F466365

General Info

Members Datasets Scaffolds Average Seq Length
584 382 542 282

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1001498|Ga0182006_10014985
Length 309
Sequence MRRRCLHERAGWRQENAMLLLSALISGFGLGSMYGLMALGFYMTYAVSGTVNFAQGSSMMLGAVLCFTFAQTLGWPMWLAIVLALAACALYGMLVEVLAVRPFARQGSNAWLMSTVALGIVLDNLVMHTFGKEPRSLPSPLALSSIELGGMGLGVYPLHLLIPAIGLALAALLHTISRRTRWGTALLAVVQNRDAARLMGIPITRAIAVAFALSTLLAGVAGVLIAPLFNVNADMGTLFGLKAFAVAILGGITSAWGVMIAGLLFGMAEALITATLGSGYTQIITFALVIVVLAIRPNGLFGRAQVKKV

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
7 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
8 2643221569 Achromobacter sp. Root565 Isolate Unclassified
9 2643221594 Achromobacter sp. Root170 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
12 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
13 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
14 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
15 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
16 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
17 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
18 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
19 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
20 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
21 2855730933 Achromobacter sp. HZ28 Isolate Nodule
22 2855767633 Achromobacter sp. HZ34 Isolate Nodule
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
25 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
26 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
27 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
28 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
29 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
30 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
31 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
32 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
33 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
34 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
35 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
36 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
37 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
38 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
39 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
40 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
226 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
267 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
268 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
273 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
274 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
275 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
375 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
376 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
382 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 0.34
Isolates 7.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 1.37
Rhizoplane 2.91
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002159 3300003187 Bacteria 12187
2 JGI25151J46595_10002298 3300003187 Bacteria 11678
3 JGI25151J46595_10013441 3300003187 Bacteria 3683
4 JGI25151J46595_10049929 3300003187 Bacteria 1430
5 JGI25406J46586_10047422 3300003203 Bacteria 1464
6 rootL2_10157044 3300003322 Bacteria 2369
7 Ga0055538_1000141 3300003751 Bacteria 50563
8 Ga0055539_1000192 3300003752 Bacteria 50563
9 Ga0055533_1000192 3300003756 Bacteria 50563
10 Ga0055525_1000260 3300003759 Bacteria 50563
11 Ga0055526_1023825 3300003771 Bacteria 2028
12 Ga0055537_1000780 3300003773 Bacteria 16027
13 Ga0055524_1001799 3300003775 Bacteria 11752
14 Ga0055524_1008162 3300003775 Bacteria 4375
15 Ga0055536_1000677 3300003781 Bacteria 22946
16 Ga0055534_1000394 3300003784 Bacteria 27123
17 Ga0055534_1000985 3300003784 Bacteria 12573
18 Ga0055541_1000127 3300003841 Bacteria 50563
19 Ga0070658_10099862 3300005327 Bacteria 2398
20 Ga0070683_100059947 3300005329 Bacteria 3536
21 Ga0070683_100071598 3300005329 Bacteria 3235
22 Ga0070690_100001504 3300005330 Bacteria 12202
23 Ga0070690_100064341 3300005330 Bacteria 2369
24 Ga0070670_100071860 3300005331 Bacteria 2971
25 Ga0070670_100098452 3300005331 Bacteria 2516
26 Ga0070670_100166975 3300005331 Bacteria 1909
27 Ga0068869_100001561 3300005334 Bacteria 13604
28 Ga0068869_100070709 3300005334 Bacteria 2583
29 Ga0068869_100133284 3300005334 Bacteria 1912
30 Ga0068869_100515595 3300005334 Bacteria 1000
31 Ga0070680_100001721 3300005336 Bacteria 16063
32 Ga0070680_100082831 3300005336 Bacteria 2649
33 Ga0070682_100005629 3300005337 Bacteria 6984
34 Ga0070682_100079571 3300005337 Bacteria 2117
35 Ga0068868_100001141 3300005338 Bacteria 18157
36 Ga0070660_100045969 3300005339 Bacteria 3345
37 Ga0070660_100098691 3300005339 Bacteria 2312
38 Ga0070660_100174956 3300005339 Bacteria 1735
39 Ga0070691_10000844 3300005341 Bacteria 12377
40 Ga0070687_100000316 3300005343 Bacteria 16392
41 Ga0070661_100105142 3300005344 Bacteria 2104
42 Ga0070692_10003111 3300005345 Bacteria 6649
43 Ga0070692_10118551 3300005345 Bacteria 1473
44 Ga0070675_100059881 3300005354 Bacteria 3143
45 Ga0070675_100266311 3300005354 Bacteria 1503
46 Ga0070671_100092729 3300005355 Bacteria 2531
47 Ga0070673_100136273 3300005364 Bacteria 2067
48 Ga0070673_100400962 3300005364 Bacteria 1227
49 Ga0070659_100005229 3300005366 Bacteria 9312
50 Ga0070659_100093847 3300005366 Bacteria 2409
51 Ga0070703_10007083 3300005406 Bacteria 3145
52 Ga0070703_10031739 3300005406 Bacteria 1600
53 Ga0070714_100185199 3300005435 Bacteria 1897
54 Ga0070713_100028911 3300005436 Bacteria 4381
55 Ga0070701_10006445 3300005438 Bacteria 4940
56 Ga0070705_100001322 3300005440 Bacteria 13267
57 Ga0070700_100044814 3300005441 Bacteria 2726
58 Ga0070700_100338278 3300005441 Bacteria 1112
59 Ga0070694_100000228 3300005444 Bacteria 29562
60 Ga0070708_100258455 3300005445 Bacteria 1637
61 Ga0070663_100062582 3300005455 Bacteria 2683
62 Ga0070681_10002377 3300005458 Bacteria 17189
63 Ga0070681_10002557 3300005458 Bacteria 16703
64 Ga0068867_100004278 3300005459 Bacteria 10046
65 Ga0068867_100092301 3300005459 Bacteria 2299
66 Ga0070707_100127737 3300005468 Bacteria 2470
67 Ga0070699_100000829 3300005518 Bacteria 28653
68 Ga0070699_100233520 3300005518 Bacteria 1640
69 Ga0070679_100015857 3300005530 Bacteria 7252
70 Ga0070684_100003238 3300005535 Bacteria 12177
71 Ga0070697_100016288 3300005536 Bacteria 5846
72 Ga0070697_100203198 3300005536 Bacteria 1684
73 Ga0068853_100028827 3300005539 Bacteria 4672
74 Ga0070686_100001157 3300005544 Bacteria 15083
75 Ga0070686_100004065 3300005544 Bacteria 8045
76 Ga0070695_100000946 3300005545 Bacteria 15751
77 Ga0070695_100011344 3300005545 Bacteria 5331
78 Ga0070695_100108288 3300005545 Bacteria 1881
79 Ga0070695_100309597 3300005545 Bacteria 1170
80 Ga0070696_100001500 3300005546 Bacteria 15319
81 Ga0070696_100002309 3300005546 Bacteria 12582
82 Ga0070696_100063729 3300005546 Bacteria 2582
83 Ga0070693_100000451 3300005547 Bacteria 18498
84 Ga0070693_100143976 3300005547 Bacteria 1503
85 Ga0070704_100001349 3300005549 Bacteria 13010
86 Ga0070704_100426466 3300005549 Bacteria 1137
87 Ga0068855_100003762 3300005563 Bacteria 18547
88 Ga0068855_100007207 3300005563 Bacteria 13495
89 Ga0068855_100047077 3300005563 Bacteria 5096
90 Ga0068855_100244551 3300005563 Bacteria 2003
91 Ga0068855_100619389 3300005563 Bacteria 1165
92 Ga0070664_100041171 3300005564 Bacteria 3897
93 Ga0068857_100113906 3300005577 Bacteria 2432
94 Ga0068857_100299946 3300005577 Bacteria 1481
95 Ga0068854_100008150 3300005578 Bacteria 6720
96 Ga0068854_100013003 3300005578 Bacteria 5455
97 Ga0068856_100006230 3300005614 Bacteria 11706
98 Ga0068856_100068929 3300005614 Bacteria 3497
99 Ga0068856_100110677 3300005614 Bacteria 2743
100 Ga0070702_100000148 3300005615 Bacteria 21963
101 Ga0070702_100008100 3300005615 Bacteria 5076
102 Ga0068852_100023753 3300005616 Bacteria 4942
103 Ga0068852_100063710 3300005616 Bacteria 3211
104 Ga0068859_100002466 3300005617 Bacteria 18828
105 Ga0068859_100034852 3300005617 Bacteria 5050
106 Ga0068866_10000302 3300005718 Bacteria 23469
107 Ga0068861_100002875 3300005719 Bacteria 11344
108 Ga0068851_10018633 3300005834 Bacteria 3346
109 Ga0068863_100326532 3300005841 Bacteria 1491
110 Ga0068858_100004157 3300005842 Bacteria 14242
111 Ga0068860_100008220 3300005843 Bacteria 10386
112 Ga0068862_100004540 3300005844 Bacteria 11702
113 Ga0068862_100005219 3300005844 Bacteria 10912
114 Ga0068862_100270969 3300005844 Bacteria 1552
115 Ga0081539_10003560 3300005985 Bacteria 18916
116 Ga0075364_10131018 3300006051 Bacteria 1683
117 Ga0070716_100049998 3300006173 Bacteria 2371
118 Ga0070712_100022470 3300006175 Bacteria 4156
119 Ga0070712_100273914 3300006175 Bacteria 1357
120 Ga0097621_100003364 3300006237 Bacteria 11005
121 Ga0097621_100004313 3300006237 Bacteria 9881
122 Ga0068871_100001348 3300006358 Bacteria 16432
123 Ga0068871_100008335 3300006358 Bacteria 7451
124 Ga0075428_100001160 3300006844 Bacteria 28222
125 Ga0075428_100049725 3300006844 Bacteria 4600
126 Ga0075428_100213419 3300006844 Bacteria 2085
127 Ga0075430_100021532 3300006846 Bacteria 5479
128 Ga0075430_100125335 3300006846 Bacteria 2141
129 Ga0075431_100003002 3300006847 Bacteria 16325
130 Ga0075431_100434518 3300006847 Bacteria 1310
131 Ga0075433_10078004 3300006852 Bacteria 2919
132 Ga0075433_10223715 3300006852 Bacteria 1671
133 Ga0075434_100005264 3300006871 Bacteria 11759
134 Ga0075434_100229925 3300006871 Bacteria 1874
135 Ga0075429_100000076 3300006880 Bacteria 49832
136 Ga0075429_100000107 3300006880 Bacteria 47068
137 Ga0068865_100001770 3300006881 Bacteria 12679
138 Ga0075436_100003398 3300006914 Bacteria 10909
139 Ga0097620_100002466 3300006931 Bacteria 18828
140 Ga0097620_100034852 3300006931 Bacteria 5050
141 Ga0079104_1016099 3300006946 Bacteria 2196
142 Ga0099826_10000113 3300006948 Bacteria 36930
143 Ga0075435_100324503 3300007076 Bacteria 1318
144 Ga0099794_10012552 3300007265 Bacteria 3660
145 Ga0105251_10057914 3300009011 Bacteria 1830
146 Ga0105240_10002050 3300009093 Bacteria 33144
147 Ga0105240_10006656 3300009093 Bacteria 16948
148 Ga0105240_10017559 3300009093 Bacteria 9640
149 Ga0105240_10030486 3300009093 Bacteria 7010
150 Ga0111539_10018489 3300009094 Bacteria 8632
151 Ga0111539_10059054 3300009094 Bacteria 4550
152 Ga0111539_10070243 3300009094 Bacteria 4134
153 Ga0111539_10399916 3300009094 Bacteria 1600
154 Ga0105245_10001017 3300009098 Bacteria 25471
155 Ga0105247_10017168 3300009101 Bacteria 4344
156 Ga0114129_10000791 3300009147 Bacteria 40561
157 Ga0114129_10023386 3300009147 Bacteria 8762
158 Ga0105243_10002797 3300009148 Bacteria 14482
159 Ga0105243_10002935 3300009148 Bacteria 14105
160 Ga0105243_10229159 3300009148 Bacteria 1647
161 Ga0105241_10050931 3300009174 Bacteria 3157
162 Ga0105241_10149270 3300009174 Bacteria 1911
163 Ga0105242_10001715 3300009176 Bacteria 17307
164 Ga0105248_10139969 3300009177 Bacteria 2730
165 Ga0105248_10245441 3300009177 Bacteria 2016
166 Ga0105237_10021166 3300009545 Bacteria 6689
167 Ga0105237_10581476 3300009545 Bacteria 1127
168 Ga0105238_10000006 3300009551 Bacteria 346249
169 Ga0105238_10019514 3300009551 Bacteria 6904
170 Ga0105238_10189172 3300009551 Bacteria 2035
171 Ga0105249_10004241 3300009553 Bacteria 12400
172 Ga0105239_10002999 3300010375 Bacteria 21046
173 Ga0105246_10180676 3300011119 Bacteria 1624
174 Ga0157370_10167458 3300013104 Bacteria 2043
175 Ga0157370_10555118 3300013104 Bacteria 1053
176 Ga0157369_10002831 3300013105 Bacteria 20703
177 Ga0157369_10123443 3300013105 Bacteria 2747
178 Ga0157378_10003629 3300013297 Bacteria 13658
179 Ga0163162_10165328 3300013306 Bacteria 2336
180 Ga0157372_10042798 3300013307 Bacteria 5011
181 Ga0157372_10385642 3300013307 Bacteria 1633
182 Ga0163163_10114033 3300014325 Bacteria 2733
183 Ga0157380_10478944 3300014326 Bacteria 1203
184 Ga0182008_10024181 3300014497 Bacteria 3095
185 Ga0157379_10290581 3300014968 Bacteria 1489
186 Ga0157376_10001701 3300014969 Bacteria 14639
187 Ga0157376_10032509 3300014969 Bacteria 4190
188 Ga0182006_1001498 3300015261 Bacteria 14002
189 Ga0206353_10776176 3300020082 Bacteria 2166
190 Ga0213872_10018675 3300021361 Bacteria 3195
191 Ga0209784_100009 3300025224 Bacteria 688031
192 Ga0209566_100007 3300025225 Bacteria 688031
193 Ga0209674_100018 3300025226 Bacteria 688031
194 Ga0209563_100020 3300025230 Bacteria 688031
195 Ga0209437_100117 3300025233 Bacteria 209271
196 Ga0209677_100010 3300025253 Bacteria 688031
197 Ga0209565_1000426 3300025263 Bacteria 34052
198 Ga0209130_1009566 3300025284 Bacteria 2747
199 Ga0209130_1012022 3300025284 Bacteria 2287
200 Ga0209675_1000174 3300025291 Bacteria 74594
201 Ga0209675_1000426 3300025291 Bacteria 34022
202 Ga0209676_1001413 3300025292 Bacteria 22998
203 Ga0209676_1003226 3300025292 Bacteria 10303
204 Ga0209025_1000019 3300025294 Bacteria 631548
205 Ga0209025_1001481 3300025294 Bacteria 30488
206 Ga0209025_1001800 3300025294 Bacteria 25408
207 Ga0209025_1002021 3300025294 Bacteria 23150
208 Ga0209564_1000145 3300025295 Bacteria 175251
209 Ga0209564_1001261 3300025295 Bacteria 27868
210 Ga0209564_1004730 3300025295 Bacteria 8150
211 Ga0209758_1015363 3300025297 Bacteria 3972
212 Ga0209050_1004102 3300025298 Bacteria 10172
213 Ga0209050_1026989 3300025298 Bacteria 1906
214 Ga0209256_1000492 3300025299 Bacteria 58194
215 Ga0209256_1003493 3300025299 Bacteria 10955
216 Ga0209051_1004307 3300025303 Bacteria 8838
217 Ga0209051_1024873 3300025303 Bacteria 2452
218 Ga0209257_1011872 3300025304 Bacteria 4119
219 Ga0207656_10085700 3300025321 Bacteria 1423
220 Ga0207653_10010080 3300025885 Bacteria 2947
221 Ga0207653_10071177 3300025885 Bacteria 1189
222 Ga0207642_10001745 3300025899 Bacteria 6709
223 Ga0207688_10019224 3300025901 Bacteria 3719
224 Ga0207688_10161244 3300025901 Bacteria 1330
225 Ga0207699_10139104 3300025906 Bacteria 1594
226 Ga0207645_10040099 3300025907 Bacteria 2999
227 Ga0207645_10103419 3300025907 Bacteria 1839
228 Ga0207643_10031169 3300025908 Bacteria 2971
229 Ga0207643_10047240 3300025908 Bacteria 2435
230 Ga0207705_10042785 3300025909 Bacteria 3252
231 Ga0207684_10048246 3300025910 Bacteria 3611
232 Ga0207654_10070263 3300025911 Bacteria 2078
233 Ga0207707_10034183 3300025912 Bacteria 4448
234 Ga0207707_10054809 3300025912 Bacteria 3470
235 Ga0207695_10002139 3300025913 Bacteria 29918
236 Ga0207695_10004925 3300025913 Bacteria 17994
237 Ga0207695_10168650 3300025913 Bacteria 2116
238 Ga0207671_10009496 3300025914 Bacteria 8125
239 Ga0207693_10006637 3300025915 Bacteria 9561
240 Ga0207693_10014590 3300025915 Bacteria 6314
241 Ga0207660_10021266 3300025917 Bacteria 4362
242 Ga0207660_10173286 3300025917 Bacteria 1671
243 Ga0207662_10000479 3300025918 Bacteria 17918
244 Ga0207657_10000160 3300025919 Bacteria 69252
245 Ga0207657_10022419 3300025919 Bacteria 5908
246 Ga0207657_10057520 3300025919 Bacteria 3351
247 Ga0207657_10087235 3300025919 Bacteria 2611
248 Ga0207649_10009821 3300025920 Bacteria 5244
249 Ga0207652_10113919 3300025921 Bacteria 2400
250 Ga0207652_10320551 3300025921 Bacteria 1399
251 Ga0207646_10203529 3300025922 Bacteria 1788
252 Ga0207681_10001355 3300025923 Bacteria 15822
253 Ga0207694_10000110 3300025924 Bacteria 85854
254 Ga0207694_10022358 3300025924 Bacteria 4796
255 Ga0207650_10136566 3300025925 Bacteria 1924
256 Ga0207650_10499486 3300025925 Bacteria 1016
257 Ga0207659_10133119 3300025926 Bacteria 1922
258 Ga0207687_10001010 3300025927 Bacteria 19091
259 Ga0207687_10153040 3300025927 Bacteria 1762
260 Ga0207664_10040242 3300025929 Bacteria 3633
261 Ga0207664_10096151 3300025929 Bacteria 2438
262 Ga0207686_10002110 3300025934 Bacteria 10953
263 Ga0207709_10000532 3300025935 Bacteria 32789
264 Ga0207709_10013646 3300025935 Bacteria 4482
265 Ga0207670_10034477 3300025936 Bacteria 3271
266 Ga0207704_10003136 3300025938 Bacteria 7477
267 Ga0207704_10024596 3300025938 Bacteria 3270
268 Ga0207665_10015991 3300025939 Bacteria 4927
269 Ga0207691_10268888 3300025940 Bacteria 1468
270 Ga0207711_10263704 3300025941 Bacteria 1584
271 Ga0207689_10001100 3300025942 Bacteria 26064
272 Ga0207689_10009573 3300025942 Bacteria 8356
273 Ga0207661_10040466 3300025944 Bacteria 3664
274 Ga0207679_10132301 3300025945 Bacteria 2003
275 Ga0207679_10294947 3300025945 Bacteria 1395
276 Ga0207667_10001999 3300025949 Bacteria 25585
277 Ga0207667_10006563 3300025949 Bacteria 14075
278 Ga0207667_10011796 3300025949 Bacteria 10124
279 Ga0207667_10016670 3300025949 Bacteria 8292
280 Ga0207667_10205159 3300025949 Bacteria 2021
281 Ga0207651_10069988 3300025960 Bacteria 2480
282 Ga0207712_10006700 3300025961 Bacteria 7261
283 Ga0207668_10038805 3300025972 Bacteria 3200
284 Ga0207640_10013112 3300025981 Bacteria 4742
285 Ga0207640_10088830 3300025981 Bacteria 2135
286 Ga0207640_10418639 3300025981 Bacteria 1096
287 Ga0207677_10002179 3300026023 Bacteria 10295
288 Ga0207703_10018088 3300026035 Bacteria 5504
289 Ga0207639_10015120 3300026041 Bacteria 5438
290 Ga0207639_10246441 3300026041 Bacteria 1556
291 Ga0207678_10000797 3300026067 Bacteria 28895
292 Ga0207708_10001959 3300026075 Bacteria 15185
293 Ga0207702_10023862 3300026078 Bacteria 5074
294 Ga0207702_10073673 3300026078 Bacteria 2945
295 Ga0207702_10112572 3300026078 Bacteria 2422
296 Ga0207702_10165389 3300026078 Bacteria 2023
297 Ga0207648_10001964 3300026089 Bacteria 22482
298 Ga0207648_10012950 3300026089 Bacteria 7790
299 Ga0207676_10097972 3300026095 Bacteria 2423
300 Ga0207674_10000236 3300026116 Bacteria 68955
301 Ga0207674_10235166 3300026116 Bacteria 1780
302 Ga0207675_100000089 3300026118 Bacteria 71258
303 Ga0207675_100020378 3300026118 Bacteria 6181
304 Ga0207698_10026389 3300026142 Bacteria 4109
305 Ga0207698_10049484 3300026142 Bacteria 3199
306 Ga0207698_10054538 3300026142 Bacteria 3076
307 Ga0209970_1000507 3300027614 Bacteria 6685
308 Ga0209970_1008636 3300027614 Bacteria 1669
309 Ga0209282_1000165 3300027666 Bacteria 37517
310 Ga0209588_1032236 3300027671 Bacteria 1678
311 Ga0209971_1011152 3300027682 Bacteria 2129
312 Ga0209966_1005180 3300027695 Bacteria 2231
313 Ga0209974_10019543 3300027876 Bacteria 2246
314 Ga0207428_10001985 3300027907 Bacteria 20758
315 Ga0207428_10198484 3300027907 Bacteria 1510
316 Ga0268265_10002203 3300028380 Bacteria 15024
317 Ga0268265_10008737 3300028380 Bacteria 6848
318 Ga0268265_10280955 3300028380 Bacteria 1489
319 Ga0268264_10003987 3300028381 Bacteria 12640
320 Ga0307515_10095051 3300028794 Bacteria 3673
321 Ga0265760_10014928 3300031090 Bacteria 2227
322 Ga0265316_10083565 3300031344 Bacteria 2446
323 Ga0307513_10117289 3300031456 Bacteria 2640
324 Ga0307408_100119558 3300031548 Bacteria 2039
325 Ga0307405_10279474 3300031731 Bacteria 1256
326 Ga0307412_10000106 3300031911 Bacteria 67067
327 Ga0307416_100063467 3300032002 Bacteria 3025
328 Ga0307416_100221734 3300032002 Bacteria 1814
329 Ga0307416_100534844 3300032002 Bacteria 1243
330 Ga0307411_10090119 3300032005 Bacteria 2138
331 Ga0307510_10037495 3300033180 Bacteria 5377
332 Ga0373950_0015194 3300034818 Bacteria 1303
333 Ga0373958_0018831 3300034819 Bacteria 1255
334 Ga0373959_0028411 3300034820 Bacteria 1116
335 Ga0373926_0009660 3300035083 Bacteria 3222
336 Ga0373928_0007841 3300035084 Bacteria 2066
337 Ga0373940_0083521 3300035088 Bacteria 948
338 Ga0373952_0019730 3300035092 Bacteria 1407
339 Ga0373941_0008916 3300035115 Bacteria 2512
340 Ga0373941_0021741 3300035115 Bacteria 1814
341 Ga0373955_0006817 3300035172 Bacteria 5218
342 Ga0373942_0051060 3300035207 Bacteria 1160
343 Ga0373962_0008807 3300035242 Bacteria 2491
344 Ga0373931_0002999 3300035691 Bacteria 7536
345 Ga0373931_0026064 3300035691 Bacteria 2972
346 Ga0373935_0050988 3300035692 Bacteria 2627
347 Ga0373927_0018551 3300035695 Bacteria 4569
348 Ga0373927_0082518 3300035695 Bacteria 2084
349 Ga0373947_0146659 3300035725 Bacteria 1517
350 Ga0373937_0068852 3300036401 Bacteria 3263
351 Ga0373925_0032753 3300037068 Bacteria 3826
352 Ga0373925_0306302 3300037068 Bacteria 1283
353 Ga0395899_0011466 3300037312 Bacteria 6786
354 Ga0395900_0055645 3300037418 Bacteria 4074
355 Ga0395898_0038222 3300037466 Bacteria 4758
356 Ga0395905_0094682 3300037471 Bacteria 2802
357 Ga0395901_0167378 3300038443 Bacteria 2307
358 Ga0436361_0168918 3300039447 Bacteria 13423
359 Ga0439441_001355 3300042001 Bacteria 3170
360 Ga0439445_0012060 3300042004 Bacteria 2070
361 Ga0439456_012441 3300042013 Bacteria 1764
362 Ga0439462_0002146 3300042015 Bacteria 4536
363 Ga0450911_000322 3300042115 Bacteria 17149
364 Ga0439446_0036701 3300042156 Bacteria 1433
365 Ga0439434_0073702 3300042435 Bacteria 1077
366 Ga0439435_0004976 3300042436 Bacteria 2895
367 Ga0439444_0000141 3300042437 Bacteria 6202
368 Ga0439460_0013205 3300042461 Bacteria 2157
369 Ga0466963_0394222 3300044694 Bacteria 976
370 Ga0451576_0143917 3300045051 Bacteria 2486
371 Ga0466967_0512990 3300045976 Bacteria 1177
372 Ga0495592_0271707 3300046454 Bacteria 1112
373 Ga0495603_0003735 3300046455 Bacteria 9052
374 Ga0495653_0383533 3300046463 Bacteria 897
375 Ga0495580_0014864 3300046472 Bacteria 5897
376 Ga0495605_0006316 3300046474 Bacteria 6830
377 Ga0495605_0038636 3300046474 Bacteria 2394
378 Ga0495639_0130280 3300046475 Bacteria 1204
379 Ga0495662_0046936 3300046476 Bacteria 2085
380 Ga0495584_0071056 3300046491 Bacteria 1749
381 Ga0495596_0000975 3300046500 Bacteria 17034
382 Ga0495607_0005726 3300046501 Bacteria 8847
383 Ga0495610_0001332 3300046512 Bacteria 21933
384 Ga0495616_0000889 3300046513 Bacteria 21607
385 Ga0495628_0034298 3300046516 Bacteria 4083
386 Ga0495628_0043678 3300046516 Bacteria 3568
387 Ga0495630_0002830 3300046517 Bacteria 12030
388 Ga0495666_0059438 3300046526 Bacteria 1828
389 Ga0495652_0259602 3300046529 Bacteria 1283
390 Ga0495654_0003050 3300046530 Bacteria 10432
391 Ga0495640_0170997 3300046533 Bacteria 1388
392 Ga0495640_0233408 3300046533 Bacteria 1156
393 Ga0495586_0004499 3300046535 Bacteria 7447
394 Ga0495609_0003775 3300046538 Bacteria 8536
395 Ga0495621_0034663 3300046539 Bacteria 1745
396 Ga0495634_0034394 3300046642 Bacteria 3478
397 Ga0495634_0091065 3300046642 Bacteria 1980
398 Ga0495634_0141893 3300046642 Bacteria 1525
399 Ga0495611_0060295 3300046648 Bacteria 1724
400 Ga0495625_0002799 3300046660 Bacteria 18380
401 Ga0495661_0014728 3300046665 Bacteria 5235
402 Ga0495588_0028228 3300046674 Bacteria 2807
403 Ga0495588_0091117 3300046674 Bacteria 1597
404 Ga0495646_0034925 3300046680 Bacteria 3120
405 Ga0495647_0000551 3300046681 Bacteria 11018
406 Ga0495647_0012356 3300046681 Bacteria 2939
407 Ga0495624_0007569 3300046690 Bacteria 7621
408 Ga0495671_0001016 3300046692 Bacteria 19531
409 Ga0495604_0104852 3300047317 Bacteria 2070
410 Ga0495636_0101516 3300047318 Bacteria 1258
411 Ga0495672_0015225 3300047320 Bacteria 5231
412 Ga0495676_0034950 3300047321 Bacteria 4210
413 Ga0495676_0067451 3300047321 Bacteria 2768
414 Ga0495680_0167183 3300047322 Bacteria 1594
415 Ga0495687_006653 3300047443 Bacteria 7023
416 Ga0495675_0228037 3300047444 Bacteria 1125
417 Ga0495686_0124868 3300047472 Bacteria 1531
418 Ga0496101_0144398 3300048904 Bacteria 1816
419 Ga0496102_0064195 3300048905 Bacteria 3363
420 Ga0496103_0048741 3300048906 Bacteria 2618
421 Ga0496104_0010260 3300048907 Bacteria 8366
422 Ga0496104_0165959 3300048907 Bacteria 2118
423 Ga0496106_0129859 3300048909 Bacteria 1975
424 Ga0496108_0079845 3300048911 Bacteria 2770
425 Ga0496108_0130915 3300048911 Bacteria 2156
426 Ga0496108_0407351 3300048911 Bacteria 1188
427 Ga0496109_0113606 3300048912 Bacteria 2519
428 Ga0496110_0072749 3300048913 Bacteria 3051
429 Ga0496110_0084010 3300048913 Bacteria 2841
430 Ga0496110_0087967 3300048913 Bacteria 2774
431 Ga0496112_0323176 3300048915 Bacteria 1487
432 Ga0496113_0039121 3300048916 Bacteria 3490
433 Ga0496114_0474586 3300048917 Bacteria 1107
434 Ga0496116_0009765 3300048919 Bacteria 8142
435 Ga0496116_0015566 3300048919 Bacteria 6007
436 Ga0496116_0041832 3300048919 Bacteria 3140
437 Ga0496116_0053678 3300048919 Bacteria 2660
438 Ga0496117_0033194 3300048920 Bacteria 3907
439 Ga0496117_0105303 3300048920 Bacteria 1773
440 Ga0496118_0009498 3300048921 Bacteria 9806
441 Ga0496118_0095952 3300048921 Bacteria 2022
442 Ga0496119_0023399 3300048922 Bacteria 4381
443 Ga0496120_0003586 3300048923 Bacteria 13947
444 Ga0496121_0000165 3300048924 Bacteria 145052
445 Ga0496121_0003822 3300048924 Bacteria 20965
446 Ga0496121_0004161 3300048924 Bacteria 19780
447 Ga0496121_0016988 3300048924 Bacteria 7470
448 Ga0496121_0017600 3300048924 Bacteria 7284
449 Ga0496121_0022402 3300048924 Bacteria 6133
450 Ga0496121_0127293 3300048924 Bacteria 1913
451 Ga0496122_0000936 3300048925 Bacteria 53067
452 Ga0496122_0001626 3300048925 Bacteria 35051
453 Ga0496122_0003285 3300048925 Bacteria 21429
454 Ga0496123_0001075 3300048926 Bacteria 41273
455 Ga0496123_0001319 3300048926 Bacteria 35071
456 Ga0496123_0003769 3300048926 Bacteria 16617
457 Ga0496123_0089642 3300048926 Bacteria 1831
458 Ga0496124_0000046 3300048927 Bacteria 287043
459 Ga0496124_0084004 3300048927 Bacteria 2611
460 Ga0496125_0000121 3300048928 Bacteria 174971
461 Ga0496125_0002327 3300048928 Bacteria 25024
462 Ga0496125_0022455 3300048928 Bacteria 5860
463 Ga0496125_0029702 3300048928 Bacteria 4906
464 Ga0496125_0049346 3300048928 Bacteria 3498
465 Ga0496125_0076764 3300048928 Bacteria 2578
466 Ga0501033_0104094 3300049570 Bacteria 2069
467 Ga0501034_0219609 3300049571 Bacteria 1853
468 Ga0501036_0024422 3300049572 Bacteria 5095
469 Ga0501037_0030270 3300049573 Bacteria 4001
470 Ga0501038_0016173 3300049574 Bacteria 6768
471 Ga0501038_0018785 3300049574 Bacteria 6239
472 Ga0501039_0034728 3300049575 Bacteria 3891
473 Ga0501039_0088857 3300049575 Bacteria 2407
474 Ga0501039_0664693 3300049575 Bacteria 815
475 Ga0501040_0025479 3300049576 Bacteria 3976
476 Ga0501041_0007764 3300049577 Bacteria 6299
477 Ga0501041_0066512 3300049577 Bacteria 2209
478 Ga0501042_0357326 3300049578 Bacteria 1057
479 Ga0501046_0063123 3300049580 Bacteria 2893
480 Ga0501046_0182729 3300049580 Bacteria 1567
481 Ga0501048_0083380 3300049582 Bacteria 2254
482 Ga0501072_0003674 3300049588 Bacteria 11566
483 Ga0501072_0159215 3300049588 Bacteria 1801
484 Ga0501072_0243928 3300049588 Bacteria 1431
485 Ga0501075_0001437 3300049591 Bacteria 15477
486 Ga0501075_0020339 3300049591 Bacteria 4827
487 Ga0501076_0053398 3300049592 Bacteria 3202
488 Ga0501076_0168335 3300049592 Bacteria 1786
489 Ga0501076_0321160 3300049592 Bacteria 1270
490 Ga0501079_0011234 3300049741 Bacteria 6830
491 Ga0501079_0100210 3300049741 Bacteria 2246
492 Ga0501079_0172978 3300049741 Bacteria 1684
493 Ga0501080_0025403 3300049742 Bacteria 5497
494 Ga0501081_0011654 3300049743 Bacteria 5755
495 Ga0501083_0165164 3300049744 Bacteria 1447
496 Ga0501035_0294935 3300049822 Bacteria 1368
497 Ga0501044_0013470 3300049823 Bacteria 8844
498 Ga0501045_0002422 3300049824 Bacteria 12679
499 Ga0501045_0014711 3300049824 Bacteria 5547
500 nmdc:mga00v17_158968_c1 3300050491 Bacteria 1454
501 nmdc:mga05p37_1054_c1 3300050507 Bacteria 31460
502 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
503 nmdc:mga09592_100_c1 3300050508 Bacteria 52155
504 nmdc:mga09592_52447_c1 3300050508 Bacteria 3443
505 nmdc:mga09592_739_c1 3300050508 Bacteria 25175
506 nmdc:mga0qj67_135341_c1 3300050509 Bacteria 1997
507 nmdc:mga0qj67_215928_c1 3300050509 Bacteria 1557
508 nmdc:mga0qj67_71687_c1 3300050509 Bacteria 2766
509 nmdc:mga06r32_10136_c2 3300050510 Bacteria 8123
510 nmdc:mga06r32_109174_c1 3300050510 Bacteria 2721
511 nmdc:mga06r32_83503_c1 3300050510 Bacteria 3113
512 nmdc:mga08y16_171471_c1 3300050511 Bacteria 2254
513 nmdc:mga08y16_208965_c1 3300050511 Bacteria 2022
514 nmdc:mga08y16_322987_c1 3300050511 Bacteria 1589
515 nmdc:mga08y16_58171_c2 3300050511 Bacteria 3144
516 nmdc:mga0n895_16072_c1 3300050512 Bacteria 6857
517 nmdc:mga0n895_811443_c1 3300050512 Bacteria 925
518 nmdc:mga0rr50_117702_c1 3300050513 Bacteria 2110
519 nmdc:mga0rr50_2265_c1 3300050513 Bacteria 10792
520 nmdc:mga08x19_1264_c1 3300050514 Bacteria 15694
521 nmdc:mga08x19_67646_c1 3300050514 Bacteria 2324
522 nmdc:mga08x19_91732_c1 3300050514 Bacteria 2005
523 nmdc:mga0a205_156224_c1 3300050515 Bacteria 2179
524 nmdc:mga0a205_226893_c1 3300050515 Bacteria 1752
525 nmdc:mga0a205_3570_c1 3300050515 Bacteria 13926
526 Ga0495612_0075714 3300053078 Bacteria 1409
527 Ga0500644_0027330 3300053088 Bacteria 1774
528 Ga0500644_0044142 3300053088 Bacteria 1495
529 Ga0500651_0057488 3300053093 Bacteria 2434
530 Ga0500562_002948 3300053108 Bacteria 4246
531 Ga0500594_0011571 3300053118 Bacteria 2061
532 Ga0500618_000716 3300053125 Bacteria 19145
533 Ga0500618_000823 3300053125 Bacteria 17028
534 Ga0500559_0000047 3300053136 Bacteria 95447
535 Ga0500586_051960 3300053145 Bacteria 1414
536 Ga0500622_0006088 3300053156 Bacteria 7085
537 Ga0500634_0098054 3300053161 Bacteria 1473
538 Ga0501084_0045106 3300054114 Bacteria 3692
539 Ga0501082_0013050 3300060353 Bacteria 7141
540 Ga0501082_0184640 3300060353 Bacteria 1814
541 Ga0501082_0229799 3300060353 Bacteria 1614
542 Ga0530510_0112172 3300061734 Bacteria 1998

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0664693 Ga0501039_0664693_13_729 224
2 3300025925 Ga0207650_10499486 Ga0207650_104994862 226
3 3300050511 nmdc:mga08y16_58171_c2 nmdc:mga08y16_58171_c2_2377_3120 233
4 3300046539 Ga0495621_0034663 Ga0495621_0034663_12_761 235
5 3300031090 Ga0265760_10014928 Ga0265760_100149282 246
6 3300005435 Ga0070714_100185199 Ga0070714_1001851991 247
7 3300005458 Ga0070681_10002557 Ga0070681_1000255714 247
8 3300005563 Ga0068855_100244551 Ga0068855_1002445512 247
9 3300005614 Ga0068856_100006230 Ga0068856_1000062302 247
10 3300013105 Ga0157369_10123443 Ga0157369_101234432 247
11 3300025917 Ga0207660_10021266 Ga0207660_100212662 247
12 3300025949 Ga0207667_10205159 Ga0207667_102051592 247
13 3300026078 Ga0207702_10112572 Ga0207702_101125722 247
14 3300025303 Ga0209051_1004307 Ga0209051_10043075 252
15 3300036401 Ga0373937_0068852 Ga0373937_0068852_1163_2035 252
16 3300046529 Ga0495652_0259602 Ga0495652_0259602_295_1167 252
17 3300031456 Ga0307513_10117289 Ga0307513_101172892 253
18 3300048924 Ga0496121_0022402 Ga0496121_0022402_593_1471 255
19 3300003187 JGI25151J46595_10049929 JGI25151J46595_100499292 256
20 3300003775 Ga0055524_1008162 Ga0055524_10081622 256
21 3300025294 Ga0209025_1002021 Ga0209025_10020211 256
22 3300025299 Ga0209256_1000492 Ga0209256_100049247 256
23 3300037068 Ga0373925_0306302 Ga0373925_0306302_219_1094 256
24 3300046533 Ga0495640_0170997 Ga0495640_0170997_80_955 256
25 3300005331 Ga0070670_100071860 Ga0070670_1000718602 257
26 3300005563 Ga0068855_100619389 Ga0068855_1006193892 257
27 3300005614 Ga0068856_100068929 Ga0068856_1000689292 257
28 3300005616 Ga0068852_100023753 Ga0068852_1000237534 257
29 3300009093 Ga0105240_10002050 Ga0105240_100020505 257
30 3300009093 Ga0105240_10006656 Ga0105240_1000665612 257
31 3300009551 Ga0105238_10189172 Ga0105238_101891722 257
32 3300014497 Ga0182008_10024181 Ga0182008_100241811 257
33 3300025233 Ga0209437_100117 Ga0209437_100117133 257
34 3300025913 Ga0207695_10004925 Ga0207695_100049252 257
35 3300025925 Ga0207650_10136566 Ga0207650_101365662 257
36 3300025949 Ga0207667_10006563 Ga0207667_1000656310 257
37 3300026078 Ga0207702_10023862 Ga0207702_100238622 257
38 3300026142 Ga0207698_10026389 Ga0207698_100263892 257
39 3300048919 Ga0496116_0015566 Ga0496116_0015566_1761_2639 257
40 3300048924 Ga0496121_0003822 Ga0496121_0003822_13648_14526 257
41 3300048925 Ga0496122_0001626 Ga0496122_0001626_8776_9654 257
42 3300048926 Ga0496123_0001319 Ga0496123_0001319_8796_9674 257
43 3300048928 Ga0496125_0002327 Ga0496125_0002327_3721_4599 257
44 3300048928 Ga0496125_0076764 Ga0496125_0076764_676_1554 257
45 3300053078 Ga0495612_0075714 Ga0495612_0075714_61_936 257
46 3300047443 Ga0495687_006653 Ga0495687_006653_1472_2347 258
47 3300048911 Ga0496108_0079845 Ga0496108_0079845_565_1440 258
48 3300048912 Ga0496109_0113606 Ga0496109_0113606_1021_1896 258
49 3300048913 Ga0496110_0087967 Ga0496110_0087967_488_1363 258
50 3300005436 Ga0070713_100028911 Ga0070713_1000289114 259
51 3300005459 Ga0068867_100092301 Ga0068867_1000923012 259
52 3300005468 Ga0070707_100127737 Ga0070707_1001277372 259
53 3300005518 Ga0070699_100000829 Ga0070699_1000008299 259
54 3300005518 Ga0070699_100233520 Ga0070699_1002335202 259
55 3300005536 Ga0070697_100203198 Ga0070697_1002031982 259
56 3300005545 Ga0070695_100309597 Ga0070695_1003095972 259
57 3300006173 Ga0070716_100049998 Ga0070716_1000499982 259
58 3300007265 Ga0099794_10012552 Ga0099794_100125522 259
59 3300025292 Ga0209676_1003226 Ga0209676_10032268 259
60 3300025298 Ga0209050_1004102 Ga0209050_10041022 259
61 3300025303 Ga0209051_1024873 Ga0209051_10248732 259
62 3300025907 Ga0207645_10040099 Ga0207645_100400992 259
63 3300025910 Ga0207684_10048246 Ga0207684_100482462 259
64 3300025915 Ga0207693_10014590 Ga0207693_100145903 259
65 3300025922 Ga0207646_10203529 Ga0207646_102035292 259
66 3300025923 Ga0207681_10001355 Ga0207681_100013557 259
67 3300025939 Ga0207665_10015991 Ga0207665_100159915 259
68 3300026089 Ga0207648_10012950 Ga0207648_100129502 259
69 3300027671 Ga0209588_1032236 Ga0209588_10322362 259
70 3300042015 Ga0439462_0002146 Ga0439462_0002146_2782_3660 259
71 3300047318 Ga0495636_0101516 Ga0495636_0101516_249_1124 259
72 3300048913 Ga0496110_0084010 Ga0496110_0084010_975_1850 259
73 3300048919 Ga0496116_0041832 Ga0496116_0041832_18_1019 259
74 3300048919 Ga0496116_0053678 Ga0496116_0053678_1353_2231 259
75 3300048920 Ga0496117_0033194 Ga0496117_0033194_2087_2965 259
76 3300048920 Ga0496117_0105303 Ga0496117_0105303_766_1644 259
77 3300048921 Ga0496118_0009498 Ga0496118_0009498_5304_6182 259
78 3300048921 Ga0496118_0095952 Ga0496118_0095952_95_973 259
79 3300048922 Ga0496119_0023399 Ga0496119_0023399_1017_1895 259
80 3300048923 Ga0496120_0003586 Ga0496120_0003586_11176_12054 259
81 3300048924 Ga0496121_0000165 Ga0496121_0000165_117783_118661 259
82 3300048925 Ga0496122_0000936 Ga0496122_0000936_3650_4528 259
83 3300048926 Ga0496123_0001075 Ga0496123_0001075_3711_4589 259
84 3300048926 Ga0496123_0089642 Ga0496123_0089642_830_1708 259
85 3300048927 Ga0496124_0084004 Ga0496124_0084004_1397_2275 259
86 3300048928 Ga0496125_0000121 Ga0496125_0000121_128250_129128 259
87 3300048928 Ga0496125_0049346 Ga0496125_0049346_2265_3143 259
88 3300050515 nmdc:mga0a205_156224_c1 nmdc:mga0a205_156224_c1_996_1871 259
89 3300049588 Ga0501072_0003674 Ga0501072_0003674_2469_3344 260
90 3300053125 Ga0500618_000823 Ga0500618_000823_9205_10083 260
91 3300005334 Ga0068869_100515595 Ga0068869_1005155951 261
92 3300006852 Ga0075433_10223715 Ga0075433_102237152 261
93 3300006946 Ga0079104_1016099 Ga0079104_10160992 261
94 3300009177 Ga0105248_10139969 Ga0105248_101399692 261
95 3300014326 Ga0157380_10478944 Ga0157380_104789441 261
96 3300025921 Ga0207652_10113919 Ga0207652_101139192 261
97 3300035088 Ga0373940_0083521 Ga0373940_0083521_13_840 261
98 3300035695 Ga0373927_0082518 Ga0373927_0082518_535_1362 261
99 3300046463 Ga0495653_0383533 Ga0495653_0383533_14_886 261
100 3300047317 Ga0495604_0104852 Ga0495604_0104852_530_1402 261
101 3300047444 Ga0495675_0228037 Ga0495675_0228037_73_945 261
102 3300048907 Ga0496104_0010260 Ga0496104_0010260_1991_2818 261
103 3300048909 Ga0496106_0129859 Ga0496106_0129859_624_1451 261
104 3300048911 Ga0496108_0130915 Ga0496108_0130915_1126_1953 261
105 3300048911 Ga0496108_0407351 Ga0496108_0407351_21_848 261
106 3300048913 Ga0496110_0072749 Ga0496110_0072749_1672_2499 261
107 3300048915 Ga0496112_0323176 Ga0496112_0323176_512_1339 261
108 3300048916 Ga0496113_0039121 Ga0496113_0039121_723_1550 261
109 3300049580 Ga0501046_0182729 Ga0501046_0182729_17_847 261
110 3300049744 Ga0501083_0165164 Ga0501083_0165164_599_1426 261
111 3300050512 nmdc:mga0n895_811443_c1 nmdc:mga0n895_811443_c1_25_852 261
112 3300050515 nmdc:mga0a205_226893_c1 nmdc:mga0a205_226893_c1_464_1291 261
113 3300046642 Ga0495634_0034394 Ga0495634_0034394_1540_2415 262
114 3300047321 Ga0495676_0067451 Ga0495676_0067451_884_1759 262
115 3300048924 Ga0496121_0127293 Ga0496121_0127293_287_1159 262
116 3300006175 Ga0070712_100022470 Ga0070712_1000224702 263
117 3300009094 Ga0111539_10018489 Ga0111539_100184895 263
118 3300025915 Ga0207693_10006637 Ga0207693_100066372 263
119 3300025981 Ga0207640_10088830 Ga0207640_100888302 263
120 3300035172 Ga0373955_0006817 Ga0373955_0006817_524_1396 263
121 3300046516 Ga0495628_0034298 Ga0495628_0034298_2717_3589 263
122 3300046680 Ga0495646_0034925 Ga0495646_0034925_703_1575 263
123 3300046681 Ga0495647_0012356 Ga0495647_0012356_967_1839 263
124 3300049575 Ga0501039_0088857 Ga0501039_0088857_658_1527 263
125 3300005339 Ga0070660_100045969 Ga0070660_1000459692 264
126 3300005366 Ga0070659_100093847 Ga0070659_1000938472 264
127 3300005563 Ga0068855_100007207 Ga0068855_10000720711 264
128 3300005614 Ga0068856_100110677 Ga0068856_1001106772 264
129 3300005841 Ga0068863_100326532 Ga0068863_1003265322 264
130 3300006871 Ga0075434_100229925 Ga0075434_1002299252 264
131 3300007076 Ga0075435_100324503 Ga0075435_1003245031 264
132 3300025284 Ga0209130_1012022 Ga0209130_10120222 264
133 3300025906 Ga0207699_10139104 Ga0207699_101391042 264
134 3300025919 Ga0207657_10057520 Ga0207657_100575202 264
135 3300025929 Ga0207664_10096151 Ga0207664_100961511 264
136 3300025945 Ga0207679_10294947 Ga0207679_102949471 264
137 3300026078 Ga0207702_10165389 Ga0207702_101653892 264
138 3300046454 Ga0495592_0271707 Ga0495592_0271707_66_932 264
139 3300046476 Ga0495662_0046936 Ga0495662_0046936_67_933 264
140 3300046517 Ga0495630_0002830 Ga0495630_0002830_8964_9830 264
141 3300046533 Ga0495640_0233408 Ga0495640_0233408_93_959 264
142 3300046642 Ga0495634_0091065 Ga0495634_0091065_853_1719 264
143 3300046690 Ga0495624_0007569 Ga0495624_0007569_5124_5990 264
144 3300047322 Ga0495680_0167183 Ga0495680_0167183_548_1414 264
145 3300048917 Ga0496114_0474586 Ga0496114_0474586_46_921 264
146 3300049572 Ga0501036_0024422 Ga0501036_0024422_180_1052 264
147 3300049574 Ga0501038_0016173 Ga0501038_0016173_2819_3691 264
148 3300049576 Ga0501040_0025479 Ga0501040_0025479_2599_3471 264
149 3300049577 Ga0501041_0007764 Ga0501041_0007764_5337_6209 264
150 3300049580 Ga0501046_0063123 Ga0501046_0063123_1914_2786 264
151 3300049582 Ga0501048_0083380 Ga0501048_0083380_965_1837 264
152 3300049591 Ga0501075_0001437 Ga0501075_0001437_13708_14580 264
153 3300049592 Ga0501076_0053398 Ga0501076_0053398_2207_3079 264
154 3300049741 Ga0501079_0011234 Ga0501079_0011234_24_896 264
155 3300049743 Ga0501081_0011654 Ga0501081_0011654_25_897 264
156 3300049822 Ga0501035_0294935 Ga0501035_0294935_446_1318 264
157 3300049824 Ga0501045_0002422 Ga0501045_0002422_10448_11320 264
158 3300050513 nmdc:mga0rr50_117702_c1 nmdc:mga0rr50_117702_c1_1170_2036 264
159 3300054114 Ga0501084_0045106 Ga0501084_0045106_948_1820 264
160 3300060353 Ga0501082_0013050 Ga0501082_0013050_3572_4444 264
161 3300037312 Ga0395899_0011466 Ga0395899_0011466_5776_6654 265
162 3300037418 Ga0395900_0055645 Ga0395900_0055645_316_1194 265
163 3300037466 Ga0395898_0038222 Ga0395898_0038222_1873_2751 265
164 3300037471 Ga0395905_0094682 Ga0395905_0094682_1062_1940 265
165 3300038443 Ga0395901_0167378 Ga0395901_0167378_920_1798 265
166 3300053093 Ga0500651_0057488 Ga0500651_0057488_546_1424 265
167 3300005327 Ga0070658_10099862 Ga0070658_100998622 266
168 3300005329 Ga0070683_100071598 Ga0070683_1000715982 266
169 3300005337 Ga0070682_100079571 Ga0070682_1000795712 266
170 3300005339 Ga0070660_100098691 Ga0070660_1000986912 266
171 3300005339 Ga0070660_100174956 Ga0070660_1001749562 266
172 3300005344 Ga0070661_100105142 Ga0070661_1001051422 266
173 3300005366 Ga0070659_100005229 Ga0070659_1000052299 266
174 3300005535 Ga0070684_100003238 Ga0070684_1000032386 266
175 3300005539 Ga0068853_100028827 Ga0068853_1000288273 266
176 3300005564 Ga0070664_100041171 Ga0070664_1000411712 266
177 3300005578 Ga0068854_100008150 Ga0068854_1000081505 266
178 3300005834 Ga0068851_10018633 Ga0068851_100186332 266
179 3300006175 Ga0070712_100273914 Ga0070712_1002739142 266
180 3300009551 Ga0105238_10019514 Ga0105238_100195146 266
181 3300013104 Ga0157370_10555118 Ga0157370_105551181 266
182 3300013307 Ga0157372_10042798 Ga0157372_100427982 266
183 3300020082 Ga0206353_10776176 Ga0206353_107761762 266
184 3300025909 Ga0207705_10042785 Ga0207705_100427852 266
185 3300025912 Ga0207707_10054809 Ga0207707_100548093 266
186 3300025913 Ga0207695_10168650 Ga0207695_101686502 266
187 3300025917 Ga0207660_10173286 Ga0207660_101732862 266
188 3300025919 Ga0207657_10000160 Ga0207657_1000016035 266
189 3300025919 Ga0207657_10087235 Ga0207657_100872352 266
190 3300025920 Ga0207649_10009821 Ga0207649_100098212 266
191 3300025929 Ga0207664_10040242 Ga0207664_100402422 266
192 3300025945 Ga0207679_10132301 Ga0207679_101323012 266
193 3300025949 Ga0207667_10001999 Ga0207667_1000199924 266
194 3300026041 Ga0207639_10015120 Ga0207639_100151202 266
195 3300026041 Ga0207639_10246441 Ga0207639_102464412 266
196 3300026116 Ga0207674_10000236 Ga0207674_1000023627 266
197 3300026142 Ga0207698_10054538 Ga0207698_100545382 266
198 3300046516 Ga0495628_0043678 Ga0495628_0043678_908_1783 266
199 3300006948 Ga0099826_10000113 Ga0099826_100001138 267
200 3300009011 Ga0105251_10057914 Ga0105251_100579142 267
201 3300027666 Ga0209282_1000165 Ga0209282_10001659 267
202 3300046474 Ga0495605_0006316 Ga0495605_0006316_3054_3932 267
203 3300046491 Ga0495584_0071056 Ga0495584_0071056_107_985 267
204 3300046500 Ga0495596_0000975 Ga0495596_0000975_180_1058 267
205 3300046501 Ga0495607_0005726 Ga0495607_0005726_7876_8754 267
206 3300046512 Ga0495610_0001332 Ga0495610_0001332_6108_6986 267
207 3300046513 Ga0495616_0000889 Ga0495616_0000889_15213_16091 267
208 3300046538 Ga0495609_0003775 Ga0495609_0003775_5455_6333 267
209 3300046648 Ga0495611_0060295 Ga0495611_0060295_756_1634 267
210 3300046660 Ga0495625_0002799 Ga0495625_0002799_8777_9655 267
211 3300046665 Ga0495661_0014728 Ga0495661_0014728_3508_4386 267
212 3300046692 Ga0495671_0001016 Ga0495671_0001016_13089_13967 267
213 3300047320 Ga0495672_0015225 Ga0495672_0015225_85_963 267
214 3300048919 Ga0496116_0009765 Ga0496116_0009765_84_962 267
215 3300048924 Ga0496121_0017600 Ga0496121_0017600_315_1193 267
216 3300048925 Ga0496122_0003285 Ga0496122_0003285_5563_6441 267
217 3300048926 Ga0496123_0003769 Ga0496123_0003769_15625_16503 267
218 3300006844 Ga0075428_100049725 Ga0075428_1000497252 268
219 3300006847 Ga0075431_100003002 Ga0075431_1000030025 268
220 3300006880 Ga0075429_100000107 Ga0075429_10000010728 268
221 3300009147 Ga0114129_10023386 Ga0114129_100233864 268
222 3300046475 Ga0495639_0130280 Ga0495639_0130280_45_920 268
223 3300048904 Ga0496101_0144398 Ga0496101_0144398_920_1795 268
224 3300048907 Ga0496104_0165959 Ga0496104_0165959_158_1033 268
225 3300050507 nmdc:mga05p37_1054_c1 nmdc:mga05p37_1054_c1_18755_19627 268
226 3300050508 nmdc:mga09592_100_c1 nmdc:mga09592_100_c1_35729_36601 268
227 3300050510 nmdc:mga06r32_109174_c1 nmdc:mga06r32_109174_c1_1595_2467 268
228 3300025940 Ga0207691_10268888 Ga0207691_102688882 269
229 3300003187 JGI25151J46595_10002298 JGI25151J46595_100022987 270
230 3300003322 rootL2_10157044 rootL2_101570442 270
231 3300003781 Ga0055536_1000677 Ga0055536_100067715 270
232 3300003784 Ga0055534_1000985 Ga0055534_10009857 270
233 3300025291 Ga0209675_1000174 Ga0209675_100017426 270
234 3300025292 Ga0209676_1001413 Ga0209676_100141316 270
235 3300025294 Ga0209025_1001481 Ga0209025_10014818 270
236 3300025295 Ga0209564_1000145 Ga0209564_100014525 270
237 3300025295 Ga0209564_1001261 Ga0209564_10012618 270
238 iso_pu_bacteria 2842698319 2842701893 271
239 3300031548 Ga0307408_100119558 Ga0307408_1001195582 272
240 3300031911 Ga0307412_10000106 Ga0307412_1000010641 272
241 3300032002 Ga0307416_100221734 Ga0307416_1002217342 272
242 3300044694 Ga0466963_0394222 Ga0466963_0394222_14_886 272
243 iso_pu_bacteria 2513237087 2513590286 272
244 iso_pu_bacteria 2937843397 2937847601 272
245 3300006847 Ga0075431_100434518 Ga0075431_1004345182 273
246 3300025901 Ga0207688_10161244 Ga0207688_101612441 273
247 3300027682 Ga0209971_1011152 Ga0209971_10111522 273
248 3300027695 Ga0209966_1005180 Ga0209966_10051802 273
249 3300027876 Ga0209974_10019543 Ga0209974_100195432 273
250 3300042001 Ga0439441_001355 Ga0439441_001355_2276_3139 273
251 3300042013 Ga0439456_012441 Ga0439456_012441_301_1164 273
252 3300042435 Ga0439434_0073702 Ga0439434_0073702_124_987 273
253 3300042436 Ga0439435_0004976 Ga0439435_0004976_1499_2362 273
254 3300042437 Ga0439444_0000141 Ga0439444_0000141_3589_4452 273
255 3300042461 Ga0439460_0013205 Ga0439460_0013205_901_1764 273
256 3300048924 Ga0496121_0016988 Ga0496121_0016988_2415_3293 273
257 3300048927 Ga0496124_0000046 Ga0496124_0000046_256302_257180 273
258 3300050508 nmdc:mga09592_52447_c1 nmdc:mga09592_52447_c1_837_1700 273
259 3300050509 nmdc:mga0qj67_71687_c1 nmdc:mga0qj67_71687_c1_769_1632 273
260 3300050510 nmdc:mga06r32_83503_c1 nmdc:mga06r32_83503_c1_1874_2737 273
261 3300053125 Ga0500618_000716 Ga0500618_000716_10904_11782 273
262 3300053161 Ga0500634_0098054 Ga0500634_0098054_284_1162 273
263 iso_pu_bacteria 2574179768 2574432085 273
264 iso_pu_bacteria 2834641062 2834645804 273
265 iso_pu_bacteria 8003400568 8003405541 273
266 3300005329 Ga0070683_100059947 Ga0070683_1000599472 274
267 3300005330 Ga0070690_100064341 Ga0070690_1000643412 274
268 3300005334 Ga0068869_100070709 Ga0068869_1000707092 274
269 3300005354 Ga0070675_100059881 Ga0070675_1000598812 274
270 3300005364 Ga0070673_100400962 Ga0070673_1004009621 274
271 3300005406 Ga0070703_10031739 Ga0070703_100317392 274
272 3300005441 Ga0070700_100044814 Ga0070700_1000448142 274
273 3300005441 Ga0070700_100338278 Ga0070700_1003382781 274
274 3300005544 Ga0070686_100004065 Ga0070686_1000040655 274
275 3300005549 Ga0070704_100426466 Ga0070704_1004264662 274
276 3300005615 Ga0070702_100008100 Ga0070702_1000081002 274
277 3300005844 Ga0068862_100005219 Ga0068862_10000521911 274
278 3300005844 Ga0068862_100270969 Ga0068862_1002709691 274
279 3300006237 Ga0097621_100004313 Ga0097621_10000431311 274
280 3300006358 Ga0068871_100008335 Ga0068871_1000083354 274
281 3300006844 Ga0075428_100213419 Ga0075428_1002134192 274
282 3300006846 Ga0075430_100125335 Ga0075430_1001253352 274
283 3300009094 Ga0111539_10059054 Ga0111539_100590542 274
284 3300009094 Ga0111539_10399916 Ga0111539_103999162 274
285 3300009148 Ga0105243_10002935 Ga0105243_100029353 274
286 3300014969 Ga0157376_10032509 Ga0157376_100325093 274
287 3300025885 Ga0207653_10071177 Ga0207653_100711772 274
288 3300025908 Ga0207643_10031169 Ga0207643_100311692 274
289 3300025935 Ga0207709_10013646 Ga0207709_100136464 274
290 3300025938 Ga0207704_10024596 Ga0207704_100245962 274
291 3300025944 Ga0207661_10040466 Ga0207661_100404662 274
292 3300025972 Ga0207668_10038805 Ga0207668_100388054 274
293 3300026118 Ga0207675_100020378 Ga0207675_1000203786 274
294 3300027907 Ga0207428_10198484 Ga0207428_101984841 274
295 3300028380 Ga0268265_10002203 Ga0268265_1000220311 274
296 3300028380 Ga0268265_10280955 Ga0268265_102809552 274
297 3300031731 Ga0307405_10279474 Ga0307405_102794742 274
298 3300032002 Ga0307416_100063467 Ga0307416_1000634672 274
299 3300032005 Ga0307411_10090119 Ga0307411_100901192 274
300 3300035092 Ga0373952_0019730 Ga0373952_0019730_168_1034 274
301 3300035207 Ga0373942_0051060 Ga0373942_0051060_134_1000 274
302 3300035691 Ga0373931_0026064 Ga0373931_0026064_281_1147 274
303 3300048905 Ga0496102_0064195 Ga0496102_0064195_993_1868 274
304 3300048906 Ga0496103_0048741 Ga0496103_0048741_302_1177 274
305 3300050509 nmdc:mga0qj67_215928_c1 nmdc:mga0qj67_215928_c1_337_1203 274
306 3300050511 nmdc:mga08y16_208965_c1 nmdc:mga08y16_208965_c1_720_1586 274
307 3300050511 nmdc:mga08y16_322987_c1 nmdc:mga08y16_322987_c1_38_904 274
308 iso_pu_bacteria 2501025502 2501085711 274
309 iso_pu_bacteria 2510917013 2511094175 274
310 iso_pu_bacteria 2511231026 2511384284 274
311 iso_pu_bacteria 2521172590 2521559701 274
312 iso_pu_bacteria 2599185292 2599904324 274
313 iso_pu_bacteria 2643221569 2643863730 274
314 iso_pu_bacteria 2643221594 2643982933 274
315 iso_pu_bacteria 2643221621 2644123226 274
316 iso_pu_bacteria 2765235838 2765570959 274
317 iso_pu_bacteria 2808606386 2808984868 274
318 iso_pu_bacteria 2808606395 2809033523 274
319 iso_pu_bacteria 2808606415 2809128274 274
320 iso_pu_bacteria 2808606419 2809147895 274
321 iso_pu_bacteria 2818991449 2819616076 274
322 iso_pu_bacteria 2839094727 2839099350 274
323 iso_pu_bacteria 2852618963 2852620693 274
324 iso_pu_bacteria 2855730933 2855732900 274
325 iso_pu_bacteria 2855767633 2855771652 274
326 iso_pu_bacteria 2857357740 2857365990 274
327 iso_pu_bacteria 2857537821 2857537977 274
328 iso_pu_bacteria 2857542790 2857546546 274
329 iso_pu_bacteria 2881412998 2881413797 274
330 iso_pu_bacteria 2884811622 2884815355 274
331 iso_pu_bacteria 2884836552 2884841087 274
332 iso_pu_bacteria 2884852848 2884855962 274
333 iso_pu_bacteria 2896154374 2896157113 274
334 iso_pu_bacteria 2904479285 2904481438 274
335 iso_pu_bacteria 2904530477 2904533047 274
336 iso_pu_bacteria 2904584206 2904585602 274
337 iso_pu_bacteria 2904589729 2904593951 274
338 iso_pu_bacteria 2904601388 2904603896 274
339 iso_pu_bacteria 2919046199 2919047605 274
340 iso_pu_bacteria 2919079590 2919081866 274
341 iso_pu_bacteria 2919704043 2919708643 274
342 iso_pu_bacteria 2941479691 2941484218 274
343 3300003203 JGI25406J46586_10047422 JGI25406J46586_100474222 275
344 3300005330 Ga0070690_100001504 Ga0070690_1000015049 275
345 3300005334 Ga0068869_100001561 Ga0068869_1000015612 275
346 3300005336 Ga0070680_100001721 Ga0070680_1000017218 275
347 3300005337 Ga0070682_100005629 Ga0070682_1000056295 275
348 3300005338 Ga0068868_100001141 Ga0068868_10000114111 275
349 3300005341 Ga0070691_10000844 Ga0070691_100008446 275
350 3300005343 Ga0070687_100000316 Ga0070687_1000003169 275
351 3300005345 Ga0070692_10003111 Ga0070692_100031112 275
352 3300005354 Ga0070675_100266311 Ga0070675_1002663111 275
353 3300005355 Ga0070671_100092729 Ga0070671_1000927292 275
354 3300005364 Ga0070673_100136273 Ga0070673_1001362732 275
355 3300005406 Ga0070703_10007083 Ga0070703_100070832 275
356 3300005438 Ga0070701_10006445 Ga0070701_100064452 275
357 3300005440 Ga0070705_100001322 Ga0070705_1000013229 275
358 3300005444 Ga0070694_100000228 Ga0070694_10000022825 275
359 3300005445 Ga0070708_100258455 Ga0070708_1002584552 275
360 3300005458 Ga0070681_10002377 Ga0070681_1000237710 275
361 3300005459 Ga0068867_100004278 Ga0068867_1000042785 275
362 3300005530 Ga0070679_100015857 Ga0070679_1000158573 275
363 3300005536 Ga0070697_100016288 Ga0070697_1000162882 275
364 3300005544 Ga0070686_100001157 Ga0070686_10000115711 275
365 3300005545 Ga0070695_100000946 Ga0070695_1000009469 275
366 3300005545 Ga0070695_100011344 Ga0070695_1000113442 275
367 3300005545 Ga0070695_100108288 Ga0070695_1001082881 275
368 3300005546 Ga0070696_100001500 Ga0070696_10000150020 275
369 3300005546 Ga0070696_100002309 Ga0070696_10000230914 275
370 3300005547 Ga0070693_100000451 Ga0070693_10000045110 275
371 3300005547 Ga0070693_100143976 Ga0070693_1001439762 275
372 3300005549 Ga0070704_100001349 Ga0070704_1000013499 275
373 3300005563 Ga0068855_100003762 Ga0068855_10000376212 275
374 3300005578 Ga0068854_100013003 Ga0068854_1000130032 275
375 3300005615 Ga0070702_100000148 Ga0070702_10000014810 275
376 3300005616 Ga0068852_100063710 Ga0068852_1000637102 275
377 3300005617 Ga0068859_100002466 Ga0068859_1000024669 275
378 3300005718 Ga0068866_10000302 Ga0068866_1000030212 275
379 3300005719 Ga0068861_100002875 Ga0068861_1000028756 275
380 3300005842 Ga0068858_100004157 Ga0068858_1000041575 275
381 3300005843 Ga0068860_100008220 Ga0068860_1000082206 275
382 3300005844 Ga0068862_100004540 Ga0068862_10000454012 275
383 3300005985 Ga0081539_10003560 Ga0081539_100035604 275
384 3300006237 Ga0097621_100003364 Ga0097621_1000033649 275
385 3300006358 Ga0068871_100001348 Ga0068871_1000013489 275
386 3300006844 Ga0075428_100001160 Ga0075428_10000116027 275
387 3300006852 Ga0075433_10078004 Ga0075433_100780041 275
388 3300006871 Ga0075434_100005264 Ga0075434_10000526411 275
389 3300006880 Ga0075429_100000076 Ga0075429_10000007649 275
390 3300006881 Ga0068865_100001770 Ga0068865_1000017708 275
391 3300006914 Ga0075436_100003398 Ga0075436_1000033985 275
392 3300006931 Ga0097620_100002466 Ga0097620_1000024669 275
393 3300009094 Ga0111539_10070243 Ga0111539_100702432 275
394 3300009098 Ga0105245_10001017 Ga0105245_1000101712 275
395 3300009147 Ga0114129_10000791 Ga0114129_1000079138 275
396 3300009148 Ga0105243_10002797 Ga0105243_100027973 275
397 3300009176 Ga0105242_10001715 Ga0105242_1000171511 275
398 3300009177 Ga0105248_10245441 Ga0105248_102454412 275
399 3300009553 Ga0105249_10004241 Ga0105249_100042413 275
400 3300011119 Ga0105246_10180676 Ga0105246_101806762 275
401 3300013297 Ga0157378_10003629 Ga0157378_100036292 275
402 3300013306 Ga0163162_10165328 Ga0163162_101653282 275
403 3300014968 Ga0157379_10290581 Ga0157379_102905812 275
404 3300014969 Ga0157376_10001701 Ga0157376_100017019 275
405 3300025885 Ga0207653_10010080 Ga0207653_100100802 275
406 3300025899 Ga0207642_10001745 Ga0207642_100017453 275
407 3300025907 Ga0207645_10103419 Ga0207645_101034192 275
408 3300025912 Ga0207707_10034183 Ga0207707_100341832 275
409 3300025918 Ga0207662_10000479 Ga0207662_100004795 275
410 3300025926 Ga0207659_10133119 Ga0207659_101331192 275
411 3300025927 Ga0207687_10001010 Ga0207687_1000101012 275
412 3300025934 Ga0207686_10002110 Ga0207686_100021108 275
413 3300025935 Ga0207709_10000532 Ga0207709_1000053217 275
414 3300025936 Ga0207670_10034477 Ga0207670_100344772 275
415 3300025938 Ga0207704_10003136 Ga0207704_100031366 275
416 3300025941 Ga0207711_10263704 Ga0207711_102637042 275
417 3300025942 Ga0207689_10001100 Ga0207689_100011009 275
418 3300025949 Ga0207667_10011796 Ga0207667_100117963 275
419 3300025960 Ga0207651_10069988 Ga0207651_100699882 275
420 3300025961 Ga0207712_10006700 Ga0207712_100067004 275
421 3300025981 Ga0207640_10013112 Ga0207640_100131122 275
422 3300026023 Ga0207677_10002179 Ga0207677_100021794 275
423 3300026035 Ga0207703_10018088 Ga0207703_100180883 275
424 3300026075 Ga0207708_10001959 Ga0207708_100019598 275
425 3300026089 Ga0207648_10001964 Ga0207648_1000196410 275
426 3300026118 Ga0207675_100000089 Ga0207675_10000008964 275
427 3300026142 Ga0207698_10049484 Ga0207698_100494842 275
428 3300027907 Ga0207428_10001985 Ga0207428_1000198515 275
429 3300028380 Ga0268265_10008737 Ga0268265_100087373 275
430 3300028381 Ga0268264_10003987 Ga0268264_100039879 275
431 3300034818 Ga0373950_0015194 Ga0373950_0015194_341_1210 275
432 3300034819 Ga0373958_0018831 Ga0373958_0018831_191_1060 275
433 3300034820 Ga0373959_0028411 Ga0373959_0028411_143_1012 275
434 3300035083 Ga0373926_0009660 Ga0373926_0009660_288_1157 275
435 3300035084 Ga0373928_0007841 Ga0373928_0007841_1110_1979 275
436 3300035115 Ga0373941_0008916 Ga0373941_0008916_299_1168 275
437 3300035115 Ga0373941_0021741 Ga0373941_0021741_461_1330 275
438 3300035242 Ga0373962_0008807 Ga0373962_0008807_513_1382 275
439 3300035691 Ga0373931_0002999 Ga0373931_0002999_1368_2237 275
440 3300035692 Ga0373935_0050988 Ga0373935_0050988_1165_2034 275
441 3300035695 Ga0373927_0018551 Ga0373927_0018551_515_1384 275
442 3300035725 Ga0373947_0146659 Ga0373947_0146659_594_1463 275
443 3300037068 Ga0373925_0032753 Ga0373925_0032753_1237_2106 275
444 3300046455 Ga0495603_0003735 Ga0495603_0003735_1553_2422 275
445 3300046472 Ga0495580_0014864 Ga0495580_0014864_1472_2341 275
446 3300046526 Ga0495666_0059438 Ga0495666_0059438_293_1162 275
447 3300046535 Ga0495586_0004499 Ga0495586_0004499_837_1706 275
448 3300046674 Ga0495588_0028228 Ga0495588_0028228_549_1418 275
449 3300046681 Ga0495647_0000551 Ga0495647_0000551_2628_3497 275
450 3300047321 Ga0495676_0034950 Ga0495676_0034950_1771_2640 275
451 3300049577 Ga0501041_0066512 Ga0501041_0066512_602_1471 275
452 3300049578 Ga0501042_0357326 Ga0501042_0357326_39_908 275
453 3300049588 Ga0501072_0243928 Ga0501072_0243928_455_1324 275
454 3300049591 Ga0501075_0020339 Ga0501075_0020339_3913_4782 275
455 3300049592 Ga0501076_0321160 Ga0501076_0321160_327_1196 275
456 3300049741 Ga0501079_0172978 Ga0501079_0172978_72_941 275
457 3300050507 nmdc:mga05p37_72_c1 nmdc:mga05p37_72_c1_51822_52691 275
458 3300050508 nmdc:mga09592_739_c1 nmdc:mga09592_739_c1_16093_16962 275
459 3300050511 nmdc:mga08y16_171471_c1 nmdc:mga08y16_171471_c1_470_1339 275
460 3300050512 nmdc:mga0n895_16072_c1 nmdc:mga0n895_16072_c1_4657_5526 275
461 3300050513 nmdc:mga0rr50_2265_c1 nmdc:mga0rr50_2265_c1_2875_3744 275
462 3300050514 nmdc:mga08x19_1264_c1 nmdc:mga08x19_1264_c1_10703_11572 275
463 3300050514 nmdc:mga08x19_67646_c1 nmdc:mga08x19_67646_c1_866_1735 275
464 3300050515 nmdc:mga0a205_3570_c1 nmdc:mga0a205_3570_c1_9907_10776 275
465 3300061734 Ga0530510_0112172 Ga0530510_0112172_1075_1944 275
466 3300005331 Ga0070670_100098452 Ga0070670_1000984522 276
467 3300005331 Ga0070670_100166975 Ga0070670_1001669752 276
468 3300005334 Ga0068869_100133284 Ga0068869_1001332842 276
469 3300005336 Ga0070680_100082831 Ga0070680_1000828312 276
470 3300005345 Ga0070692_10118551 Ga0070692_101185512 276
471 3300005455 Ga0070663_100062582 Ga0070663_1000625822 276
472 3300005546 Ga0070696_100063729 Ga0070696_1000637292 276
473 3300005577 Ga0068857_100113906 Ga0068857_1001139062 276
474 3300005617 Ga0068859_100034852 Ga0068859_1000348523 276
475 3300006846 Ga0075430_100021532 Ga0075430_1000215324 276
476 3300006931 Ga0097620_100034852 Ga0097620_1000348522 276
477 3300009093 Ga0105240_10017559 Ga0105240_100175598 276
478 3300009101 Ga0105247_10017168 Ga0105247_100171683 276
479 3300009148 Ga0105243_10229159 Ga0105243_102291592 276
480 3300009174 Ga0105241_10050931 Ga0105241_100509312 276
481 3300009174 Ga0105241_10149270 Ga0105241_101492702 276
482 3300013104 Ga0157370_10167458 Ga0157370_101674582 276
483 3300013105 Ga0157369_10002831 Ga0157369_100028311 276
484 3300013307 Ga0157372_10385642 Ga0157372_103856422 276
485 3300014325 Ga0163163_10114033 Ga0163163_101140332 276
486 3300025901 Ga0207688_10019224 Ga0207688_100192242 276
487 3300025908 Ga0207643_10047240 Ga0207643_100472402 276
488 3300025911 Ga0207654_10070263 Ga0207654_100702631 276
489 3300025919 Ga0207657_10022419 Ga0207657_100224194 276
490 3300025921 Ga0207652_10320551 Ga0207652_103205512 276
491 3300025924 Ga0207694_10022358 Ga0207694_100223583 276
492 3300025927 Ga0207687_10153040 Ga0207687_101530402 276
493 3300025942 Ga0207689_10009573 Ga0207689_100095732 276
494 3300025981 Ga0207640_10418639 Ga0207640_104186391 276
495 3300026067 Ga0207678_10000797 Ga0207678_100007979 276
496 3300026078 Ga0207702_10073673 Ga0207702_100736732 276
497 3300026095 Ga0207676_10097972 Ga0207676_100979722 276
498 3300027614 Ga0209970_1008636 Ga0209970_10086362 276
499 3300031344 Ga0265316_10083565 Ga0265316_100835652 276
500 3300032002 Ga0307416_100534844 Ga0307416_1005348442 276
501 3300042156 Ga0439446_0036701 Ga0439446_0036701_347_1222 276
502 3300045051 Ga0451576_0143917 Ga0451576_0143917_1322_2197 276
503 3300045976 Ga0466967_0512990 Ga0466967_0512990_52_969 276
504 3300046474 Ga0495605_0038636 Ga0495605_0038636_1313_2188 276
505 3300046642 Ga0495634_0141893 Ga0495634_0141893_86_958 276
506 3300046674 Ga0495588_0091117 Ga0495588_0091117_32_907 276
507 3300049570 Ga0501033_0104094 Ga0501033_0104094_718_1590 276
508 3300049571 Ga0501034_0219609 Ga0501034_0219609_637_1509 276
509 3300049573 Ga0501037_0030270 Ga0501037_0030270_1004_1876 276
510 3300049574 Ga0501038_0018785 Ga0501038_0018785_1176_2048 276
511 3300049575 Ga0501039_0034728 Ga0501039_0034728_135_1010 276
512 3300049588 Ga0501072_0159215 Ga0501072_0159215_374_1246 276
513 3300049592 Ga0501076_0168335 Ga0501076_0168335_527_1402 276
514 3300049741 Ga0501079_0100210 Ga0501079_0100210_769_1641 276
515 3300049742 Ga0501080_0025403 Ga0501080_0025403_3695_4567 276
516 3300049823 Ga0501044_0013470 Ga0501044_0013470_4274_5146 276
517 3300049824 Ga0501045_0014711 Ga0501045_0014711_2271_3146 276
518 3300050509 nmdc:mga0qj67_135341_c1 nmdc:mga0qj67_135341_c1_855_1727 276
519 3300050510 nmdc:mga06r32_10136_c2 nmdc:mga06r32_10136_c2_10_882 276
520 3300050514 nmdc:mga08x19_91732_c1 nmdc:mga08x19_91732_c1_467_1339 276
521 3300060353 Ga0501082_0184640 Ga0501082_0184640_432_1304 276
522 3300060353 Ga0501082_0229799 Ga0501082_0229799_356_1228 276
523 3300003771 Ga0055526_1023825 Ga0055526_10238252 277
524 3300003773 Ga0055537_1000780 Ga0055537_10007808 277
525 3300003784 Ga0055534_1000394 Ga0055534_10003947 277
526 3300006051 Ga0075364_10131018 Ga0075364_101310182 277
527 3300025263 Ga0209565_1000426 Ga0209565_100042623 277
528 3300025291 Ga0209675_1000426 Ga0209675_10004268 277
529 3300025294 Ga0209025_1001800 Ga0209025_10018003 277
530 3300025295 Ga0209564_1004730 Ga0209564_10047308 277
531 3300025297 Ga0209758_1015363 Ga0209758_10153632 277
532 3300025299 Ga0209256_1003493 Ga0209256_10034938 277
533 3300050491 nmdc:mga00v17_158968_c1 nmdc:mga00v17_158968_c1_59_934 277
534 3300003187 JGI25151J46595_10002159 JGI25151J46595_100021592 278
535 3300003187 JGI25151J46595_10013441 JGI25151J46595_100134413 278
536 3300003751 Ga0055538_1000141 Ga0055538_100014115 278
537 3300003752 Ga0055539_1000192 Ga0055539_100019215 278
538 3300003756 Ga0055533_1000192 Ga0055533_100019215 278
539 3300003759 Ga0055525_1000260 Ga0055525_100026035 278
540 3300003775 Ga0055524_1001799 Ga0055524_10017993 278
541 3300003841 Ga0055541_1000127 Ga0055541_100012715 278
542 3300005563 Ga0068855_100047077 Ga0068855_1000470775 278
543 3300005577 Ga0068857_100299946 Ga0068857_1002999462 278
544 3300009093 Ga0105240_10030486 Ga0105240_100304862 278
545 3300009545 Ga0105237_10021166 Ga0105237_100211666 278
546 3300009545 Ga0105237_10581476 Ga0105237_105814761 278
547 3300009551 Ga0105238_10000006 Ga0105238_10000006237 278
548 3300010375 Ga0105239_10002999 Ga0105239_100029999 278
549 3300015261 Ga0182006_1001498 Ga0182006_10014985 278
550 3300021361 Ga0213872_10018675 Ga0213872_100186752 278
551 3300025224 Ga0209784_100009 Ga0209784_100009529 278
552 3300025225 Ga0209566_100007 Ga0209566_100007529 278
553 3300025226 Ga0209674_100018 Ga0209674_100018529 278
554 3300025230 Ga0209563_100020 Ga0209563_100020529 278
555 3300025253 Ga0209677_100010 Ga0209677_100010529 278
556 3300025284 Ga0209130_1009566 Ga0209130_10095662 278
557 3300025294 Ga0209025_1000019 Ga0209025_1000019188 278
558 3300025298 Ga0209050_1026989 Ga0209050_10269892 278
559 3300025304 Ga0209257_1011872 Ga0209257_10118722 278
560 3300025321 Ga0207656_10085700 Ga0207656_100857001 278
561 3300025913 Ga0207695_10002139 Ga0207695_1000213915 278
562 3300025914 Ga0207671_10009496 Ga0207671_100094962 278
563 3300025924 Ga0207694_10000110 Ga0207694_1000011048 278
564 3300025949 Ga0207667_10016670 Ga0207667_100166708 278
565 3300026116 Ga0207674_10235166 Ga0207674_102351663 278
566 3300027614 Ga0209970_1000507 Ga0209970_10005073 278
567 3300028794 Ga0307515_10095051 Ga0307515_100950512 278
568 3300033180 Ga0307510_10037495 Ga0307510_100374954 278
569 3300039447 Ga0436361_0168918 Ga0436361_0168918_1461_2339 278
570 3300042004 Ga0439445_0012060 Ga0439445_0012060_797_1675 278
571 3300042115 Ga0450911_000322 Ga0450911_000322_5235_6113 278
572 3300046530 Ga0495654_0003050 Ga0495654_0003050_4951_5829 278
573 3300047472 Ga0495686_0124868 Ga0495686_0124868_299_1177 278
574 3300048924 Ga0496121_0004161 Ga0496121_0004161_5069_5947 278
575 3300048928 Ga0496125_0022455 Ga0496125_0022455_4170_5048 278
576 3300048928 Ga0496125_0029702 Ga0496125_0029702_388_1266 278
577 3300053088 Ga0500644_0027330 Ga0500644_0027330_91_969 278
578 3300053088 Ga0500644_0044142 Ga0500644_0044142_393_1271 278
579 3300053108 Ga0500562_002948 Ga0500562_002948_714_1592 278
580 3300053118 Ga0500594_0011571 Ga0500594_0011571_653_1531 278
581 3300053136 Ga0500559_0000047 Ga0500559_0000047_94187_95065 278
582 3300053145 Ga0500586_051960 Ga0500586_051960_431_1309 278
583 3300053156 Ga0500622_0006088 Ga0500622_0006088_496_1374 278
584 iso_pu_bacteria 2904439833 2904443338 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

23

293

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.568 5 261
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5412 1 263
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5362 4 263
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5324 4 264
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5272 1 263
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7946 7 261 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7867 10 261 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7697 7 260 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7664 7 262 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.758 10 260 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A6I7PDL1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8683 4 271 GO:0005886
GO:0006865
GO:0022857
AF-A0A7V9JNY4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.868 3 265 GO:0005886
GO:0006865
GO:0022857
AF-A0A1M3NRV2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8576 3 268 GO:0005886
GO:0006865
GO:0022857
AF-A0A1N7CM48-F1-model_v4 Branched-chain amino acid transport system permease protein 0.8571 2 265 GO:0005886
GO:0006865
GO:0022857
AF-A0A7C8EH00-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8559 2 268 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
79.78 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map