
40 Ga0070673_100679453 3300005364 Bacteria 944
41 Ga0070688_100002788 3300005365 Bacteria 8877
42 Ga0070688_100649053 3300005365 Bacteria 812
43 Ga0070688_101186473 3300005365 Bacteria 613
44 Ga0070659_100046645 3300005366 Bacteria 3397
45 Ga0070667_100219877 3300005367 Bacteria 1690
46 Ga0070667_100794861 3300005367 Bacteria 878
47 Ga0070703_10346195 3300005406 Bacteria 633
48 Ga0070709_10369055 3300005434 Bacteria 1064
49 Ga0070709_10486699 3300005434 Bacteria 935
50 Ga0070713_100219277 3300005436 Bacteria 1725
51 Ga0070710_10055830 3300005437 Bacteria 2233
52 Ga0070710_10069311 3300005437 Bacteria 2029
53 Ga0070711_100032369 3300005439 Bacteria 3476
54 Ga0070705_100025484 3300005440 Bacteria 3207
55 Ga0070705_100344003 3300005440 Bacteria 1085
56 Ga0070705_100801696 3300005440 Unclassified 749
57 Ga0070705_101834732 3300005440 Bacteria 515
58 Ga0070700_101201584 3300005441 Bacteria 633
59 Ga0070700_101995725 3300005441 Bacteria 503
60 Ga0070694_100019769 3300005444 Bacteria 4286
61 Ga0070694_100156506 3300005444 Bacteria 1669
62 Ga0070708_100358316 3300005445 Bacteria 1375
63 Ga0070708_101929956 3300005445 Bacteria 547
64 Ga0070708_101972075 3300005445 Bacteria 541
65 Ga0070663_100654981 3300005455 Bacteria 888
66 Ga0070678_100659954 3300005456 Bacteria 939
67 Ga0070678_100991761 3300005456 Bacteria 772
68 Ga0070678_101648739 3300005456 Bacteria 603
69 Ga0070662_100325245 3300005457 Bacteria 1255
70 Ga0070681_10136305 3300005458 Bacteria 2385
71 Ga0068867_100488789 3300005459 Bacteria 1056
72 Ga0068867_100898354 3300005459 Bacteria 797
73 Ga0068867_101181361 3300005459 Bacteria 702
74 Ga0070685_10000600 3300005466 Bacteria 19953
75 Ga0070685_10721028 3300005466 Bacteria 729
76 Ga0070685_10920850 3300005466 Bacteria 652
77 Ga0070706_100684995 3300005467 Bacteria 951
78 Ga0070706_100930152 3300005467 Bacteria 803
79 Ga0070707_100982467 3300005468 Bacteria 809
80 Ga0070707_101112702 3300005468 Bacteria 756
81 Ga0070698_100000653 3300005471 Bacteria 37115
82 Ga0070698_100006921 3300005471 Bacteria 12287
83 Ga0070698_100015376 3300005471 Bacteria 8087
84 Ga0070698_100172573 3300005471 Bacteria 2103
85 Ga0070698_100408728 3300005471 Bacteria 1291
86 Ga0070698_100480843 3300005471 Bacteria 1179
87 Ga0070698_101759373 3300005471 Bacteria 572
88 Ga0070699_100011038 3300005518 Bacteria 7811
89 Ga0070699_100028973 3300005518 Bacteria 4774
90 Ga0070699_100059045 3300005518 Bacteria 3324
91 Ga0070679_100101016 3300005530 Bacteria 2871
92 Ga0070684_102235183 3300005535 Bacteria 516
93 Ga0070684_102364958 3300005535 Bacteria 501
94 Ga0070697_100017820 3300005536 Bacteria 5593
95 Ga0070697_101167278 3300005536 Bacteria 686
96 Ga0068853_100933224 3300005539 Bacteria 834
97 Ga0068853_101826616 3300005539 Bacteria 589
98 Ga0068853_101874603 3300005539 Bacteria 581
99 Ga0070672_100129255 3300005543 Bacteria 2075
100 Ga0070672_100319299 3300005543 Bacteria 1320
101 Ga0070672_100461256 3300005543 Bacteria 1095
102 Ga0070672_101803856 3300005543 Bacteria 550
103 Ga0070686_100862396 3300005544 Bacteria 734
104 Ga0070695_100119683 3300005545 Bacteria 1799
105 Ga0070695_100139235 3300005545 Bacteria 1681
106 Ga0070696_100002946 3300005546 Bacteria 11308
107 Ga0070696_100026035 3300005546 Bacteria 3979
108 Ga0070696_100186257 3300005546 Bacteria 1542
109 Ga0070696_100829508 3300005546 Bacteria 763
110 Ga0070696_100917977 3300005546 Bacteria 727
111 Ga0070696_101169473 3300005546 Bacteria 649
112 Ga0070696_101844296 3300005546 Bacteria 523
113 Ga0070704_100023983 3300005549 Bacteria 3996
114 Ga0070704_100035648 3300005549 Bacteria 3384
115 Ga0070704_100102234 3300005549 Bacteria 2162
116 Ga0070704_101508776 3300005549 Bacteria 618
117 Ga0068855_100033007 3300005563 Bacteria 6180
118 Ga0070664_100045437 3300005564 Bacteria 3709
119 Ga0070664_100144838 3300005564 Bacteria 2094
120 Ga0070664_100740711 3300005564 Bacteria 917
121 Ga0070664_100841360 3300005564 Bacteria 859
122 Ga0070664_101087129 3300005564 Bacteria 753
123 Ga0068857_100612777 3300005577 Bacteria 1030
124 Ga0068857_101615376 3300005577 Bacteria 633
125 Ga0068856_100067706 3300005614 Bacteria 3529
126 Ga0070702_100511850 3300005615 Bacteria 884
127 Ga0068859_100066636 3300005617 Bacteria 3636
128 Ga0068859_100190652 3300005617 Bacteria 2134
129 Ga0068859_100732888 3300005617 Bacteria 1078
130 Ga0068859_101015728 3300005617 Bacteria 911
131 Ga0068859_101372971 3300005617 Bacteria 779
132 Ga0068859_102124181 3300005617 Bacteria 620
133 Ga0068864_100792353 3300005618 Bacteria 931
134 Ga0068864_101077470 3300005618 Bacteria 799
135 Ga0068861_100325813 3300005719 Bacteria 1339
136 Ga0068861_100495791 3300005719 Bacteria 1103
137 Ga0068861_101226714 3300005719 Bacteria 726
138 Ga0068870_10879565 3300005840 Unclassified 631
139 Ga0068863_100072641 3300005841 Bacteria 3255
140 Ga0068863_100385937 3300005841 Bacteria 1368
141 Ga0068863_100536045 3300005841 Bacteria 1155
142 Ga0068863_100724703 3300005841 Bacteria 989
143 Ga0068863_101317660 3300005841 Bacteria 729
144 Ga0068858_100806116 3300005842 Bacteria 916
145 Ga0068858_101853027 3300005842 Bacteria 596
146 Ga0068860_100545120 3300005843 Bacteria 1162
147 Ga0068862_100680901 3300005844 Bacteria 994
148 Ga0068862_101036335 3300005844 Bacteria 813
149 Ga0070717_10281162 3300006028 Bacteria 1476
150 Ga0075365_10495896 3300006038 Bacteria 863
151 Ga0070716_100026689 3300006173 Bacteria 3095
152 Ga0070712_100029525 3300006175 Bacteria 3676
153 Ga0070712_100496700 3300006175 Bacteria 1022
154 Ga0075367_11021641 3300006178 Bacteria 528
155 Ga0097621_100187334 3300006237 Bacteria 1790
156 Ga0097621_100550940 3300006237 Bacteria 1050
157 Ga0097621_100710187 3300006237 Bacteria 926
158 Ga0097621_100851461 3300006237 Bacteria 847
159 Ga0068871_100015187 3300006358 Bacteria 5758
160 Ga0068871_100035839 3300006358 Bacteria 3946
161 Ga0068871_100532592 3300006358 Bacteria 1062
162 Ga0068871_100792739 3300006358 Bacteria 873
163 Ga0068871_100863639 3300006358 Bacteria 837
164 Ga0068871_101042690 3300006358 Bacteria 763
165 Ga0068871_101646132 3300006358 Bacteria 608
166 Ga0075428_100024193 3300006844 Bacteria 6718
167 Ga0075428_100283351 3300006844 Bacteria 1783
168 Ga0075428_100935540 3300006844 Bacteria 919
169 Ga0075430_100197144 3300006846 Bacteria 1673
170 Ga0075430_101161705 3300006846 Bacteria 636
171 Ga0075431_100051681 3300006847 Bacteria 4238
172 Ga0075431_101049521 3300006847 Bacteria 781
173 Ga0075433_10046940 3300006852 Bacteria 3756
174 Ga0075433_10063688 3300006852 Bacteria 3231
175 Ga0075433_10084326 3300006852 Bacteria 2805
176 Ga0075433_10512262 3300006852 Bacteria 1056
177 Ga0075434_100020754 3300006871 Bacteria 6376
178 Ga0075434_100029975 3300006871 Bacteria 5356
179 Ga0075434_100031731 3300006871 Bacteria 5209
180 Ga0075434_100041517 3300006871 Bacteria 4557
181 Ga0075434_100117144 3300006871 Bacteria 2677
182 Ga0075434_100153427 3300006871 Bacteria 2323
183 Ga0075434_100503285 3300006871 Bacteria 1232
184 Ga0075429_100181049 3300006880 Bacteria 1847
185 Ga0075429_101068907 3300006880 Bacteria 705
186 Ga0075429_101656461 3300006880 Bacteria 556
187 Ga0075436_100018481 3300006914 Bacteria 4772
188 Ga0075436_100032736 3300006914 Bacteria 3583
189 Ga0075436_100058504 3300006914 Bacteria 2662
190 Ga0075436_100063967 3300006914 Bacteria 2543
191 Ga0097620_100066635 3300006931 Bacteria 3636
192 Ga0097620_100190643 3300006931 Bacteria 2134
193 Ga0097620_100733011 3300006931 Bacteria 1078
194 Ga0097620_101015765 3300006931 Bacteria 911
195 Ga0097620_101373181 3300006931 Bacteria 779
196 Ga0097620_102123633 3300006931 Bacteria 620
197 Ga0075435_100006158 3300007076 Bacteria 8456
198 Ga0075435_100012828 3300007076 Bacteria 6211
199 Ga0075435_100068196 3300007076 Bacteria 2897
200 Ga0075435_100073923 3300007076 Bacteria 2787
201 Ga0075435_100085243 3300007076 Bacteria 2600
202 Ga0075435_100140666 3300007076 Bacteria 2025
203 Ga0075435_100573580 3300007076 Bacteria 978
204 Ga0075435_100985006 3300007076 Bacteria 736
205 Ga0099794_10676274 3300007265 Bacteria 549
206 Ga0099795_10033498 3300007788 Bacteria 1785
207 Ga0105240_11309976 3300009093 Bacteria 764
208 Ga0111539_10000289 3300009094 Bacteria 60610
209 Ga0111539_10091795 3300009094 Bacteria 3568
210 Ga0111539_10094606 3300009094 Bacteria 3510
211 Ga0111539_10157256 3300009094 Bacteria 2659
212 Ga0111539_10181968 3300009094 Bacteria 2454
213 Ga0105245_10683316 3300009098 Bacteria 1059
214 Ga0105245_11057482 3300009098 Bacteria 857
215 Ga0114129_10008559 3300009147 Bacteria 14584
216 Ga0114129_10015451 3300009147 Bacteria 10858
217 Ga0114129_10019399 3300009147 Bacteria 9683
218 Ga0114129_10053574 3300009147 Bacteria 5658
219 Ga0114129_10103188 3300009147 Bacteria 3943
220 Ga0114129_10244174 3300009147 Bacteria 2413
221 Ga0114129_10385536 3300009147 Bacteria 1850
222 Ga0114129_10482110 3300009147 Bacteria 1622
223 Ga0114129_11640702 3300009147 Bacteria 786
224 Ga0105243_11277479 3300009148 Bacteria 750
225 Ga0105241_10320261 3300009174 Bacteria 1337
226 Ga0105241_10543913 3300009174 Bacteria 1042
227 Ga0105241_11279138 3300009174 Bacteria 698
228 Ga0105242_10139649 3300009176 Bacteria 2101
229 Ga0105242_11132107 3300009176 Bacteria 798
230 Ga0105242_13110561 3300009176 Bacteria 514
231 Ga0105248_10483367 3300009177 Bacteria 1396
232 Ga0105248_10843116 3300009177 Bacteria 1034
233 Ga0105238_10000066 3300009551 Bacteria 120339
234 Ga0105249_10361424 3300009553 Bacteria 1473
235 Ga0105249_10501502 3300009553 Bacteria 1259
236 Ga0105249_11328170 3300009553 Bacteria 791
237 Ga0105249_12012722 3300009553 Bacteria 650
238 Ga0105246_10768592 3300011119 Bacteria 852
239 Ga0105246_11228180 3300011119 Unclassified 691
240 Ga0105246_11480482 3300011119 Bacteria 637
241 Ga0157373_10101298 3300013100 Bacteria 2027
242 Ga0157370_10752153 3300013104 Bacteria 888
243 Ga0163162_10339033 3300013306 Bacteria 1636
244 Ga0157372_10506211 3300013307 Bacteria 1408
245 Ga0157375_10174952 3300013308 Bacteria 2296
246 Ga0157375_10695019 3300013308 Bacteria 1171
247 Ga0163163_10329974 3300014325 Bacteria 1580
248 Ga0163163_12642519 3300014325 Bacteria 559
249 Ga0157380_10116303 3300014326 Bacteria 2257
250 Ga0157380_10401788 3300014326 Bacteria 1300
251 Ga0157380_11358757 3300014326 Bacteria 760
252 Ga0157380_13163641 3300014326 Bacteria 525
253 Ga0157377_10486802 3300014745 Bacteria 859
254 Ga0157379_10397097 3300014968 Unclassified 1267
255 Ga0157379_10425789 3300014968 Bacteria 1223
256 Ga0157376_10155730 3300014969 Bacteria 2066
257 Ga0157376_10989895 3300014969 Bacteria 863
258 Ga0163161_10276173 3300017792 Bacteria 1316
259 Ga0213876_10121165 3300021384 Bacteria 1389
260 Ga0207697_10416345 3300025315 Unclassified 597
261 Ga0207682_10210035 3300025893 Unclassified 898
262 Ga0207682_10524741 3300025893 Bacteria 560
263 Ga0207692_10220311 3300025898 Bacteria 1124
264 Ga0207692_10406560 3300025898 Bacteria 850
265 Ga0207680_10026783 3300025903 Bacteria 3200
266 Ga0207699_10013947 3300025906 Bacteria 4128
267 Ga0207699_10016193 3300025906 Bacteria 3893
268 Ga0207645_10060138 3300025907 Bacteria 2426
269 Ga0207645_10122914 3300025907 Unclassified 1686
270 Ga0207705_10044668 3300025909 Bacteria 3184
271 Ga0207684_10565958 3300025910 Bacteria 972
272 Ga0207707_10019823 3300025912 Bacteria 5871
273 Ga0207693_10007169 3300025915 Bacteria 9185
274 Ga0207663_10287729 3300025916 Bacteria 1223
275 Ga0207660_10152959 3300025917 Bacteria 1774
276 Ga0207657_10073899 3300025919 Bacteria 2880
277 Ga0207649_11362163 3300025920 Bacteria 561
278 Ga0207652_10039324 3300025921 Bacteria 4014
279 Ga0207652_10087244 3300025921 Bacteria 2736
280 Ga0207646_10194337 3300025922 Bacteria 1832
281 Ga0207681_10592195 3300025923 Bacteria 916
282 Ga0207681_11193850 3300025923 Bacteria 639
283 Ga0207694_10000007 3300025924 Bacteria 595422
284 Ga0207650_10018513 3300025925 Bacteria 4888
285 Ga0207650_10158298 3300025925 Bacteria 1793
286 Ga0207650_10236696 3300025925 Bacteria 1474
287 Ga0207659_10250973 3300025926 Bacteria 1436
288 Ga0207687_10821668 3300025927 Bacteria 793
289 Ga0207644_10112156 3300025931 Bacteria 2063
290 Ga0207644_10186008 3300025931 Bacteria 1631
291 Ga0207690_10147997 3300025932 Bacteria 1738
292 Ga0207690_10190313 3300025932 Bacteria 1551
293 Ga0207706_10021702 3300025933 Bacteria 5763
294 Ga0207670_10461508 3300025936 Unclassified 1025
295 Ga0207670_10908197 3300025936 Bacteria 738
296 Ga0207670_10984822 3300025936 Bacteria 709
297 Ga0207704_10083423 3300025938 Bacteria 2074
298 Ga0207665_10160097 3300025939 Bacteria 1619
299 Ga0207691_10340077 3300025940 Bacteria 1285
300 Ga0207691_10464561 3300025940 Bacteria 1076
301 Ga0207711_10163151 3300025941 Bacteria 2018
302 Ga0207711_10213374 3300025941 Bacteria 1764
303 Ga0207711_10459490 3300025941 Bacteria 1185
304 Ga0207689_10195603 3300025942 Bacteria 1669
305 Ga0207689_10232189 3300025942 Bacteria 1525
306 Ga0207689_10469695 3300025942 Bacteria 1052
307 Ga0207689_10884117 3300025942 Bacteria 754
308 Ga0207679_10373097 3300025945 Bacteria 1249
309 Ga0207651_10359267 3300025960 Bacteria 1229
310 Ga0207651_10604717 3300025960 Bacteria 959
311 Ga0207651_10976842 3300025960 Bacteria 756
312 Ga0207651_11570242 3300025960 Bacteria 593
313 Ga0207651_11682509 3300025960 Unclassified 571
314 Ga0207658_10067592 3300025986 Bacteria 2693
315 Ga0207658_10311219 3300025986 Bacteria 1360
316 Ga0207677_10851051 3300026023 Bacteria 819
317 Ga0207677_11511591 3300026023 Bacteria 620
318 Ga0207703_10246427 3300026035 Bacteria 1608
319 Ga0207703_10699466 3300026035 Bacteria 964
320 Ga0207639_11362792 3300026041 Bacteria 666
321 Ga0207678_10214141 3300026067 Bacteria 1648
322 Ga0207678_11243082 3300026067 Bacteria 659
323 Ga0207708_10934418 3300026075 Bacteria 752
324 Ga0207702_10349012 3300026078 Bacteria 1415
325 Ga0207641_10646783 3300026088 Bacteria 1038
326 Ga0207641_11307721 3300026088 Bacteria 725
327 Ga0207641_11699425 3300026088 Bacteria 633
328 Ga0207648_10227534 3300026089 Bacteria 1658
329 Ga0207648_10617628 3300026089 Bacteria 1000
330 Ga0207648_10817155 3300026089 Bacteria 868
331 Ga0207676_10763534 3300026095 Bacteria 941
332 Ga0207676_11532684 3300026095 Bacteria 664
333 Ga0207676_11953865 3300026095 Bacteria 585
334 Ga0207674_11367415 3300026116 Bacteria 677
335 Ga0207675_100113125 3300026118 Bacteria 2563
336 Ga0207675_100293381 3300026118 Bacteria 1582
337 Ga0207675_101620655 3300026118 Bacteria 667
338 Ga0207675_101639635 3300026118 Bacteria 663
339 Ga0207683_10176342 3300026121 Bacteria 1937
340 Ga0207683_11421401 3300026121 Bacteria 641
341 Ga0207683_11599595 3300026121 Bacteria 601
342 Ga0207698_10499097 3300026142 Bacteria 1184
343 Ga0209969_1011145 3300027360 Bacteria 1290
344 Ga0207428_10009568 3300027907 Bacteria 8682
345 Ga0207428_10071520 3300027907 Bacteria 2724
346 Ga0207428_10099163 3300027907 Bacteria 2253
347 Ga0268265_10269420 3300028380 Bacteria 1518
348 Ga0265320_10055838 3300031240 Bacteria 1900
349 Ga0265331_10178744 3300031250 Bacteria 959
350 Ga0307408_100075461 3300031548 Bacteria 2505
351 Ga0307408_100201497 3300031548 Bacteria 1611
352 Ga0307408_100415151 3300031548 Bacteria 1159
353 Ga0307408_100742463 3300031548 Bacteria 886
354 Ga0307408_101042876 3300031548 Bacteria 756
355 Ga0307408_102341440 3300031548 Bacteria 518
356 Ga0307405_10256232 3300031731 Bacteria 1304
357 Ga0307405_10376225 3300031731 Bacteria 1104
358 Ga0307405_10427363 3300031731 Bacteria 1044
359 Ga0307405_10799337 3300031731 Bacteria 790
360 Ga0307413_11665635 3300031824 Bacteria 568
361 Ga0307410_10021457 3300031852 Bacteria 3974
362 Ga0307406_10118101 3300031901 Bacteria 1838
363 Ga0307406_10328705 3300031901 Bacteria 1186
364 Ga0307406_10989379 3300031901 Bacteria 721
365 Ga0307407_10541108 3300031903 Bacteria 859
366 Ga0307407_10734377 3300031903 Bacteria 746
367 Ga0307407_11150157 3300031903 Bacteria 605
368 Ga0307412_10301618 3300031911 Bacteria 1266
369 Ga0307412_10356080 3300031911 Bacteria 1177
370 Ga0307412_10454370 3300031911 Bacteria 1056
371 Ga0307412_10555079 3300031911 Bacteria 965
372 Ga0307412_10565911 3300031911 Bacteria 957
373 Ga0307409_100336133 3300031995 Bacteria 1419
374 Ga0307409_100417899 3300031995 Bacteria 1286
375 Ga0307409_101500273 3300031995 Bacteria 701
376 Ga0307409_102432565 3300031995 Bacteria 553
377 Ga0307416_100013324 3300032002 Bacteria 5584
378 Ga0307416_100048136 3300032002 Bacteria 3380
379 Ga0307416_100651146 3300032002 Bacteria 1138
380 Ga0307416_100860816 3300032002 Bacteria 1005
381 Ga0307416_101391006 3300032002 Bacteria 807
382 Ga0307416_101524316 3300032002 Bacteria 774
383 Ga0307414_10336842 3300032004 Bacteria 1290
384 Ga0307414_11107507 3300032004 Bacteria 731
385 Ga0307411_10119937 3300032005 Bacteria 1901
386 Ga0307411_10351285 3300032005 Bacteria 1202
387 Ga0307411_10470278 3300032005 Bacteria 1056
388 Ga0307411_11402308 3300032005 Bacteria 639
389 Ga0307411_11697808 3300032005 Bacteria 584
390 Ga0307415_100071591 3300032126 Bacteria 2439
391 Ga0307415_100414626 3300032126 Bacteria 1154
392 Ga0307415_100805941 3300032126 Bacteria 858
393 Ga0307415_101784258 3300032126 Bacteria 595
394 Ga0307415_102109249 3300032126 Bacteria 550
395 Ga0373959_0071256 3300034820 Bacteria 786
396 Ga0373938_0147587 3300034957 Bacteria 624
397 Ga0373926_0000574 3300035083 Bacteria 9904
398 Ga0373929_0010287 3300035085 Bacteria 1747
399 Ga0373929_0069655 3300035085 Bacteria 839
400 Ga0373949_0042949 3300035090 Bacteria 1117
401 Ga0373949_0086868 3300035090 Bacteria 841
402 Ga0373923_0070278 3300035111 Bacteria 1502
403 Ga0373932_0184151 3300035112 Bacteria 734
404 Ga0373939_0065219 3300035114 Bacteria 1171
405 Ga0373939_0110493 3300035114 Bacteria 956
406 Ga0373941_0042279 3300035115 Bacteria 1414
407 Ga0373945_0005516 3300035116 Bacteria 4051
408 Ga0373953_0561128 3300035117 Bacteria 508
409 Ga0373954_0013281 3300035118 Bacteria 3669
410 Ga0373956_0000268 3300035119 Bacteria 20838
411 Ga0373957_0123761 3300035120 Bacteria 1048
412 Ga0373943_0002132 3300035170 Bacteria 8990
413 Ga0373946_0004700 3300035171 Bacteria 4906
414 Ga0373955_0001383 3300035172 Bacteria 10302
415 Ga0373931_0436440 3300035691 Bacteria 835
416 Ga0373935_0000219 3300035692 Bacteria 27677
417 Ga0373935_0526254 3300035692 Bacteria 860
418 Ga0373927_0007443 3300035695 Bacteria 7411
419 Ga0373933_0000048 3300035724 Bacteria 74138
420 Ga0373947_0000570 3300035725 Bacteria 21527
421 Ga0373937_0000043 3300036401 Bacteria 108234
422 Ga0373937_0302001 3300036401 Bacteria 1513
423 Ga0373925_0000764 3300037068 Bacteria 29537
424 Ga0373925_1388682 3300037068 Bacteria 575
425 Ga0395905_0717102 3300037471 Bacteria 902
426 Ga0242420_021595 3300038996 Bacteria 1153
427 Ga0242420_035846 3300038996 Bacteria 934
428 Ga0436365_0072455 3300039437 Bacteria 9114
429 Ga0436365_0272919 3300039437 Bacteria 5207
430 Ga0436363_0063738 3300039450 Bacteria 1233
431 Ga0436363_1365828 3300039450 Bacteria 8842
432 Ga0436362_0449576 3300039453 Bacteria 4951
433 Ga0439441_004746 3300042001 Bacteria 2076
434 Ga0439441_081118 3300042001 Bacteria 707
435 Ga0439443_101299 3300042003 Bacteria 552
436 Ga0439450_004088 3300042008 Bacteria 2466
437 Ga0451577_1097023 3300042876 Bacteria 712
438 Ga0466969_0273178 3300044656 Bacteria 766
439 Ga0453683_0029491 3300044673 Bacteria 3469
440 Ga0466966_0397929 3300044684 Bacteria 828
441 Ga0466966_0457946 3300044684 Bacteria 767
442 Ga0466963_0006897 3300044694 Bacteria 6758
443 Ga0466971_0633885 3300044719 Bacteria 534
444 Ga0466968_0318478 3300044735 Bacteria 751
445 Ga0466968_0721826 3300044735 Bacteria 510
446 Ga0466957_0140960 3300044842 Bacteria 1553
447 Ga0466959_0180547 3300045049 Bacteria 1476
448 Ga0466959_0354168 3300045049 Bacteria 1001
449 Ga0451576_0027257 3300045051 Bacteria 6138
450 Ga0451576_1135872 3300045051 Bacteria 817
451 Ga0466958_0030094 3300045836 Bacteria 3222
452 Ga0466967_0014628 3300045976 Bacteria 6122
453 Ga0466967_0649870 3300045976 Bacteria 1043
454 Ga0495592_0011717 3300046454 Bacteria 6640
455 Ga0495592_0233661 3300046454 Bacteria 1223
456 Ga0495603_0000562 3300046455 Bacteria 20800
457 Ga0495603_0141608 3300046455 Bacteria 1399
458 Ga0495629_0049607 3300046459 Bacteria 2941
459 Ga0495651_0000222 3300046462 Bacteria 43370
460 Ga0495653_0000050 3300046463 Bacteria 106233
461 Ga0495580_0002017 3300046472 Bacteria 17879
462 Ga0495580_0688579 3300046472 Bacteria 670
463 Ga0495582_0001715 3300046473 Bacteria 12363
464 Ga0495639_0000508 3300046475 Bacteria 18386
465 Ga0495594_0156617 3300046499 Bacteria 1294
466 Ga0495608_0000073 3300046511 Bacteria 76724
467 Ga0495618_0238615 3300046514 Bacteria 1143
468 Ga0495618_0702846 3300046514 Bacteria 594
469 Ga0495628_0000157 3300046516 Bacteria 59167
470 Ga0495628_0226276 3300046516 Bacteria 1403
471 Ga0495630_0001130 3300046517 Bacteria 18408
472 Ga0495630_0001940 3300046517 Bacteria 14410
473 Ga0495666_0164554 3300046526 Bacteria 1028
474 Ga0495665_0000137 3300046531 Bacteria 35494
475 Ga0495586_0741202 3300046535 Bacteria 567
476 Ga0495587_0003874 3300046536 Bacteria 9927
477 Ga0495598_0072239 3300046537 Bacteria 1089
478 Ga0495645_0000299 3300046543 Bacteria 36039
479 Ga0495645_0123394 3300046543 Bacteria 1822
480 Ga0495667_0000191 3300046559 Bacteria 41960
481 Ga0495634_0056242 3300046642 Bacteria 2629
482 Ga0495635_0000066 3300046663 Bacteria 64707
483 Ga0495659_0523288 3300046664 Unclassified 521
484 Ga0495588_0000380 3300046674 Bacteria 25738
485 Ga0495588_0383562 3300046674 Bacteria 738
486 Ga0495657_0000053 3300046675 Bacteria 100979
487 Ga0495599_0000403 3300046678 Bacteria 24753
488 Ga0495623_0000098 3300046679 Bacteria 52586
489 Ga0495646_0008378 3300046680 Bacteria 6573
490 Ga0495658_0000248 3300046683 Bacteria 30893
491 Ga0495613_0020256 3300046689 Bacteria 4958
492 Ga0495613_0085508 3300046689 Bacteria 2288
493 Ga0495600_0000032 3300046809 Bacteria 85490
494 Ga0495581_0000687 3300047315 Bacteria 17751
495 Ga0495604_0000051 3300047317 Bacteria 103371
496 Ga0495674_0001207 3300047319 Bacteria 25026
497 Ga0495674_0896551 3300047319 Bacteria 685
498 Ga0495676_0541629 3300047321 Bacteria 761
499 Ga0495680_0002218 3300047322 Bacteria 20044
500 Ga0495675_0048559 3300047444 Bacteria 2700
501 Ga0495684_0000062 3300047471 Bacteria 73594
502 Ga0495593_0000178 3300047673 Bacteria 32900
503 Ga0495593_0244196 3300047673 Bacteria 899
504 Ga0495602_0000245 3300048088 Bacteria 50884
505 Ga0495614_0000297 3300048089 Bacteria 19603
506 Ga0496102_0059330 3300048905 Bacteria 3499
507 Ga0496103_0058762 3300048906 Bacteria 2389
508 Ga0496112_0010719 3300048915 Bacteria 8333
509 Ga0501036_0102572 3300049572 Bacteria 2420
510 Ga0501037_0103668 3300049573 Bacteria 2052
511 Ga0501041_0056605 3300049577 Bacteria 2396
512 Ga0501042_0050106 3300049578 Bacteria 2978
513 Ga0501046_0125936 3300049580 Bacteria 1946
514 Ga0501071_0139115 3300049587 Bacteria 1807
515 Ga0501072_0015157 3300049588 Bacteria 5911
516 Ga0501072_0471432 3300049588 Bacteria 994
517 Ga0501075_0054414 3300049591 Bacteria 3010
518 Ga0501075_0201704 3300049591 Bacteria 1517
519 Ga0501075_0370697 3300049591 Bacteria 1091
520 Ga0501076_0168781 3300049592 Bacteria 1783
521 Ga0501076_0673910 3300049592 Bacteria 854
522 Ga0501077_0029622 3300049593 Bacteria 3481
523 Ga0501079_0019567 3300049741 Bacteria 5171
524 Ga0501083_0063176 3300049744 Bacteria 2470
525 Ga0501273_047287 3300049770 Bacteria 650
526 Ga0501045_0020641 3300049824 Bacteria 4707
527 nmdc:mga0yw44_25569_c1 3300050492 Bacteria 3359
528 nmdc:mga05p37_150234_c1 3300050507 Bacteria 2850
529 nmdc:mga05p37_17162_c1 3300050507 Bacteria 8733
530 nmdc:mga05p37_199794_c1 3300050507 Bacteria 2422
531 nmdc:mga05p37_2243329_c1 3300050507 Bacteria 505
532 nmdc:mga05p37_42547_c1 3300050507 Bacteria 5582
533 nmdc:mga05p37_432979_c2 3300050507 Bacteria 1144
534 nmdc:mga05p37_57502_c1 3300050507 Bacteria 4790
535 nmdc:mga05p37_694476_c1 3300050507 Bacteria 1132
536 nmdc:mga05p37_69913_c1 3300050507 Bacteria 4318
537 nmdc:mga05p37_8520_c1 3300050507 Bacteria 12119
538 nmdc:mga09592_166053_c1 3300050508 Bacteria 1908
539 nmdc:mga09592_549016_c1 3300050508 Bacteria 992
540 nmdc:mga0qj67_191446_c1 3300050509 Bacteria 1662
541 nmdc:mga06r32_132498_c1 3300050510 Bacteria 1941
542 nmdc:mga06r32_37005_c1 3300050510 Bacteria 4616
543 nmdc:mga06r32_45858_c1 3300050510 Bacteria 4169
544 nmdc:mga08y16_1406_c1 3300050511 Bacteria 24115
545 nmdc:mga08y16_146131_c1 3300050511 Bacteria 2458
546 nmdc:mga08y16_171780_c1 3300050511 Unclassified 2251
547 nmdc:mga08y16_270823_c1 3300050511 Bacteria 1753
548 nmdc:mga08y16_594593_c1 3300050511 Bacteria 1116
549 nmdc:mga08y16_626050_c1 3300050511 Bacteria 1082
550 nmdc:mga08y16_82196_c1 3300050511 Bacteria 3358
551 nmdc:mga0n895_1016407_c1 3300050512 Bacteria 810
552 nmdc:mga0n895_1130352_c1 3300050512 Bacteria 760
553 nmdc:mga0n895_116428_c1 3300050512 Bacteria 2691
554 nmdc:mga0n895_208210_c1 3300050512 Bacteria 1986
555 nmdc:mga0n895_2196689_c1 3300050512 Bacteria 507
556 nmdc:mga0n895_23749_c1 3300050512 Bacteria 5767
557 nmdc:mga0n895_313249_c1 3300050512 Bacteria 1590
558 nmdc:mga0n895_391741_c1 3300050512 Bacteria 1405
559 nmdc:mga0n895_49290_c1 3300050512 Bacteria 4125
560 nmdc:mga0n895_80740_c1 3300050512 Bacteria 3241
561 nmdc:mga0n895_999939_c1 3300050512 Bacteria 818
562 nmdc:mga0rr50_116227_c1 3300050513 Bacteria 2124
563 nmdc:mga0rr50_31773_c1 3300050513 Bacteria 3754
564 nmdc:mga0rr50_324543_c1 3300050513 Bacteria 1291
565 nmdc:mga0rr50_540646_c1 3300050513 Bacteria 992
566 nmdc:mga0rr50_89181_c1 3300050513 Bacteria 2398
567 nmdc:mga08x19_121457_c1 3300050514 Bacteria 1752
568 nmdc:mga08x19_154228_c1 3300050514 Bacteria 1557
569 nmdc:mga08x19_20169_c1 3300050514 Bacteria 4103
570 nmdc:mga08x19_590571_c1 3300050514 Bacteria 787
571 nmdc:mga08x19_78425_c1 3300050514 Bacteria 2165
572 nmdc:mga0a205_1002555_c1 3300050515 Bacteria 682
573 nmdc:mga0a205_20548_c1 3300050515 Bacteria 6232
574 nmdc:mga0a205_54297_c1 3300050515 Bacteria 3868
575 nmdc:mga0a205_6045_c1 3300050515 Bacteria 10919
576 nmdc:mga0a205_74627_c1 3300050515 Bacteria 3277
577 Ga0495601_0517046 3300053077 Unclassified 769
578 Ga0495595_0063382 3300053084 Bacteria 1735
579 Ga0495619_0001025 3300053085 Bacteria 18304
580 Ga0495619_0349343 3300053085 Bacteria 1023
581 Ga0500628_011339 3300053129 Bacteria 1618
582 Ga0501082_0063007 3300060353 Bacteria 3192
583 Ga0466962_0213118 3300061719 Bacteria 945
584 Ga0530510_0006096 3300061734 Bacteria 8370
585 Ga0530510_0140416 3300061734 Bacteria 1780
586 Ga0157378_10069651
587 Ga0065704_10816709
588 Ga0065715_10265833
589 Ga0065715_10372621
590 Ga0065707_10100072
591 Ga0065707_10145037
592 Ga0065707_10545111
593 Ga0065707_10590991
594 Ga0065707_10936058
595 Ga0070676_10961662
596 Ga0070690_100118109
597 Ga0070690_101240040
598 Ga0070670_100026938
599 Ga0070670_100519515
600 Ga0070670_101595452
601 Ga0070670_102270400
602 Ga0068869_100066339
603 Ga0068869_100182210
604 Ga0068869_100347199
605 Ga0068869_100962913
606 Ga0068869_101412796
607 Ga0070666_10382715
608 Ga0070680_101564708
609 Ga0070689_100027509
610 Ga0070689_100142868
611 Ga0070689_100740861
612 Ga0070689_101105506
613 Ga0070691_10000196
614 Ga0070687_101251635
615 Ga0070661_100805505
616 Ga0070692_10123854
617 Ga0070668_100738321
618 Ga0070669_101597087
619 Ga0070675_100421266
620 Ga0070675_101356264
621 Ga0070671_100199461
622 Ga0070673_100102236
623 Ga0070673_100277034
624 Ga0070673_100400622
625 Ga0070673_100679453
626 Ga0070688_100002788
627 Ga0070688_100649053
628 Ga0070688_101186473
629 Ga0070659_100046645
630 Ga0070667_100219877
631 Ga0070667_100794861
632 Ga0070703_10346195
633 Ga0070709_10369055
634 Ga0070709_10486699
635 Ga0070713_100219277
636 Ga0070710_10055830
637 Ga0070710_10069311
638 Ga0070711_100032369
639 Ga0070705_100025484
640 Ga0070705_100344003
641 Ga0070705_100801696
642 Ga0070705_101834732
643 Ga0070700_101201584
644 Ga0070700_101995725
645 Ga0070694_100019769
646 Ga0070694_100156506
647 Ga0070708_100358316
648 Ga0070708_101929956
649 Ga0070708_101972075
650 Ga0070663_100654981
651 Ga0070678_100659954
652 Ga0070678_100991761
653 Ga0070678_101648739
654 Ga0070662_100325245
655 Ga0070681_10136305
656 Ga0068867_100488789
657 Ga0068867_100898354
658 Ga0068867_101181361
659 Ga0070685_10000600
660 Ga0070685_10721028
661 Ga0070685_10920850
662 Ga0070706_100684995
663 Ga0070706_100930152
664 Ga0070707_100982467
665 Ga0070707_101112702
666 Ga0070698_100000653
667 Ga0070698_100006921
668 Ga0070698_100015376
669 Ga0070698_100172573
670 Ga0070698_100408728
671 Ga0070698_100480843
672 Ga0070698_101759373
673 Ga0070699_100011038
674 Ga0070699_100028973
675 Ga0070699_100059045
676 Ga0070679_100101016
677 Ga0070684_102235183
678 Ga0070684_102364958
679 Ga0070697_100017820
680 Ga0070697_101167278
681 Ga0068853_100933224
682 Ga0068853_101826616
683 Ga0068853_101874603
684 Ga0070672_100129255
685 Ga0070672_100319299
686 Ga0070672_100461256
687 Ga0070672_101803856
688 Ga0070686_100862396
689 Ga0070695_100119683
690 Ga0070695_100139235
691 Ga0070696_100002946
692 Ga0070696_100026035
693 Ga0070696_100186257
694 Ga0070696_100829508
695 Ga0070696_100917977
696 Ga0070696_101169473
697 Ga0070696_101844296
698 Ga0070704_100023983
699 Ga0070704_100035648
700 Ga0070704_100102234
701 Ga0070704_101508776
702 Ga0068855_100033007
703 Ga0070664_100045437
704 Ga0070664_100144838
705 Ga0070664_100740711
706 Ga0070664_100841360
707 Ga0070664_101087129
708 Ga0068857_100612777
709 Ga0068857_101615376
710 Ga0068856_100067706
711 Ga0070702_100511850
712 Ga0068859_100066636
713 Ga0068859_100190652
714 Ga0068859_100732888
715 Ga0068859_101015728
716 Ga0068859_101372971
717 Ga0068859_102124181
718 Ga0068864_100792353
719 Ga0068864_101077470
720 Ga0068861_100325813
721 Ga0068861_100495791
722 Ga0068861_101226714
723 Ga0068870_10879565
724 Ga0068863_100072641
725 Ga0068863_100385937
726 Ga0068863_100536045
727 Ga0068863_100724703
728 Ga0068863_101317660
729 Ga0068858_100806116
730 Ga0068858_101853027
731 Ga0068860_100545120
732 Ga0068862_100680901
733 Ga0068862_101036335
734 Ga0070717_10281162
735 Ga0075365_10495896
736 Ga0070716_100026689
737 Ga0070712_100029525
738 Ga0070712_100496700
739 Ga0075367_11021641
740 Ga0097621_100187334
741 Ga0097621_100550940
742 Ga0097621_100710187
743 Ga0097621_100851461
744 Ga0068871_100015187
745 Ga0068871_100035839
746 Ga0068871_100532592
747 Ga0068871_100792739
748 Ga0068871_100863639
749 Ga0068871_101042690
750 Ga0068871_101646132
751 Ga0075428_100024193
752 Ga0075428_100283351
753 Ga0075428_100935540
754 Ga0075430_100197144
755 Ga0075430_101161705
756 Ga0075431_100051681
757 Ga0075431_101049521
758 Ga0075433_10046940
759 Ga0075433_10063688
760 Ga0075433_10084326
761 Ga0075433_10512262
762 Ga0075434_100020754
763 Ga0075434_100029975
764 Ga0075434_100031731
765 Ga0075434_100041517
766 Ga0075434_100117144
767 Ga0075434_100153427
768 Ga0075434_100503285
769 Ga0075429_100181049
770 Ga0075429_101068907
771 Ga0075429_101656461
772 Ga0075436_100018481
773 Ga0075436_100032736
774 Ga0075436_100058504
775 Ga0075436_100063967
776 Ga0097620_100066635
777 Ga0097620_100190643
778 Ga0097620_100733011
779 Ga0097620_101015765
780 Ga0097620_101373181
781 Ga0097620_102123633
782 Ga0075435_100006158
783 Ga0075435_100012828
784 Ga0075435_100068196
785 Ga0075435_100073923
786 Ga0075435_100085243
787 Ga0075435_100140666
788 Ga0075435_100573580
789 Ga0075435_100985006
790 Ga0099794_10676274
791 Ga0099795_10033498
792 Ga0105240_11309976
793 Ga0111539_10000289
794 Ga0111539_10091795
795 Ga0111539_10094606
796 Ga0111539_10157256
797 Ga0111539_10181968
798 Ga0105245_10683316
799 Ga0105245_11057482
800 Ga0114129_10008559
801 Ga0114129_10015451
802 Ga0114129_10019399
803 Ga0114129_10053574
804 Ga0114129_10103188
805 Ga0114129_10244174
806 Ga0114129_10385536
807 Ga0114129_10482110
808 Ga0114129_11640702
809 Ga0105243_11277479
810 Ga0105241_10320261
811 Ga0105241_10543913
812 Ga0105241_11279138
813 Ga0105242_10139649
814 Ga0105242_11132107
815 Ga0105242_13110561
816 Ga0105248_10483367
817 Ga0105248_10843116
818 Ga0105238_10000066
819 Ga0105249_10361424
820 Ga0105249_10501502
821 Ga0105249_11328170
822 Ga0105249_12012722
823 Ga0105246_10768592
824 Ga0105246_11228180
825 Ga0105246_11480482
826 Ga0157373_10101298
827 Ga0157370_10752153
828 Ga0163162_10339033
829 Ga0157372_10506211
830 Ga0157375_10174952
831 Ga0157375_10695019
832 Ga0163163_10329974
833 Ga0163163_12642519
834 Ga0157380_10116303
835 Ga0157380_10401788
836 Ga0157380_11358757
837 Ga0157380_13163641
838 Ga0157377_10486802
839 Ga0157379_10397097
840 Ga0157379_10425789
841 Ga0157376_10155730
842 Ga0157376_10989895
843 Ga0163161_10276173
844 Ga0213876_10121165
845 Ga0207697_10416345
846 Ga0207682_10210035
847 Ga0207682_10524741
848 Ga0207692_10220311
849 Ga0207692_10406560
850 Ga0207680_10026783
851 Ga0207699_10013947
852 Ga0207699_10016193
853 Ga0207645_10060138
854 Ga0207645_10122914
855 Ga0207705_10044668
856 Ga0207684_10565958
857 Ga0207707_10019823
858 Ga0207693_10007169
859 Ga0207663_10287729
860 Ga0207660_10152959
861 Ga0207657_10073899
862 Ga0207649_11362163
863 Ga0207652_10039324
864 Ga0207652_10087244
865 Ga0207646_10194337
866 Ga0207681_10592195
867 Ga0207681_11193850
868 Ga0207694_10000007
869 Ga0207650_10018513
870 Ga0207650_10158298
871 Ga0207650_10236696
872 Ga0207659_10250973
873 Ga0207687_10821668
874 Ga0207644_10112156
875 Ga0207644_10186008
876 Ga0207690_10147997
877 Ga0207690_10190313
878 Ga0207706_10021702
879 Ga0207670_10461508
880 Ga0207670_10908197
881 Ga0207670_10984822
882 Ga0207704_10083423
883 Ga0207665_10160097
884 Ga0207691_10340077
885 Ga0207691_10464561
886 Ga0207711_10163151
887 Ga0207711_10213374
888 Ga0207711_10459490
889 Ga0207689_10195603
890 Ga0207689_10232189
891 Ga0207689_10469695
892 Ga0207689_10884117
893 Ga0207679_10373097
894 Ga0207651_10359267
895 Ga0207651_10604717
896 Ga0207651_10976842
897 Ga0207651_11570242
898 Ga0207651_11682509
899 Ga0207658_10067592
900 Ga0207658_10311219
901 Ga0207677_10851051
902 Ga0207677_11511591
903 Ga0207703_10246427
904 Ga0207703_10699466
905 Ga0207639_11362792
906 Ga0207678_10214141
907 Ga0207678_11243082
908 Ga0207708_10934418
909 Ga0207702_10349012
910 Ga0207641_10646783
911 Ga0207641_11307721
912 Ga0207641_11699425
913 Ga0207648_10227534
914 Ga0207648_10617628
915 Ga0207648_10817155
916 Ga0207676_10763534
917 Ga0207676_11532684
918 Ga0207676_11953865
919 Ga0207674_11367415
920 Ga0207675_100113125
921 Ga0207675_100293381
922 Ga0207675_101620655
923 Ga0207675_101639635
924 Ga0207683_10176342
925 Ga0207683_11421401
926 Ga0207683_11599595
927 Ga0207698_10499097
928 Ga0209969_1011145
929 Ga0207428_10009568
930 Ga0207428_10071520
931 Ga0207428_10099163
932 Ga0268265_10269420
933 Ga0265320_10055838
934 Ga0265331_10178744
935 Ga0307408_100075461
936 Ga0307408_100201497
937 Ga0307408_100415151
938 Ga0307408_100742463
939 Ga0307408_101042876
940 Ga0307408_102341440
941 Ga0307405_10256232
942 Ga0307405_10376225
943 Ga0307405_10427363
944 Ga0307405_10799337
945 Ga0307413_11665635
946 Ga0307410_10021457
947 Ga0307406_10118101
948 Ga0307406_10328705
949 Ga0307406_10989379
950 Ga0307407_10541108
951 Ga0307407_10734377
952 Ga0307407_11150157
953 Ga0307412_10301618
954 Ga0307412_10356080
955 Ga0307412_10454370
956 Ga0307412_10555079
957 Ga0307412_10565911
958 Ga0307409_100336133
959 Ga0307409_100417899
960 Ga0307409_101500273
961 Ga0307409_102432565
962 Ga0307416_100013324
963 Ga0307416_100048136
964 Ga0307416_100651146
965 Ga0307416_100860816
966 Ga0307416_101391006
967 Ga0307416_101524316
968 Ga0307414_10336842
969 Ga0307414_11107507
970 Ga0307411_10119937
971 Ga0307411_10351285
972 Ga0307411_10470278
973 Ga0307411_11402308
974 Ga0307411_11697808
975 Ga0307415_100071591
976 Ga0307415_100414626
977 Ga0307415_100805941
978 Ga0307415_101784258
979 Ga0307415_102109249
980 Ga0373959_0071256
981 Ga0373938_0147587
982 Ga0373926_0000574
983 Ga0373929_0010287
984 Ga0373929_0069655
985 Ga0373949_0042949
986 Ga0373949_0086868
987 Ga0373923_0070278
988 Ga0373932_0184151
989 Ga0373939_0065219
990 Ga0373939_0110493
991 Ga0373941_0042279
992 Ga0373945_0005516
993 Ga0373953_0561128
994 Ga0373954_0013281
995 Ga0373956_0000268
996 Ga0373957_0123761
997 Ga0373943_0002132
998 Ga0373946_0004700
999 Ga0373955_0001383
1000 Ga0373931_0436440
1001 Ga0373935_0000219
1002 Ga0373935_0526254
1003 Ga0373927_0007443
1004 Ga0373933_0000048
1005 Ga0373947_0000570
1006 Ga0373937_0000043
1007 Ga0373937_0302001
1008 Ga0373925_0000764
1009 Ga0373925_1388682
1010 Ga0395905_0717102
1011 Ga0242420_021595
1012 Ga0242420_035846
1013 Ga0436365_0072455
1014 Ga0436365_0272919
1015 Ga0436363_0063738
1016 Ga0436363_1365828
1017 Ga0436362_0449576
1018 Ga0439441_004746
1019 Ga0439441_081118
1020 Ga0439443_101299
1021 Ga0439450_004088
1022 Ga0451577_1097023
1023 Ga0466969_0273178
1024 Ga0453683_0029491
1025 Ga0466966_0397929
1026 Ga0466966_0457946
1027 Ga0466963_0006897
1028 Ga0466971_0633885
1029 Ga0466968_0318478
1030 Ga0466968_0721826
1031 Ga0466957_0140960
1032 Ga0466959_0180547
1033 Ga0466959_0354168
1034 Ga0451576_0027257
1035 Ga0451576_1135872
1036 Ga0466958_0030094
1037 Ga0466967_0014628
1038 Ga0466967_0649870
1039 Ga0495592_0011717
1040 Ga0495592_0233661
1041 Ga0495603_0000562
1042 Ga0495603_0141608
1043 Ga0495629_0049607
1044 Ga0495651_0000222
1045 Ga0495653_0000050
1046 Ga0495580_0002017
1047 Ga0495580_0688579
1048 Ga0495582_0001715
1049 Ga0495639_0000508
1050 Ga0495594_0156617
1051 Ga0495608_0000073
1052 Ga0495618_0238615
1053 Ga0495618_0702846
1054 Ga0495628_0000157
1055 Ga0495628_0226276
1056 Ga0495630_0001130
1057 Ga0495630_0001940
1058 Ga0495666_0164554
1059 Ga0495665_0000137
1060 Ga0495586_0741202
1061 Ga0495587_0003874
1062 Ga0495598_0072239
1063 Ga0495645_0000299
1064 Ga0495645_0123394
1065 Ga0495667_0000191
1066 Ga0495634_0056242
1067 Ga0495635_0000066
1068 Ga0495659_0523288
1069 Ga0495588_0000380
1070 Ga0495588_0383562
1071 Ga0495657_0000053
1072 Ga0495599_0000403
1073 Ga0495623_0000098
1074 Ga0495646_0008378
1075 Ga0495658_0000248
1076 Ga0495613_0020256
1077 Ga0495613_0085508
1078 Ga0495600_0000032
1079 Ga0495581_0000687
1080 Ga0495604_0000051
1081 Ga0495674_0001207
1082 Ga0495674_0896551
1083 Ga0495676_0541629
1084 Ga0495680_0002218
1085 Ga0495675_0048559
1086 Ga0495684_0000062
1087 Ga0495593_0000178
1088 Ga0495593_0244196
1089 Ga0495602_0000245
1090 Ga0495614_0000297
1091 Ga0496102_0059330
1092 Ga0496103_0058762
1093 Ga0496112_0010719
1094 Ga0501036_0102572
1095 Ga0501037_0103668
1096 Ga0501041_0056605
1097 Ga0501042_0050106
1098 Ga0501046_0125936
1099 Ga0501071_0139115
1100 Ga0501072_0015157
1101 Ga0501072_0471432
1102 Ga0501075_0054414
1103 Ga0501075_0201704
1104 Ga0501075_0370697
1105 Ga0501076_0168781
1106 Ga0501076_0673910
1107 Ga0501077_0029622
1108 Ga0501079_0019567
1109 Ga0501083_0063176
1110 Ga0501273_047287
1111 Ga0501045_0020641
1112 nmdc:mga0yw44_25569_c1
1113 nmdc:mga05p37_150234_c1
1114 nmdc:mga05p37_17162_c1
1115 nmdc:mga05p37_199794_c1
1116 nmdc:mga05p37_2243329_c1
1117 nmdc:mga05p37_42547_c1
1118 nmdc:mga05p37_432979_c2
1119 nmdc:mga05p37_57502_c1
1120 nmdc:mga05p37_694476_c1
1121 nmdc:mga05p37_69913_c1
1122 nmdc:mga05p37_8520_c1
1123 nmdc:mga09592_166053_c1
1124 nmdc:mga09592_549016_c1
1125 nmdc:mga0qj67_191446_c1
1126 nmdc:mga06r32_132498_c1
1127 nmdc:mga06r32_37005_c1
1128 nmdc:mga06r32_45858_c1
1129 nmdc:mga08y16_1406_c1
1130 nmdc:mga08y16_146131_c1
1131 nmdc:mga08y16_171780_c1
1132 nmdc:mga08y16_270823_c1
1133 nmdc:mga08y16_594593_c1
1134 nmdc:mga08y16_626050_c1
1135 nmdc:mga08y16_82196_c1
1136 nmdc:mga0n895_1016407_c1
1137 nmdc:mga0n895_1130352_c1
1138 nmdc:mga0n895_116428_c1
1139 nmdc:mga0n895_208210_c1
1140 nmdc:mga0n895_2196689_c1
1141 nmdc:mga0n895_23749_c1
1142 nmdc:mga0n895_313249_c1
1143 nmdc:mga0n895_391741_c1
1144 nmdc:mga0n895_49290_c1
1145 nmdc:mga0n895_80740_c1
1146 nmdc:mga0n895_999939_c1
1147 nmdc:mga0rr50_116227_c1
1148 nmdc:mga0rr50_31773_c1
1149 nmdc:mga0rr50_324543_c1
1150 nmdc:mga0rr50_540646_c1
1151 nmdc:mga0rr50_89181_c1
1152 nmdc:mga08x19_121457_c1
1153 nmdc:mga08x19_154228_c1
1154 nmdc:mga08x19_20169_c1
1155 nmdc:mga08x19_590571_c1
1156 nmdc:mga08x19_78425_c1
1157 nmdc:mga0a205_1002555_c1
1158 nmdc:mga0a205_20548_c1
1159 nmdc:mga0a205_54297_c1
1160 nmdc:mga0a205_6045_c1
1161 nmdc:mga0a205_74627_c1
1162 Ga0495601_0517046
1163 Ga0495595_0063382
1164 Ga0495619_0001025
1165 Ga0495619_0349343
1166 Ga0500628_011339
1167 Ga0501082_0063007
1168 Ga0466962_0213118
1169 Ga0530510_0006096
1170 Ga0530510_0140416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

23

138

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9566 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9178 1 114
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7857 1 118
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7618 1 118
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7487 1 118
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9566 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9178 1 114 3.30.70.1060
af_K7KP68_1_116_3.90.1460.10 Alpha Beta;Alpha-Beta Complex;GTF2I-like repeat;GTF2I-like 0.8379 9 41 3.90.1460.10
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8191 1 118 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7884 1 118 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A090F2B7-F1-model_v4 YCII-related protein 0.9952 1 114
AF-A0A841PAK0-F1-model_v4 YCII-related domain-containing protein 0.9944 1 114
AF-A0A0Q8K7F7-F1-model_v4 YCII-related domain-containing protein 0.9934 1 114
AF-A0A401ZSA9-F1-model_v4 YCII-related domain-containing protein 0.9933 1 116
AF-X5X3Z5-F1-model_v4 DGPFAETKE family protein 0.9929 1 114

Map