F466365
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 382 | 542 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300015261|Ga0182006_1001498|Ga0182006_10014985 |
| Length | 309 |
| Sequence | MRRRCLHERAGWRQENAMLLLSALISGFGLGSMYGLMALGFYMTYAVSGTVNFAQGSSMMLGAVLCFTFAQTLGWPMWLAIVLALAACALYGMLVEVLAVRPFARQGSNAWLMSTVALGIVLDNLVMHTFGKEPRSLPSPLALSSIELGGMGLGVYPLHLLIPAIGLALAALLHTISRRTRWGTALLAVVQNRDAARLMGIPITRAIAVAFALSTLLAGVAGVLIAPLFNVNADMGTLFGLKAFAVAILGGITSAWGVMIAGLLFGMAEALITATLGSGYTQIITFALVIVVLAIRPNGLFGRAQVKKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 7 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 8 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 9 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 10 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 11 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 12 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 13 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 14 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 15 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 16 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 17 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 18 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 19 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 20 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 21 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 22 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 23 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 24 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 25 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 26 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 27 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 28 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 29 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 30 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 31 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 32 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 33 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 34 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 35 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 36 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 37 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 38 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 39 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 40 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 124 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 267 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 268 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 269 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 270 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 273 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 274 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 275 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 376 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 382 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.47 |
| Metatranscriptomes | 0.34 |
| Isolates | 7.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.76 |
| Nodule | 1.37 |
| Rhizoplane | 2.91 |
| Rhizosphere | 76.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10002159 | 3300003187 | Bacteria | 12187 |
| 2 | JGI25151J46595_10002298 | 3300003187 | Bacteria | 11678 |
| 3 | JGI25151J46595_10013441 | 3300003187 | Bacteria | 3683 |
| 4 | JGI25151J46595_10049929 | 3300003187 | Bacteria | 1430 |
| 5 | JGI25406J46586_10047422 | 3300003203 | Bacteria | 1464 |
| 6 | rootL2_10157044 | 3300003322 | Bacteria | 2369 |
| 7 | Ga0055538_1000141 | 3300003751 | Bacteria | 50563 |
| 8 | Ga0055539_1000192 | 3300003752 | Bacteria | 50563 |
| 9 | Ga0055533_1000192 | 3300003756 | Bacteria | 50563 |
| 10 | Ga0055525_1000260 | 3300003759 | Bacteria | 50563 |
| 11 | Ga0055526_1023825 | 3300003771 | Bacteria | 2028 |
| 12 | Ga0055537_1000780 | 3300003773 | Bacteria | 16027 |
| 13 | Ga0055524_1001799 | 3300003775 | Bacteria | 11752 |
| 14 | Ga0055524_1008162 | 3300003775 | Bacteria | 4375 |
| 15 | Ga0055536_1000677 | 3300003781 | Bacteria | 22946 |
| 16 | Ga0055534_1000394 | 3300003784 | Bacteria | 27123 |
| 17 | Ga0055534_1000985 | 3300003784 | Bacteria | 12573 |
| 18 | Ga0055541_1000127 | 3300003841 | Bacteria | 50563 |
| 19 | Ga0070658_10099862 | 3300005327 | Bacteria | 2398 |
| 20 | Ga0070683_100059947 | 3300005329 | Bacteria | 3536 |
| 21 | Ga0070683_100071598 | 3300005329 | Bacteria | 3235 |
| 22 | Ga0070690_100001504 | 3300005330 | Bacteria | 12202 |
| 23 | Ga0070690_100064341 | 3300005330 | Bacteria | 2369 |
| 24 | Ga0070670_100071860 | 3300005331 | Bacteria | 2971 |
| 25 | Ga0070670_100098452 | 3300005331 | Bacteria | 2516 |
| 26 | Ga0070670_100166975 | 3300005331 | Bacteria | 1909 |
| 27 | Ga0068869_100001561 | 3300005334 | Bacteria | 13604 |
| 28 | Ga0068869_100070709 | 3300005334 | Bacteria | 2583 |
| 29 | Ga0068869_100133284 | 3300005334 | Bacteria | 1912 |
| 30 | Ga0068869_100515595 | 3300005334 | Bacteria | 1000 |
| 31 | Ga0070680_100001721 | 3300005336 | Bacteria | 16063 |
| 32 | Ga0070680_100082831 | 3300005336 | Bacteria | 2649 |
| 33 | Ga0070682_100005629 | 3300005337 | Bacteria | 6984 |
| 34 | Ga0070682_100079571 | 3300005337 | Bacteria | 2117 |
| 35 | Ga0068868_100001141 | 3300005338 | Bacteria | 18157 |
| 36 | Ga0070660_100045969 | 3300005339 | Bacteria | 3345 |
| 37 | Ga0070660_100098691 | 3300005339 | Bacteria | 2312 |
| 38 | Ga0070660_100174956 | 3300005339 | Bacteria | 1735 |
| 39 | Ga0070691_10000844 | 3300005341 | Bacteria | 12377 |
| 40 | Ga0070687_100000316 | 3300005343 | Bacteria | 16392 |
| 41 | Ga0070661_100105142 | 3300005344 | Bacteria | 2104 |
| 42 | Ga0070692_10003111 | 3300005345 | Bacteria | 6649 |
| 43 | Ga0070692_10118551 | 3300005345 | Bacteria | 1473 |
| 44 | Ga0070675_100059881 | 3300005354 | Bacteria | 3143 |
| 45 | Ga0070675_100266311 | 3300005354 | Bacteria | 1503 |
| 46 | Ga0070671_100092729 | 3300005355 | Bacteria | 2531 |
| 47 | Ga0070673_100136273 | 3300005364 | Bacteria | 2067 |
| 48 | Ga0070673_100400962 | 3300005364 | Bacteria | 1227 |
| 49 | Ga0070659_100005229 | 3300005366 | Bacteria | 9312 |
| 50 | Ga0070659_100093847 | 3300005366 | Bacteria | 2409 |
| 51 | Ga0070703_10007083 | 3300005406 | Bacteria | 3145 |
| 52 | Ga0070703_10031739 | 3300005406 | Bacteria | 1600 |
| 53 | Ga0070714_100185199 | 3300005435 | Bacteria | 1897 |
| 54 | Ga0070713_100028911 | 3300005436 | Bacteria | 4381 |
| 55 | Ga0070701_10006445 | 3300005438 | Bacteria | 4940 |
| 56 | Ga0070705_100001322 | 3300005440 | Bacteria | 13267 |
| 57 | Ga0070700_100044814 | 3300005441 | Bacteria | 2726 |
| 58 | Ga0070700_100338278 | 3300005441 | Bacteria | 1112 |
| 59 | Ga0070694_100000228 | 3300005444 | Bacteria | 29562 |
| 60 | Ga0070708_100258455 | 3300005445 | Bacteria | 1637 |
| 61 | Ga0070663_100062582 | 3300005455 | Bacteria | 2683 |
| 62 | Ga0070681_10002377 | 3300005458 | Bacteria | 17189 |
| 63 | Ga0070681_10002557 | 3300005458 | Bacteria | 16703 |
| 64 | Ga0068867_100004278 | 3300005459 | Bacteria | 10046 |
| 65 | Ga0068867_100092301 | 3300005459 | Bacteria | 2299 |
| 66 | Ga0070707_100127737 | 3300005468 | Bacteria | 2470 |
| 67 | Ga0070699_100000829 | 3300005518 | Bacteria | 28653 |
| 68 | Ga0070699_100233520 | 3300005518 | Bacteria | 1640 |
| 69 | Ga0070679_100015857 | 3300005530 | Bacteria | 7252 |
| 70 | Ga0070684_100003238 | 3300005535 | Bacteria | 12177 |
| 71 | Ga0070697_100016288 | 3300005536 | Bacteria | 5846 |
| 72 | Ga0070697_100203198 | 3300005536 | Bacteria | 1684 |
| 73 | Ga0068853_100028827 | 3300005539 | Bacteria | 4672 |
| 74 | Ga0070686_100001157 | 3300005544 | Bacteria | 15083 |
| 75 | Ga0070686_100004065 | 3300005544 | Bacteria | 8045 |
| 76 | Ga0070695_100000946 | 3300005545 | Bacteria | 15751 |
| 77 | Ga0070695_100011344 | 3300005545 | Bacteria | 5331 |
| 78 | Ga0070695_100108288 | 3300005545 | Bacteria | 1881 |
| 79 | Ga0070695_100309597 | 3300005545 | Bacteria | 1170 |
| 80 | Ga0070696_100001500 | 3300005546 | Bacteria | 15319 |
| 81 | Ga0070696_100002309 | 3300005546 | Bacteria | 12582 |
| 82 | Ga0070696_100063729 | 3300005546 | Bacteria | 2582 |
| 83 | Ga0070693_100000451 | 3300005547 | Bacteria | 18498 |
| 84 | Ga0070693_100143976 | 3300005547 | Bacteria | 1503 |
| 85 | Ga0070704_100001349 | 3300005549 | Bacteria | 13010 |
| 86 | Ga0070704_100426466 | 3300005549 | Bacteria | 1137 |
| 87 | Ga0068855_100003762 | 3300005563 | Bacteria | 18547 |
| 88 | Ga0068855_100007207 | 3300005563 | Bacteria | 13495 |
| 89 | Ga0068855_100047077 | 3300005563 | Bacteria | 5096 |
| 90 | Ga0068855_100244551 | 3300005563 | Bacteria | 2003 |
| 91 | Ga0068855_100619389 | 3300005563 | Bacteria | 1165 |
| 92 | Ga0070664_100041171 | 3300005564 | Bacteria | 3897 |
| 93 | Ga0068857_100113906 | 3300005577 | Bacteria | 2432 |
| 94 | Ga0068857_100299946 | 3300005577 | Bacteria | 1481 |
| 95 | Ga0068854_100008150 | 3300005578 | Bacteria | 6720 |
| 96 | Ga0068854_100013003 | 3300005578 | Bacteria | 5455 |
| 97 | Ga0068856_100006230 | 3300005614 | Bacteria | 11706 |
| 98 | Ga0068856_100068929 | 3300005614 | Bacteria | 3497 |
| 99 | Ga0068856_100110677 | 3300005614 | Bacteria | 2743 |
| 100 | Ga0070702_100000148 | 3300005615 | Bacteria | 21963 |
| 101 | Ga0070702_100008100 | 3300005615 | Bacteria | 5076 |
| 102 | Ga0068852_100023753 | 3300005616 | Bacteria | 4942 |
| 103 | Ga0068852_100063710 | 3300005616 | Bacteria | 3211 |
| 104 | Ga0068859_100002466 | 3300005617 | Bacteria | 18828 |
| 105 | Ga0068859_100034852 | 3300005617 | Bacteria | 5050 |
| 106 | Ga0068866_10000302 | 3300005718 | Bacteria | 23469 |
| 107 | Ga0068861_100002875 | 3300005719 | Bacteria | 11344 |
| 108 | Ga0068851_10018633 | 3300005834 | Bacteria | 3346 |
| 109 | Ga0068863_100326532 | 3300005841 | Bacteria | 1491 |
| 110 | Ga0068858_100004157 | 3300005842 | Bacteria | 14242 |
| 111 | Ga0068860_100008220 | 3300005843 | Bacteria | 10386 |
| 112 | Ga0068862_100004540 | 3300005844 | Bacteria | 11702 |
| 113 | Ga0068862_100005219 | 3300005844 | Bacteria | 10912 |
| 114 | Ga0068862_100270969 | 3300005844 | Bacteria | 1552 |
| 115 | Ga0081539_10003560 | 3300005985 | Bacteria | 18916 |
| 116 | Ga0075364_10131018 | 3300006051 | Bacteria | 1683 |
| 117 | Ga0070716_100049998 | 3300006173 | Bacteria | 2371 |
| 118 | Ga0070712_100022470 | 3300006175 | Bacteria | 4156 |
| 119 | Ga0070712_100273914 | 3300006175 | Bacteria | 1357 |
| 120 | Ga0097621_100003364 | 3300006237 | Bacteria | 11005 |
| 121 | Ga0097621_100004313 | 3300006237 | Bacteria | 9881 |
| 122 | Ga0068871_100001348 | 3300006358 | Bacteria | 16432 |
| 123 | Ga0068871_100008335 | 3300006358 | Bacteria | 7451 |
| 124 | Ga0075428_100001160 | 3300006844 | Bacteria | 28222 |
| 125 | Ga0075428_100049725 | 3300006844 | Bacteria | 4600 |
| 126 | Ga0075428_100213419 | 3300006844 | Bacteria | 2085 |
| 127 | Ga0075430_100021532 | 3300006846 | Bacteria | 5479 |
| 128 | Ga0075430_100125335 | 3300006846 | Bacteria | 2141 |
| 129 | Ga0075431_100003002 | 3300006847 | Bacteria | 16325 |
| 130 | Ga0075431_100434518 | 3300006847 | Bacteria | 1310 |
| 131 | Ga0075433_10078004 | 3300006852 | Bacteria | 2919 |
| 132 | Ga0075433_10223715 | 3300006852 | Bacteria | 1671 |
| 133 | Ga0075434_100005264 | 3300006871 | Bacteria | 11759 |
| 134 | Ga0075434_100229925 | 3300006871 | Bacteria | 1874 |
| 135 | Ga0075429_100000076 | 3300006880 | Bacteria | 49832 |
| 136 | Ga0075429_100000107 | 3300006880 | Bacteria | 47068 |
| 137 | Ga0068865_100001770 | 3300006881 | Bacteria | 12679 |
| 138 | Ga0075436_100003398 | 3300006914 | Bacteria | 10909 |
| 139 | Ga0097620_100002466 | 3300006931 | Bacteria | 18828 |
| 140 | Ga0097620_100034852 | 3300006931 | Bacteria | 5050 |
| 141 | Ga0079104_1016099 | 3300006946 | Bacteria | 2196 |
| 142 | Ga0099826_10000113 | 3300006948 | Bacteria | 36930 |
| 143 | Ga0075435_100324503 | 3300007076 | Bacteria | 1318 |
| 144 | Ga0099794_10012552 | 3300007265 | Bacteria | 3660 |
| 145 | Ga0105251_10057914 | 3300009011 | Bacteria | 1830 |
| 146 | Ga0105240_10002050 | 3300009093 | Bacteria | 33144 |
| 147 | Ga0105240_10006656 | 3300009093 | Bacteria | 16948 |
| 148 | Ga0105240_10017559 | 3300009093 | Bacteria | 9640 |
| 149 | Ga0105240_10030486 | 3300009093 | Bacteria | 7010 |
| 150 | Ga0111539_10018489 | 3300009094 | Bacteria | 8632 |
| 151 | Ga0111539_10059054 | 3300009094 | Bacteria | 4550 |
| 152 | Ga0111539_10070243 | 3300009094 | Bacteria | 4134 |
| 153 | Ga0111539_10399916 | 3300009094 | Bacteria | 1600 |
| 154 | Ga0105245_10001017 | 3300009098 | Bacteria | 25471 |
| 155 | Ga0105247_10017168 | 3300009101 | Bacteria | 4344 |
| 156 | Ga0114129_10000791 | 3300009147 | Bacteria | 40561 |
| 157 | Ga0114129_10023386 | 3300009147 | Bacteria | 8762 |
| 158 | Ga0105243_10002797 | 3300009148 | Bacteria | 14482 |
| 159 | Ga0105243_10002935 | 3300009148 | Bacteria | 14105 |
| 160 | Ga0105243_10229159 | 3300009148 | Bacteria | 1647 |
| 161 | Ga0105241_10050931 | 3300009174 | Bacteria | 3157 |
| 162 | Ga0105241_10149270 | 3300009174 | Bacteria | 1911 |
| 163 | Ga0105242_10001715 | 3300009176 | Bacteria | 17307 |
| 164 | Ga0105248_10139969 | 3300009177 | Bacteria | 2730 |
| 165 | Ga0105248_10245441 | 3300009177 | Bacteria | 2016 |
| 166 | Ga0105237_10021166 | 3300009545 | Bacteria | 6689 |
| 167 | Ga0105237_10581476 | 3300009545 | Bacteria | 1127 |
| 168 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 169 | Ga0105238_10019514 | 3300009551 | Bacteria | 6904 |
| 170 | Ga0105238_10189172 | 3300009551 | Bacteria | 2035 |
| 171 | Ga0105249_10004241 | 3300009553 | Bacteria | 12400 |
| 172 | Ga0105239_10002999 | 3300010375 | Bacteria | 21046 |
| 173 | Ga0105246_10180676 | 3300011119 | Bacteria | 1624 |
| 174 | Ga0157370_10167458 | 3300013104 | Bacteria | 2043 |
| 175 | Ga0157370_10555118 | 3300013104 | Bacteria | 1053 |
| 176 | Ga0157369_10002831 | 3300013105 | Bacteria | 20703 |
| 177 | Ga0157369_10123443 | 3300013105 | Bacteria | 2747 |
| 178 | Ga0157378_10003629 | 3300013297 | Bacteria | 13658 |
| 179 | Ga0163162_10165328 | 3300013306 | Bacteria | 2336 |
| 180 | Ga0157372_10042798 | 3300013307 | Bacteria | 5011 |
| 181 | Ga0157372_10385642 | 3300013307 | Bacteria | 1633 |
| 182 | Ga0163163_10114033 | 3300014325 | Bacteria | 2733 |
| 183 | Ga0157380_10478944 | 3300014326 | Bacteria | 1203 |
| 184 | Ga0182008_10024181 | 3300014497 | Bacteria | 3095 |
| 185 | Ga0157379_10290581 | 3300014968 | Bacteria | 1489 |
| 186 | Ga0157376_10001701 | 3300014969 | Bacteria | 14639 |
| 187 | Ga0157376_10032509 | 3300014969 | Bacteria | 4190 |
| 188 | Ga0182006_1001498 | 3300015261 | Bacteria | 14002 |
| 189 | Ga0206353_10776176 | 3300020082 | Bacteria | 2166 |
| 190 | Ga0213872_10018675 | 3300021361 | Bacteria | 3195 |
| 191 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 192 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 193 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 194 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 195 | Ga0209437_100117 | 3300025233 | Bacteria | 209271 |
| 196 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 197 | Ga0209565_1000426 | 3300025263 | Bacteria | 34052 |
| 198 | Ga0209130_1009566 | 3300025284 | Bacteria | 2747 |
| 199 | Ga0209130_1012022 | 3300025284 | Bacteria | 2287 |
| 200 | Ga0209675_1000174 | 3300025291 | Bacteria | 74594 |
| 201 | Ga0209675_1000426 | 3300025291 | Bacteria | 34022 |
| 202 | Ga0209676_1001413 | 3300025292 | Bacteria | 22998 |
| 203 | Ga0209676_1003226 | 3300025292 | Bacteria | 10303 |
| 204 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 205 | Ga0209025_1001481 | 3300025294 | Bacteria | 30488 |
| 206 | Ga0209025_1001800 | 3300025294 | Bacteria | 25408 |
| 207 | Ga0209025_1002021 | 3300025294 | Bacteria | 23150 |
| 208 | Ga0209564_1000145 | 3300025295 | Bacteria | 175251 |
| 209 | Ga0209564_1001261 | 3300025295 | Bacteria | 27868 |
| 210 | Ga0209564_1004730 | 3300025295 | Bacteria | 8150 |
| 211 | Ga0209758_1015363 | 3300025297 | Bacteria | 3972 |
| 212 | Ga0209050_1004102 | 3300025298 | Bacteria | 10172 |
| 213 | Ga0209050_1026989 | 3300025298 | Bacteria | 1906 |
| 214 | Ga0209256_1000492 | 3300025299 | Bacteria | 58194 |
| 215 | Ga0209256_1003493 | 3300025299 | Bacteria | 10955 |
| 216 | Ga0209051_1004307 | 3300025303 | Bacteria | 8838 |
| 217 | Ga0209051_1024873 | 3300025303 | Bacteria | 2452 |
| 218 | Ga0209257_1011872 | 3300025304 | Bacteria | 4119 |
| 219 | Ga0207656_10085700 | 3300025321 | Bacteria | 1423 |
| 220 | Ga0207653_10010080 | 3300025885 | Bacteria | 2947 |
| 221 | Ga0207653_10071177 | 3300025885 | Bacteria | 1189 |
| 222 | Ga0207642_10001745 | 3300025899 | Bacteria | 6709 |
| 223 | Ga0207688_10019224 | 3300025901 | Bacteria | 3719 |
| 224 | Ga0207688_10161244 | 3300025901 | Bacteria | 1330 |
| 225 | Ga0207699_10139104 | 3300025906 | Bacteria | 1594 |
| 226 | Ga0207645_10040099 | 3300025907 | Bacteria | 2999 |
| 227 | Ga0207645_10103419 | 3300025907 | Bacteria | 1839 |
| 228 | Ga0207643_10031169 | 3300025908 | Bacteria | 2971 |
| 229 | Ga0207643_10047240 | 3300025908 | Bacteria | 2435 |
| 230 | Ga0207705_10042785 | 3300025909 | Bacteria | 3252 |
| 231 | Ga0207684_10048246 | 3300025910 | Bacteria | 3611 |
| 232 | Ga0207654_10070263 | 3300025911 | Bacteria | 2078 |
| 233 | Ga0207707_10034183 | 3300025912 | Bacteria | 4448 |
| 234 | Ga0207707_10054809 | 3300025912 | Bacteria | 3470 |
| 235 | Ga0207695_10002139 | 3300025913 | Bacteria | 29918 |
| 236 | Ga0207695_10004925 | 3300025913 | Bacteria | 17994 |
| 237 | Ga0207695_10168650 | 3300025913 | Bacteria | 2116 |
| 238 | Ga0207671_10009496 | 3300025914 | Bacteria | 8125 |
| 239 | Ga0207693_10006637 | 3300025915 | Bacteria | 9561 |
| 240 | Ga0207693_10014590 | 3300025915 | Bacteria | 6314 |
| 241 | Ga0207660_10021266 | 3300025917 | Bacteria | 4362 |
| 242 | Ga0207660_10173286 | 3300025917 | Bacteria | 1671 |
| 243 | Ga0207662_10000479 | 3300025918 | Bacteria | 17918 |
| 244 | Ga0207657_10000160 | 3300025919 | Bacteria | 69252 |
| 245 | Ga0207657_10022419 | 3300025919 | Bacteria | 5908 |
| 246 | Ga0207657_10057520 | 3300025919 | Bacteria | 3351 |
| 247 | Ga0207657_10087235 | 3300025919 | Bacteria | 2611 |
| 248 | Ga0207649_10009821 | 3300025920 | Bacteria | 5244 |
| 249 | Ga0207652_10113919 | 3300025921 | Bacteria | 2400 |
| 250 | Ga0207652_10320551 | 3300025921 | Bacteria | 1399 |
| 251 | Ga0207646_10203529 | 3300025922 | Bacteria | 1788 |
| 252 | Ga0207681_10001355 | 3300025923 | Bacteria | 15822 |
| 253 | Ga0207694_10000110 | 3300025924 | Bacteria | 85854 |
| 254 | Ga0207694_10022358 | 3300025924 | Bacteria | 4796 |
| 255 | Ga0207650_10136566 | 3300025925 | Bacteria | 1924 |
| 256 | Ga0207650_10499486 | 3300025925 | Bacteria | 1016 |
| 257 | Ga0207659_10133119 | 3300025926 | Bacteria | 1922 |
| 258 | Ga0207687_10001010 | 3300025927 | Bacteria | 19091 |
| 259 | Ga0207687_10153040 | 3300025927 | Bacteria | 1762 |
| 260 | Ga0207664_10040242 | 3300025929 | Bacteria | 3633 |
| 261 | Ga0207664_10096151 | 3300025929 | Bacteria | 2438 |
| 262 | Ga0207686_10002110 | 3300025934 | Bacteria | 10953 |
| 263 | Ga0207709_10000532 | 3300025935 | Bacteria | 32789 |
| 264 | Ga0207709_10013646 | 3300025935 | Bacteria | 4482 |
| 265 | Ga0207670_10034477 | 3300025936 | Bacteria | 3271 |
| 266 | Ga0207704_10003136 | 3300025938 | Bacteria | 7477 |
| 267 | Ga0207704_10024596 | 3300025938 | Bacteria | 3270 |
| 268 | Ga0207665_10015991 | 3300025939 | Bacteria | 4927 |
| 269 | Ga0207691_10268888 | 3300025940 | Bacteria | 1468 |
| 270 | Ga0207711_10263704 | 3300025941 | Bacteria | 1584 |
| 271 | Ga0207689_10001100 | 3300025942 | Bacteria | 26064 |
| 272 | Ga0207689_10009573 | 3300025942 | Bacteria | 8356 |
| 273 | Ga0207661_10040466 | 3300025944 | Bacteria | 3664 |
| 274 | Ga0207679_10132301 | 3300025945 | Bacteria | 2003 |
| 275 | Ga0207679_10294947 | 3300025945 | Bacteria | 1395 |
| 276 | Ga0207667_10001999 | 3300025949 | Bacteria | 25585 |
| 277 | Ga0207667_10006563 | 3300025949 | Bacteria | 14075 |
| 278 | Ga0207667_10011796 | 3300025949 | Bacteria | 10124 |
| 279 | Ga0207667_10016670 | 3300025949 | Bacteria | 8292 |
| 280 | Ga0207667_10205159 | 3300025949 | Bacteria | 2021 |
| 281 | Ga0207651_10069988 | 3300025960 | Bacteria | 2480 |
| 282 | Ga0207712_10006700 | 3300025961 | Bacteria | 7261 |
| 283 | Ga0207668_10038805 | 3300025972 | Bacteria | 3200 |
| 284 | Ga0207640_10013112 | 3300025981 | Bacteria | 4742 |
| 285 | Ga0207640_10088830 | 3300025981 | Bacteria | 2135 |
| 286 | Ga0207640_10418639 | 3300025981 | Bacteria | 1096 |
| 287 | Ga0207677_10002179 | 3300026023 | Bacteria | 10295 |
| 288 | Ga0207703_10018088 | 3300026035 | Bacteria | 5504 |
| 289 | Ga0207639_10015120 | 3300026041 | Bacteria | 5438 |
| 290 | Ga0207639_10246441 | 3300026041 | Bacteria | 1556 |
| 291 | Ga0207678_10000797 | 3300026067 | Bacteria | 28895 |
| 292 | Ga0207708_10001959 | 3300026075 | Bacteria | 15185 |
| 293 | Ga0207702_10023862 | 3300026078 | Bacteria | 5074 |
| 294 | Ga0207702_10073673 | 3300026078 | Bacteria | 2945 |
| 295 | Ga0207702_10112572 | 3300026078 | Bacteria | 2422 |
| 296 | Ga0207702_10165389 | 3300026078 | Bacteria | 2023 |
| 297 | Ga0207648_10001964 | 3300026089 | Bacteria | 22482 |
| 298 | Ga0207648_10012950 | 3300026089 | Bacteria | 7790 |
| 299 | Ga0207676_10097972 | 3300026095 | Bacteria | 2423 |
| 300 | Ga0207674_10000236 | 3300026116 | Bacteria | 68955 |
| 301 | Ga0207674_10235166 | 3300026116 | Bacteria | 1780 |
| 302 | Ga0207675_100000089 | 3300026118 | Bacteria | 71258 |
| 303 | Ga0207675_100020378 | 3300026118 | Bacteria | 6181 |
| 304 | Ga0207698_10026389 | 3300026142 | Bacteria | 4109 |
| 305 | Ga0207698_10049484 | 3300026142 | Bacteria | 3199 |
| 306 | Ga0207698_10054538 | 3300026142 | Bacteria | 3076 |
| 307 | Ga0209970_1000507 | 3300027614 | Bacteria | 6685 |
| 308 | Ga0209970_1008636 | 3300027614 | Bacteria | 1669 |
| 309 | Ga0209282_1000165 | 3300027666 | Bacteria | 37517 |
| 310 | Ga0209588_1032236 | 3300027671 | Bacteria | 1678 |
| 311 | Ga0209971_1011152 | 3300027682 | Bacteria | 2129 |
| 312 | Ga0209966_1005180 | 3300027695 | Bacteria | 2231 |
| 313 | Ga0209974_10019543 | 3300027876 | Bacteria | 2246 |
| 314 | Ga0207428_10001985 | 3300027907 | Bacteria | 20758 |
| 315 | Ga0207428_10198484 | 3300027907 | Bacteria | 1510 |
| 316 | Ga0268265_10002203 | 3300028380 | Bacteria | 15024 |
| 317 | Ga0268265_10008737 | 3300028380 | Bacteria | 6848 |
| 318 | Ga0268265_10280955 | 3300028380 | Bacteria | 1489 |
| 319 | Ga0268264_10003987 | 3300028381 | Bacteria | 12640 |
| 320 | Ga0307515_10095051 | 3300028794 | Bacteria | 3673 |
| 321 | Ga0265760_10014928 | 3300031090 | Bacteria | 2227 |
| 322 | Ga0265316_10083565 | 3300031344 | Bacteria | 2446 |
| 323 | Ga0307513_10117289 | 3300031456 | Bacteria | 2640 |
| 324 | Ga0307408_100119558 | 3300031548 | Bacteria | 2039 |
| 325 | Ga0307405_10279474 | 3300031731 | Bacteria | 1256 |
| 326 | Ga0307412_10000106 | 3300031911 | Bacteria | 67067 |
| 327 | Ga0307416_100063467 | 3300032002 | Bacteria | 3025 |
| 328 | Ga0307416_100221734 | 3300032002 | Bacteria | 1814 |
| 329 | Ga0307416_100534844 | 3300032002 | Bacteria | 1243 |
| 330 | Ga0307411_10090119 | 3300032005 | Bacteria | 2138 |
| 331 | Ga0307510_10037495 | 3300033180 | Bacteria | 5377 |
| 332 | Ga0373950_0015194 | 3300034818 | Bacteria | 1303 |
| 333 | Ga0373958_0018831 | 3300034819 | Bacteria | 1255 |
| 334 | Ga0373959_0028411 | 3300034820 | Bacteria | 1116 |
| 335 | Ga0373926_0009660 | 3300035083 | Bacteria | 3222 |
| 336 | Ga0373928_0007841 | 3300035084 | Bacteria | 2066 |
| 337 | Ga0373940_0083521 | 3300035088 | Bacteria | 948 |
| 338 | Ga0373952_0019730 | 3300035092 | Bacteria | 1407 |
| 339 | Ga0373941_0008916 | 3300035115 | Bacteria | 2512 |
| 340 | Ga0373941_0021741 | 3300035115 | Bacteria | 1814 |
| 341 | Ga0373955_0006817 | 3300035172 | Bacteria | 5218 |
| 342 | Ga0373942_0051060 | 3300035207 | Bacteria | 1160 |
| 343 | Ga0373962_0008807 | 3300035242 | Bacteria | 2491 |
| 344 | Ga0373931_0002999 | 3300035691 | Bacteria | 7536 |
| 345 | Ga0373931_0026064 | 3300035691 | Bacteria | 2972 |
| 346 | Ga0373935_0050988 | 3300035692 | Bacteria | 2627 |
| 347 | Ga0373927_0018551 | 3300035695 | Bacteria | 4569 |
| 348 | Ga0373927_0082518 | 3300035695 | Bacteria | 2084 |
| 349 | Ga0373947_0146659 | 3300035725 | Bacteria | 1517 |
| 350 | Ga0373937_0068852 | 3300036401 | Bacteria | 3263 |
| 351 | Ga0373925_0032753 | 3300037068 | Bacteria | 3826 |
| 352 | Ga0373925_0306302 | 3300037068 | Bacteria | 1283 |
| 353 | Ga0395899_0011466 | 3300037312 | Bacteria | 6786 |
| 354 | Ga0395900_0055645 | 3300037418 | Bacteria | 4074 |
| 355 | Ga0395898_0038222 | 3300037466 | Bacteria | 4758 |
| 356 | Ga0395905_0094682 | 3300037471 | Bacteria | 2802 |
| 357 | Ga0395901_0167378 | 3300038443 | Bacteria | 2307 |
| 358 | Ga0436361_0168918 | 3300039447 | Bacteria | 13423 |
| 359 | Ga0439441_001355 | 3300042001 | Bacteria | 3170 |
| 360 | Ga0439445_0012060 | 3300042004 | Bacteria | 2070 |
| 361 | Ga0439456_012441 | 3300042013 | Bacteria | 1764 |
| 362 | Ga0439462_0002146 | 3300042015 | Bacteria | 4536 |
| 363 | Ga0450911_000322 | 3300042115 | Bacteria | 17149 |
| 364 | Ga0439446_0036701 | 3300042156 | Bacteria | 1433 |
| 365 | Ga0439434_0073702 | 3300042435 | Bacteria | 1077 |
| 366 | Ga0439435_0004976 | 3300042436 | Bacteria | 2895 |
| 367 | Ga0439444_0000141 | 3300042437 | Bacteria | 6202 |
| 368 | Ga0439460_0013205 | 3300042461 | Bacteria | 2157 |
| 369 | Ga0466963_0394222 | 3300044694 | Bacteria | 976 |
| 370 | Ga0451576_0143917 | 3300045051 | Bacteria | 2486 |
| 371 | Ga0466967_0512990 | 3300045976 | Bacteria | 1177 |
| 372 | Ga0495592_0271707 | 3300046454 | Bacteria | 1112 |
| 373 | Ga0495603_0003735 | 3300046455 | Bacteria | 9052 |
| 374 | Ga0495653_0383533 | 3300046463 | Bacteria | 897 |
| 375 | Ga0495580_0014864 | 3300046472 | Bacteria | 5897 |
| 376 | Ga0495605_0006316 | 3300046474 | Bacteria | 6830 |
| 377 | Ga0495605_0038636 | 3300046474 | Bacteria | 2394 |
| 378 | Ga0495639_0130280 | 3300046475 | Bacteria | 1204 |
| 379 | Ga0495662_0046936 | 3300046476 | Bacteria | 2085 |
| 380 | Ga0495584_0071056 | 3300046491 | Bacteria | 1749 |
| 381 | Ga0495596_0000975 | 3300046500 | Bacteria | 17034 |
| 382 | Ga0495607_0005726 | 3300046501 | Bacteria | 8847 |
| 383 | Ga0495610_0001332 | 3300046512 | Bacteria | 21933 |
| 384 | Ga0495616_0000889 | 3300046513 | Bacteria | 21607 |
| 385 | Ga0495628_0034298 | 3300046516 | Bacteria | 4083 |
| 386 | Ga0495628_0043678 | 3300046516 | Bacteria | 3568 |
| 387 | Ga0495630_0002830 | 3300046517 | Bacteria | 12030 |
| 388 | Ga0495666_0059438 | 3300046526 | Bacteria | 1828 |
| 389 | Ga0495652_0259602 | 3300046529 | Bacteria | 1283 |
| 390 | Ga0495654_0003050 | 3300046530 | Bacteria | 10432 |
| 391 | Ga0495640_0170997 | 3300046533 | Bacteria | 1388 |
| 392 | Ga0495640_0233408 | 3300046533 | Bacteria | 1156 |
| 393 | Ga0495586_0004499 | 3300046535 | Bacteria | 7447 |
| 394 | Ga0495609_0003775 | 3300046538 | Bacteria | 8536 |
| 395 | Ga0495621_0034663 | 3300046539 | Bacteria | 1745 |
| 396 | Ga0495634_0034394 | 3300046642 | Bacteria | 3478 |
| 397 | Ga0495634_0091065 | 3300046642 | Bacteria | 1980 |
| 398 | Ga0495634_0141893 | 3300046642 | Bacteria | 1525 |
| 399 | Ga0495611_0060295 | 3300046648 | Bacteria | 1724 |
| 400 | Ga0495625_0002799 | 3300046660 | Bacteria | 18380 |
| 401 | Ga0495661_0014728 | 3300046665 | Bacteria | 5235 |
| 402 | Ga0495588_0028228 | 3300046674 | Bacteria | 2807 |
| 403 | Ga0495588_0091117 | 3300046674 | Bacteria | 1597 |
| 404 | Ga0495646_0034925 | 3300046680 | Bacteria | 3120 |
| 405 | Ga0495647_0000551 | 3300046681 | Bacteria | 11018 |
| 406 | Ga0495647_0012356 | 3300046681 | Bacteria | 2939 |
| 407 | Ga0495624_0007569 | 3300046690 | Bacteria | 7621 |
| 408 | Ga0495671_0001016 | 3300046692 | Bacteria | 19531 |
| 409 | Ga0495604_0104852 | 3300047317 | Bacteria | 2070 |
| 410 | Ga0495636_0101516 | 3300047318 | Bacteria | 1258 |
| 411 | Ga0495672_0015225 | 3300047320 | Bacteria | 5231 |
| 412 | Ga0495676_0034950 | 3300047321 | Bacteria | 4210 |
| 413 | Ga0495676_0067451 | 3300047321 | Bacteria | 2768 |
| 414 | Ga0495680_0167183 | 3300047322 | Bacteria | 1594 |
| 415 | Ga0495687_006653 | 3300047443 | Bacteria | 7023 |
| 416 | Ga0495675_0228037 | 3300047444 | Bacteria | 1125 |
| 417 | Ga0495686_0124868 | 3300047472 | Bacteria | 1531 |
| 418 | Ga0496101_0144398 | 3300048904 | Bacteria | 1816 |
| 419 | Ga0496102_0064195 | 3300048905 | Bacteria | 3363 |
| 420 | Ga0496103_0048741 | 3300048906 | Bacteria | 2618 |
| 421 | Ga0496104_0010260 | 3300048907 | Bacteria | 8366 |
| 422 | Ga0496104_0165959 | 3300048907 | Bacteria | 2118 |
| 423 | Ga0496106_0129859 | 3300048909 | Bacteria | 1975 |
| 424 | Ga0496108_0079845 | 3300048911 | Bacteria | 2770 |
| 425 | Ga0496108_0130915 | 3300048911 | Bacteria | 2156 |
| 426 | Ga0496108_0407351 | 3300048911 | Bacteria | 1188 |
| 427 | Ga0496109_0113606 | 3300048912 | Bacteria | 2519 |
| 428 | Ga0496110_0072749 | 3300048913 | Bacteria | 3051 |
| 429 | Ga0496110_0084010 | 3300048913 | Bacteria | 2841 |
| 430 | Ga0496110_0087967 | 3300048913 | Bacteria | 2774 |
| 431 | Ga0496112_0323176 | 3300048915 | Bacteria | 1487 |
| 432 | Ga0496113_0039121 | 3300048916 | Bacteria | 3490 |
| 433 | Ga0496114_0474586 | 3300048917 | Bacteria | 1107 |
| 434 | Ga0496116_0009765 | 3300048919 | Bacteria | 8142 |
| 435 | Ga0496116_0015566 | 3300048919 | Bacteria | 6007 |
| 436 | Ga0496116_0041832 | 3300048919 | Bacteria | 3140 |
| 437 | Ga0496116_0053678 | 3300048919 | Bacteria | 2660 |
| 438 | Ga0496117_0033194 | 3300048920 | Bacteria | 3907 |
| 439 | Ga0496117_0105303 | 3300048920 | Bacteria | 1773 |
| 440 | Ga0496118_0009498 | 3300048921 | Bacteria | 9806 |
| 441 | Ga0496118_0095952 | 3300048921 | Bacteria | 2022 |
| 442 | Ga0496119_0023399 | 3300048922 | Bacteria | 4381 |
| 443 | Ga0496120_0003586 | 3300048923 | Bacteria | 13947 |
| 444 | Ga0496121_0000165 | 3300048924 | Bacteria | 145052 |
| 445 | Ga0496121_0003822 | 3300048924 | Bacteria | 20965 |
| 446 | Ga0496121_0004161 | 3300048924 | Bacteria | 19780 |
| 447 | Ga0496121_0016988 | 3300048924 | Bacteria | 7470 |
| 448 | Ga0496121_0017600 | 3300048924 | Bacteria | 7284 |
| 449 | Ga0496121_0022402 | 3300048924 | Bacteria | 6133 |
| 450 | Ga0496121_0127293 | 3300048924 | Bacteria | 1913 |
| 451 | Ga0496122_0000936 | 3300048925 | Bacteria | 53067 |
| 452 | Ga0496122_0001626 | 3300048925 | Bacteria | 35051 |
| 453 | Ga0496122_0003285 | 3300048925 | Bacteria | 21429 |
| 454 | Ga0496123_0001075 | 3300048926 | Bacteria | 41273 |
| 455 | Ga0496123_0001319 | 3300048926 | Bacteria | 35071 |
| 456 | Ga0496123_0003769 | 3300048926 | Bacteria | 16617 |
| 457 | Ga0496123_0089642 | 3300048926 | Bacteria | 1831 |
| 458 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 459 | Ga0496124_0084004 | 3300048927 | Bacteria | 2611 |
| 460 | Ga0496125_0000121 | 3300048928 | Bacteria | 174971 |
| 461 | Ga0496125_0002327 | 3300048928 | Bacteria | 25024 |
| 462 | Ga0496125_0022455 | 3300048928 | Bacteria | 5860 |
| 463 | Ga0496125_0029702 | 3300048928 | Bacteria | 4906 |
| 464 | Ga0496125_0049346 | 3300048928 | Bacteria | 3498 |
| 465 | Ga0496125_0076764 | 3300048928 | Bacteria | 2578 |
| 466 | Ga0501033_0104094 | 3300049570 | Bacteria | 2069 |
| 467 | Ga0501034_0219609 | 3300049571 | Bacteria | 1853 |
| 468 | Ga0501036_0024422 | 3300049572 | Bacteria | 5095 |
| 469 | Ga0501037_0030270 | 3300049573 | Bacteria | 4001 |
| 470 | Ga0501038_0016173 | 3300049574 | Bacteria | 6768 |
| 471 | Ga0501038_0018785 | 3300049574 | Bacteria | 6239 |
| 472 | Ga0501039_0034728 | 3300049575 | Bacteria | 3891 |
| 473 | Ga0501039_0088857 | 3300049575 | Bacteria | 2407 |
| 474 | Ga0501039_0664693 | 3300049575 | Bacteria | 815 |
| 475 | Ga0501040_0025479 | 3300049576 | Bacteria | 3976 |
| 476 | Ga0501041_0007764 | 3300049577 | Bacteria | 6299 |
| 477 | Ga0501041_0066512 | 3300049577 | Bacteria | 2209 |
| 478 | Ga0501042_0357326 | 3300049578 | Bacteria | 1057 |
| 479 | Ga0501046_0063123 | 3300049580 | Bacteria | 2893 |
| 480 | Ga0501046_0182729 | 3300049580 | Bacteria | 1567 |
| 481 | Ga0501048_0083380 | 3300049582 | Bacteria | 2254 |
| 482 | Ga0501072_0003674 | 3300049588 | Bacteria | 11566 |
| 483 | Ga0501072_0159215 | 3300049588 | Bacteria | 1801 |
| 484 | Ga0501072_0243928 | 3300049588 | Bacteria | 1431 |
| 485 | Ga0501075_0001437 | 3300049591 | Bacteria | 15477 |
| 486 | Ga0501075_0020339 | 3300049591 | Bacteria | 4827 |
| 487 | Ga0501076_0053398 | 3300049592 | Bacteria | 3202 |
| 488 | Ga0501076_0168335 | 3300049592 | Bacteria | 1786 |
| 489 | Ga0501076_0321160 | 3300049592 | Bacteria | 1270 |
| 490 | Ga0501079_0011234 | 3300049741 | Bacteria | 6830 |
| 491 | Ga0501079_0100210 | 3300049741 | Bacteria | 2246 |
| 492 | Ga0501079_0172978 | 3300049741 | Bacteria | 1684 |
| 493 | Ga0501080_0025403 | 3300049742 | Bacteria | 5497 |
| 494 | Ga0501081_0011654 | 3300049743 | Bacteria | 5755 |
| 495 | Ga0501083_0165164 | 3300049744 | Bacteria | 1447 |
| 496 | Ga0501035_0294935 | 3300049822 | Bacteria | 1368 |
| 497 | Ga0501044_0013470 | 3300049823 | Bacteria | 8844 |
| 498 | Ga0501045_0002422 | 3300049824 | Bacteria | 12679 |
| 499 | Ga0501045_0014711 | 3300049824 | Bacteria | 5547 |
| 500 | nmdc:mga00v17_158968_c1 | 3300050491 | Bacteria | 1454 |
| 501 | nmdc:mga05p37_1054_c1 | 3300050507 | Bacteria | 31460 |
| 502 | nmdc:mga05p37_72_c1 | 3300050507 | Bacteria | 88725 |
| 503 | nmdc:mga09592_100_c1 | 3300050508 | Bacteria | 52155 |
| 504 | nmdc:mga09592_52447_c1 | 3300050508 | Bacteria | 3443 |
| 505 | nmdc:mga09592_739_c1 | 3300050508 | Bacteria | 25175 |
| 506 | nmdc:mga0qj67_135341_c1 | 3300050509 | Bacteria | 1997 |
| 507 | nmdc:mga0qj67_215928_c1 | 3300050509 | Bacteria | 1557 |
| 508 | nmdc:mga0qj67_71687_c1 | 3300050509 | Bacteria | 2766 |
| 509 | nmdc:mga06r32_10136_c2 | 3300050510 | Bacteria | 8123 |
| 510 | nmdc:mga06r32_109174_c1 | 3300050510 | Bacteria | 2721 |
| 511 | nmdc:mga06r32_83503_c1 | 3300050510 | Bacteria | 3113 |
| 512 | nmdc:mga08y16_171471_c1 | 3300050511 | Bacteria | 2254 |
| 513 | nmdc:mga08y16_208965_c1 | 3300050511 | Bacteria | 2022 |
| 514 | nmdc:mga08y16_322987_c1 | 3300050511 | Bacteria | 1589 |
| 515 | nmdc:mga08y16_58171_c2 | 3300050511 | Bacteria | 3144 |
| 516 | nmdc:mga0n895_16072_c1 | 3300050512 | Bacteria | 6857 |
| 517 | nmdc:mga0n895_811443_c1 | 3300050512 | Bacteria | 925 |
| 518 | nmdc:mga0rr50_117702_c1 | 3300050513 | Bacteria | 2110 |
| 519 | nmdc:mga0rr50_2265_c1 | 3300050513 | Bacteria | 10792 |
| 520 | nmdc:mga08x19_1264_c1 | 3300050514 | Bacteria | 15694 |
| 521 | nmdc:mga08x19_67646_c1 | 3300050514 | Bacteria | 2324 |
| 522 | nmdc:mga08x19_91732_c1 | 3300050514 | Bacteria | 2005 |
| 523 | nmdc:mga0a205_156224_c1 | 3300050515 | Bacteria | 2179 |
| 524 | nmdc:mga0a205_226893_c1 | 3300050515 | Bacteria | 1752 |
| 525 | nmdc:mga0a205_3570_c1 | 3300050515 | Bacteria | 13926 |
| 526 | Ga0495612_0075714 | 3300053078 | Bacteria | 1409 |
| 527 | Ga0500644_0027330 | 3300053088 | Bacteria | 1774 |
| 528 | Ga0500644_0044142 | 3300053088 | Bacteria | 1495 |
| 529 | Ga0500651_0057488 | 3300053093 | Bacteria | 2434 |
| 530 | Ga0500562_002948 | 3300053108 | Bacteria | 4246 |
| 531 | Ga0500594_0011571 | 3300053118 | Bacteria | 2061 |
| 532 | Ga0500618_000716 | 3300053125 | Bacteria | 19145 |
| 533 | Ga0500618_000823 | 3300053125 | Bacteria | 17028 |
| 534 | Ga0500559_0000047 | 3300053136 | Bacteria | 95447 |
| 535 | Ga0500586_051960 | 3300053145 | Bacteria | 1414 |
| 536 | Ga0500622_0006088 | 3300053156 | Bacteria | 7085 |
| 537 | Ga0500634_0098054 | 3300053161 | Bacteria | 1473 |
| 538 | Ga0501084_0045106 | 3300054114 | Bacteria | 3692 |
| 539 | Ga0501082_0013050 | 3300060353 | Bacteria | 7141 |
| 540 | Ga0501082_0184640 | 3300060353 | Bacteria | 1814 |
| 541 | Ga0501082_0229799 | 3300060353 | Bacteria | 1614 |
| 542 | Ga0530510_0112172 | 3300061734 | Bacteria | 1998 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0664693 | Ga0501039_0664693_13_729 | 224 |
| 2 | 3300025925 | Ga0207650_10499486 | Ga0207650_104994862 | 226 |
| 3 | 3300050511 | nmdc:mga08y16_58171_c2 | nmdc:mga08y16_58171_c2_2377_3120 | 233 |
| 4 | 3300046539 | Ga0495621_0034663 | Ga0495621_0034663_12_761 | 235 |
| 5 | 3300031090 | Ga0265760_10014928 | Ga0265760_100149282 | 246 |
| 6 | 3300005435 | Ga0070714_100185199 | Ga0070714_1001851991 | 247 |
| 7 | 3300005458 | Ga0070681_10002557 | Ga0070681_1000255714 | 247 |
| 8 | 3300005563 | Ga0068855_100244551 | Ga0068855_1002445512 | 247 |
| 9 | 3300005614 | Ga0068856_100006230 | Ga0068856_1000062302 | 247 |
| 10 | 3300013105 | Ga0157369_10123443 | Ga0157369_101234432 | 247 |
| 11 | 3300025917 | Ga0207660_10021266 | Ga0207660_100212662 | 247 |
| 12 | 3300025949 | Ga0207667_10205159 | Ga0207667_102051592 | 247 |
| 13 | 3300026078 | Ga0207702_10112572 | Ga0207702_101125722 | 247 |
| 14 | 3300025303 | Ga0209051_1004307 | Ga0209051_10043075 | 252 |
| 15 | 3300036401 | Ga0373937_0068852 | Ga0373937_0068852_1163_2035 | 252 |
| 16 | 3300046529 | Ga0495652_0259602 | Ga0495652_0259602_295_1167 | 252 |
| 17 | 3300031456 | Ga0307513_10117289 | Ga0307513_101172892 | 253 |
| 18 | 3300048924 | Ga0496121_0022402 | Ga0496121_0022402_593_1471 | 255 |
| 19 | 3300003187 | JGI25151J46595_10049929 | JGI25151J46595_100499292 | 256 |
| 20 | 3300003775 | Ga0055524_1008162 | Ga0055524_10081622 | 256 |
| 21 | 3300025294 | Ga0209025_1002021 | Ga0209025_10020211 | 256 |
| 22 | 3300025299 | Ga0209256_1000492 | Ga0209256_100049247 | 256 |
| 23 | 3300037068 | Ga0373925_0306302 | Ga0373925_0306302_219_1094 | 256 |
| 24 | 3300046533 | Ga0495640_0170997 | Ga0495640_0170997_80_955 | 256 |
| 25 | 3300005331 | Ga0070670_100071860 | Ga0070670_1000718602 | 257 |
| 26 | 3300005563 | Ga0068855_100619389 | Ga0068855_1006193892 | 257 |
| 27 | 3300005614 | Ga0068856_100068929 | Ga0068856_1000689292 | 257 |
| 28 | 3300005616 | Ga0068852_100023753 | Ga0068852_1000237534 | 257 |
| 29 | 3300009093 | Ga0105240_10002050 | Ga0105240_100020505 | 257 |
| 30 | 3300009093 | Ga0105240_10006656 | Ga0105240_1000665612 | 257 |
| 31 | 3300009551 | Ga0105238_10189172 | Ga0105238_101891722 | 257 |
| 32 | 3300014497 | Ga0182008_10024181 | Ga0182008_100241811 | 257 |
| 33 | 3300025233 | Ga0209437_100117 | Ga0209437_100117133 | 257 |
| 34 | 3300025913 | Ga0207695_10004925 | Ga0207695_100049252 | 257 |
| 35 | 3300025925 | Ga0207650_10136566 | Ga0207650_101365662 | 257 |
| 36 | 3300025949 | Ga0207667_10006563 | Ga0207667_1000656310 | 257 |
| 37 | 3300026078 | Ga0207702_10023862 | Ga0207702_100238622 | 257 |
| 38 | 3300026142 | Ga0207698_10026389 | Ga0207698_100263892 | 257 |
| 39 | 3300048919 | Ga0496116_0015566 | Ga0496116_0015566_1761_2639 | 257 |
| 40 | 3300048924 | Ga0496121_0003822 | Ga0496121_0003822_13648_14526 | 257 |
| 41 | 3300048925 | Ga0496122_0001626 | Ga0496122_0001626_8776_9654 | 257 |
| 42 | 3300048926 | Ga0496123_0001319 | Ga0496123_0001319_8796_9674 | 257 |
| 43 | 3300048928 | Ga0496125_0002327 | Ga0496125_0002327_3721_4599 | 257 |
| 44 | 3300048928 | Ga0496125_0076764 | Ga0496125_0076764_676_1554 | 257 |
| 45 | 3300053078 | Ga0495612_0075714 | Ga0495612_0075714_61_936 | 257 |
| 46 | 3300047443 | Ga0495687_006653 | Ga0495687_006653_1472_2347 | 258 |
| 47 | 3300048911 | Ga0496108_0079845 | Ga0496108_0079845_565_1440 | 258 |
| 48 | 3300048912 | Ga0496109_0113606 | Ga0496109_0113606_1021_1896 | 258 |
| 49 | 3300048913 | Ga0496110_0087967 | Ga0496110_0087967_488_1363 | 258 |
| 50 | 3300005436 | Ga0070713_100028911 | Ga0070713_1000289114 | 259 |
| 51 | 3300005459 | Ga0068867_100092301 | Ga0068867_1000923012 | 259 |
| 52 | 3300005468 | Ga0070707_100127737 | Ga0070707_1001277372 | 259 |
| 53 | 3300005518 | Ga0070699_100000829 | Ga0070699_1000008299 | 259 |
| 54 | 3300005518 | Ga0070699_100233520 | Ga0070699_1002335202 | 259 |
| 55 | 3300005536 | Ga0070697_100203198 | Ga0070697_1002031982 | 259 |
| 56 | 3300005545 | Ga0070695_100309597 | Ga0070695_1003095972 | 259 |
| 57 | 3300006173 | Ga0070716_100049998 | Ga0070716_1000499982 | 259 |
| 58 | 3300007265 | Ga0099794_10012552 | Ga0099794_100125522 | 259 |
| 59 | 3300025292 | Ga0209676_1003226 | Ga0209676_10032268 | 259 |
| 60 | 3300025298 | Ga0209050_1004102 | Ga0209050_10041022 | 259 |
| 61 | 3300025303 | Ga0209051_1024873 | Ga0209051_10248732 | 259 |
| 62 | 3300025907 | Ga0207645_10040099 | Ga0207645_100400992 | 259 |
| 63 | 3300025910 | Ga0207684_10048246 | Ga0207684_100482462 | 259 |
| 64 | 3300025915 | Ga0207693_10014590 | Ga0207693_100145903 | 259 |
| 65 | 3300025922 | Ga0207646_10203529 | Ga0207646_102035292 | 259 |
| 66 | 3300025923 | Ga0207681_10001355 | Ga0207681_100013557 | 259 |
| 67 | 3300025939 | Ga0207665_10015991 | Ga0207665_100159915 | 259 |
| 68 | 3300026089 | Ga0207648_10012950 | Ga0207648_100129502 | 259 |
| 69 | 3300027671 | Ga0209588_1032236 | Ga0209588_10322362 | 259 |
| 70 | 3300042015 | Ga0439462_0002146 | Ga0439462_0002146_2782_3660 | 259 |
| 71 | 3300047318 | Ga0495636_0101516 | Ga0495636_0101516_249_1124 | 259 |
| 72 | 3300048913 | Ga0496110_0084010 | Ga0496110_0084010_975_1850 | 259 |
| 73 | 3300048919 | Ga0496116_0041832 | Ga0496116_0041832_18_1019 | 259 |
| 74 | 3300048919 | Ga0496116_0053678 | Ga0496116_0053678_1353_2231 | 259 |
| 75 | 3300048920 | Ga0496117_0033194 | Ga0496117_0033194_2087_2965 | 259 |
| 76 | 3300048920 | Ga0496117_0105303 | Ga0496117_0105303_766_1644 | 259 |
| 77 | 3300048921 | Ga0496118_0009498 | Ga0496118_0009498_5304_6182 | 259 |
| 78 | 3300048921 | Ga0496118_0095952 | Ga0496118_0095952_95_973 | 259 |
| 79 | 3300048922 | Ga0496119_0023399 | Ga0496119_0023399_1017_1895 | 259 |
| 80 | 3300048923 | Ga0496120_0003586 | Ga0496120_0003586_11176_12054 | 259 |
| 81 | 3300048924 | Ga0496121_0000165 | Ga0496121_0000165_117783_118661 | 259 |
| 82 | 3300048925 | Ga0496122_0000936 | Ga0496122_0000936_3650_4528 | 259 |
| 83 | 3300048926 | Ga0496123_0001075 | Ga0496123_0001075_3711_4589 | 259 |
| 84 | 3300048926 | Ga0496123_0089642 | Ga0496123_0089642_830_1708 | 259 |
| 85 | 3300048927 | Ga0496124_0084004 | Ga0496124_0084004_1397_2275 | 259 |
| 86 | 3300048928 | Ga0496125_0000121 | Ga0496125_0000121_128250_129128 | 259 |
| 87 | 3300048928 | Ga0496125_0049346 | Ga0496125_0049346_2265_3143 | 259 |
| 88 | 3300050515 | nmdc:mga0a205_156224_c1 | nmdc:mga0a205_156224_c1_996_1871 | 259 |
| 89 | 3300049588 | Ga0501072_0003674 | Ga0501072_0003674_2469_3344 | 260 |
| 90 | 3300053125 | Ga0500618_000823 | Ga0500618_000823_9205_10083 | 260 |
| 91 | 3300005334 | Ga0068869_100515595 | Ga0068869_1005155951 | 261 |
| 92 | 3300006852 | Ga0075433_10223715 | Ga0075433_102237152 | 261 |
| 93 | 3300006946 | Ga0079104_1016099 | Ga0079104_10160992 | 261 |
| 94 | 3300009177 | Ga0105248_10139969 | Ga0105248_101399692 | 261 |
| 95 | 3300014326 | Ga0157380_10478944 | Ga0157380_104789441 | 261 |
| 96 | 3300025921 | Ga0207652_10113919 | Ga0207652_101139192 | 261 |
| 97 | 3300035088 | Ga0373940_0083521 | Ga0373940_0083521_13_840 | 261 |
| 98 | 3300035695 | Ga0373927_0082518 | Ga0373927_0082518_535_1362 | 261 |
| 99 | 3300046463 | Ga0495653_0383533 | Ga0495653_0383533_14_886 | 261 |
| 100 | 3300047317 | Ga0495604_0104852 | Ga0495604_0104852_530_1402 | 261 |
| 101 | 3300047444 | Ga0495675_0228037 | Ga0495675_0228037_73_945 | 261 |
| 102 | 3300048907 | Ga0496104_0010260 | Ga0496104_0010260_1991_2818 | 261 |
| 103 | 3300048909 | Ga0496106_0129859 | Ga0496106_0129859_624_1451 | 261 |
| 104 | 3300048911 | Ga0496108_0130915 | Ga0496108_0130915_1126_1953 | 261 |
| 105 | 3300048911 | Ga0496108_0407351 | Ga0496108_0407351_21_848 | 261 |
| 106 | 3300048913 | Ga0496110_0072749 | Ga0496110_0072749_1672_2499 | 261 |
| 107 | 3300048915 | Ga0496112_0323176 | Ga0496112_0323176_512_1339 | 261 |
| 108 | 3300048916 | Ga0496113_0039121 | Ga0496113_0039121_723_1550 | 261 |
| 109 | 3300049580 | Ga0501046_0182729 | Ga0501046_0182729_17_847 | 261 |
| 110 | 3300049744 | Ga0501083_0165164 | Ga0501083_0165164_599_1426 | 261 |
| 111 | 3300050512 | nmdc:mga0n895_811443_c1 | nmdc:mga0n895_811443_c1_25_852 | 261 |
| 112 | 3300050515 | nmdc:mga0a205_226893_c1 | nmdc:mga0a205_226893_c1_464_1291 | 261 |
| 113 | 3300046642 | Ga0495634_0034394 | Ga0495634_0034394_1540_2415 | 262 |
| 114 | 3300047321 | Ga0495676_0067451 | Ga0495676_0067451_884_1759 | 262 |
| 115 | 3300048924 | Ga0496121_0127293 | Ga0496121_0127293_287_1159 | 262 |
| 116 | 3300006175 | Ga0070712_100022470 | Ga0070712_1000224702 | 263 |
| 117 | 3300009094 | Ga0111539_10018489 | Ga0111539_100184895 | 263 |
| 118 | 3300025915 | Ga0207693_10006637 | Ga0207693_100066372 | 263 |
| 119 | 3300025981 | Ga0207640_10088830 | Ga0207640_100888302 | 263 |
| 120 | 3300035172 | Ga0373955_0006817 | Ga0373955_0006817_524_1396 | 263 |
| 121 | 3300046516 | Ga0495628_0034298 | Ga0495628_0034298_2717_3589 | 263 |
| 122 | 3300046680 | Ga0495646_0034925 | Ga0495646_0034925_703_1575 | 263 |
| 123 | 3300046681 | Ga0495647_0012356 | Ga0495647_0012356_967_1839 | 263 |
| 124 | 3300049575 | Ga0501039_0088857 | Ga0501039_0088857_658_1527 | 263 |
| 125 | 3300005339 | Ga0070660_100045969 | Ga0070660_1000459692 | 264 |
| 126 | 3300005366 | Ga0070659_100093847 | Ga0070659_1000938472 | 264 |
| 127 | 3300005563 | Ga0068855_100007207 | Ga0068855_10000720711 | 264 |
| 128 | 3300005614 | Ga0068856_100110677 | Ga0068856_1001106772 | 264 |
| 129 | 3300005841 | Ga0068863_100326532 | Ga0068863_1003265322 | 264 |
| 130 | 3300006871 | Ga0075434_100229925 | Ga0075434_1002299252 | 264 |
| 131 | 3300007076 | Ga0075435_100324503 | Ga0075435_1003245031 | 264 |
| 132 | 3300025284 | Ga0209130_1012022 | Ga0209130_10120222 | 264 |
| 133 | 3300025906 | Ga0207699_10139104 | Ga0207699_101391042 | 264 |
| 134 | 3300025919 | Ga0207657_10057520 | Ga0207657_100575202 | 264 |
| 135 | 3300025929 | Ga0207664_10096151 | Ga0207664_100961511 | 264 |
| 136 | 3300025945 | Ga0207679_10294947 | Ga0207679_102949471 | 264 |
| 137 | 3300026078 | Ga0207702_10165389 | Ga0207702_101653892 | 264 |
| 138 | 3300046454 | Ga0495592_0271707 | Ga0495592_0271707_66_932 | 264 |
| 139 | 3300046476 | Ga0495662_0046936 | Ga0495662_0046936_67_933 | 264 |
| 140 | 3300046517 | Ga0495630_0002830 | Ga0495630_0002830_8964_9830 | 264 |
| 141 | 3300046533 | Ga0495640_0233408 | Ga0495640_0233408_93_959 | 264 |
| 142 | 3300046642 | Ga0495634_0091065 | Ga0495634_0091065_853_1719 | 264 |
| 143 | 3300046690 | Ga0495624_0007569 | Ga0495624_0007569_5124_5990 | 264 |
| 144 | 3300047322 | Ga0495680_0167183 | Ga0495680_0167183_548_1414 | 264 |
| 145 | 3300048917 | Ga0496114_0474586 | Ga0496114_0474586_46_921 | 264 |
| 146 | 3300049572 | Ga0501036_0024422 | Ga0501036_0024422_180_1052 | 264 |
| 147 | 3300049574 | Ga0501038_0016173 | Ga0501038_0016173_2819_3691 | 264 |
| 148 | 3300049576 | Ga0501040_0025479 | Ga0501040_0025479_2599_3471 | 264 |
| 149 | 3300049577 | Ga0501041_0007764 | Ga0501041_0007764_5337_6209 | 264 |
| 150 | 3300049580 | Ga0501046_0063123 | Ga0501046_0063123_1914_2786 | 264 |
| 151 | 3300049582 | Ga0501048_0083380 | Ga0501048_0083380_965_1837 | 264 |
| 152 | 3300049591 | Ga0501075_0001437 | Ga0501075_0001437_13708_14580 | 264 |
| 153 | 3300049592 | Ga0501076_0053398 | Ga0501076_0053398_2207_3079 | 264 |
| 154 | 3300049741 | Ga0501079_0011234 | Ga0501079_0011234_24_896 | 264 |
| 155 | 3300049743 | Ga0501081_0011654 | Ga0501081_0011654_25_897 | 264 |
| 156 | 3300049822 | Ga0501035_0294935 | Ga0501035_0294935_446_1318 | 264 |
| 157 | 3300049824 | Ga0501045_0002422 | Ga0501045_0002422_10448_11320 | 264 |
| 158 | 3300050513 | nmdc:mga0rr50_117702_c1 | nmdc:mga0rr50_117702_c1_1170_2036 | 264 |
| 159 | 3300054114 | Ga0501084_0045106 | Ga0501084_0045106_948_1820 | 264 |
| 160 | 3300060353 | Ga0501082_0013050 | Ga0501082_0013050_3572_4444 | 264 |
| 161 | 3300037312 | Ga0395899_0011466 | Ga0395899_0011466_5776_6654 | 265 |
| 162 | 3300037418 | Ga0395900_0055645 | Ga0395900_0055645_316_1194 | 265 |
| 163 | 3300037466 | Ga0395898_0038222 | Ga0395898_0038222_1873_2751 | 265 |
| 164 | 3300037471 | Ga0395905_0094682 | Ga0395905_0094682_1062_1940 | 265 |
| 165 | 3300038443 | Ga0395901_0167378 | Ga0395901_0167378_920_1798 | 265 |
| 166 | 3300053093 | Ga0500651_0057488 | Ga0500651_0057488_546_1424 | 265 |
| 167 | 3300005327 | Ga0070658_10099862 | Ga0070658_100998622 | 266 |
| 168 | 3300005329 | Ga0070683_100071598 | Ga0070683_1000715982 | 266 |
| 169 | 3300005337 | Ga0070682_100079571 | Ga0070682_1000795712 | 266 |
| 170 | 3300005339 | Ga0070660_100098691 | Ga0070660_1000986912 | 266 |
| 171 | 3300005339 | Ga0070660_100174956 | Ga0070660_1001749562 | 266 |
| 172 | 3300005344 | Ga0070661_100105142 | Ga0070661_1001051422 | 266 |
| 173 | 3300005366 | Ga0070659_100005229 | Ga0070659_1000052299 | 266 |
| 174 | 3300005535 | Ga0070684_100003238 | Ga0070684_1000032386 | 266 |
| 175 | 3300005539 | Ga0068853_100028827 | Ga0068853_1000288273 | 266 |
| 176 | 3300005564 | Ga0070664_100041171 | Ga0070664_1000411712 | 266 |
| 177 | 3300005578 | Ga0068854_100008150 | Ga0068854_1000081505 | 266 |
| 178 | 3300005834 | Ga0068851_10018633 | Ga0068851_100186332 | 266 |
| 179 | 3300006175 | Ga0070712_100273914 | Ga0070712_1002739142 | 266 |
| 180 | 3300009551 | Ga0105238_10019514 | Ga0105238_100195146 | 266 |
| 181 | 3300013104 | Ga0157370_10555118 | Ga0157370_105551181 | 266 |
| 182 | 3300013307 | Ga0157372_10042798 | Ga0157372_100427982 | 266 |
| 183 | 3300020082 | Ga0206353_10776176 | Ga0206353_107761762 | 266 |
| 184 | 3300025909 | Ga0207705_10042785 | Ga0207705_100427852 | 266 |
| 185 | 3300025912 | Ga0207707_10054809 | Ga0207707_100548093 | 266 |
| 186 | 3300025913 | Ga0207695_10168650 | Ga0207695_101686502 | 266 |
| 187 | 3300025917 | Ga0207660_10173286 | Ga0207660_101732862 | 266 |
| 188 | 3300025919 | Ga0207657_10000160 | Ga0207657_1000016035 | 266 |
| 189 | 3300025919 | Ga0207657_10087235 | Ga0207657_100872352 | 266 |
| 190 | 3300025920 | Ga0207649_10009821 | Ga0207649_100098212 | 266 |
| 191 | 3300025929 | Ga0207664_10040242 | Ga0207664_100402422 | 266 |
| 192 | 3300025945 | Ga0207679_10132301 | Ga0207679_101323012 | 266 |
| 193 | 3300025949 | Ga0207667_10001999 | Ga0207667_1000199924 | 266 |
| 194 | 3300026041 | Ga0207639_10015120 | Ga0207639_100151202 | 266 |
| 195 | 3300026041 | Ga0207639_10246441 | Ga0207639_102464412 | 266 |
| 196 | 3300026116 | Ga0207674_10000236 | Ga0207674_1000023627 | 266 |
| 197 | 3300026142 | Ga0207698_10054538 | Ga0207698_100545382 | 266 |
| 198 | 3300046516 | Ga0495628_0043678 | Ga0495628_0043678_908_1783 | 266 |
| 199 | 3300006948 | Ga0099826_10000113 | Ga0099826_100001138 | 267 |
| 200 | 3300009011 | Ga0105251_10057914 | Ga0105251_100579142 | 267 |
| 201 | 3300027666 | Ga0209282_1000165 | Ga0209282_10001659 | 267 |
| 202 | 3300046474 | Ga0495605_0006316 | Ga0495605_0006316_3054_3932 | 267 |
| 203 | 3300046491 | Ga0495584_0071056 | Ga0495584_0071056_107_985 | 267 |
| 204 | 3300046500 | Ga0495596_0000975 | Ga0495596_0000975_180_1058 | 267 |
| 205 | 3300046501 | Ga0495607_0005726 | Ga0495607_0005726_7876_8754 | 267 |
| 206 | 3300046512 | Ga0495610_0001332 | Ga0495610_0001332_6108_6986 | 267 |
| 207 | 3300046513 | Ga0495616_0000889 | Ga0495616_0000889_15213_16091 | 267 |
| 208 | 3300046538 | Ga0495609_0003775 | Ga0495609_0003775_5455_6333 | 267 |
| 209 | 3300046648 | Ga0495611_0060295 | Ga0495611_0060295_756_1634 | 267 |
| 210 | 3300046660 | Ga0495625_0002799 | Ga0495625_0002799_8777_9655 | 267 |
| 211 | 3300046665 | Ga0495661_0014728 | Ga0495661_0014728_3508_4386 | 267 |
| 212 | 3300046692 | Ga0495671_0001016 | Ga0495671_0001016_13089_13967 | 267 |
| 213 | 3300047320 | Ga0495672_0015225 | Ga0495672_0015225_85_963 | 267 |
| 214 | 3300048919 | Ga0496116_0009765 | Ga0496116_0009765_84_962 | 267 |
| 215 | 3300048924 | Ga0496121_0017600 | Ga0496121_0017600_315_1193 | 267 |
| 216 | 3300048925 | Ga0496122_0003285 | Ga0496122_0003285_5563_6441 | 267 |
| 217 | 3300048926 | Ga0496123_0003769 | Ga0496123_0003769_15625_16503 | 267 |
| 218 | 3300006844 | Ga0075428_100049725 | Ga0075428_1000497252 | 268 |
| 219 | 3300006847 | Ga0075431_100003002 | Ga0075431_1000030025 | 268 |
| 220 | 3300006880 | Ga0075429_100000107 | Ga0075429_10000010728 | 268 |
| 221 | 3300009147 | Ga0114129_10023386 | Ga0114129_100233864 | 268 |
| 222 | 3300046475 | Ga0495639_0130280 | Ga0495639_0130280_45_920 | 268 |
| 223 | 3300048904 | Ga0496101_0144398 | Ga0496101_0144398_920_1795 | 268 |
| 224 | 3300048907 | Ga0496104_0165959 | Ga0496104_0165959_158_1033 | 268 |
| 225 | 3300050507 | nmdc:mga05p37_1054_c1 | nmdc:mga05p37_1054_c1_18755_19627 | 268 |
| 226 | 3300050508 | nmdc:mga09592_100_c1 | nmdc:mga09592_100_c1_35729_36601 | 268 |
| 227 | 3300050510 | nmdc:mga06r32_109174_c1 | nmdc:mga06r32_109174_c1_1595_2467 | 268 |
| 228 | 3300025940 | Ga0207691_10268888 | Ga0207691_102688882 | 269 |
| 229 | 3300003187 | JGI25151J46595_10002298 | JGI25151J46595_100022987 | 270 |
| 230 | 3300003322 | rootL2_10157044 | rootL2_101570442 | 270 |
| 231 | 3300003781 | Ga0055536_1000677 | Ga0055536_100067715 | 270 |
| 232 | 3300003784 | Ga0055534_1000985 | Ga0055534_10009857 | 270 |
| 233 | 3300025291 | Ga0209675_1000174 | Ga0209675_100017426 | 270 |
| 234 | 3300025292 | Ga0209676_1001413 | Ga0209676_100141316 | 270 |
| 235 | 3300025294 | Ga0209025_1001481 | Ga0209025_10014818 | 270 |
| 236 | 3300025295 | Ga0209564_1000145 | Ga0209564_100014525 | 270 |
| 237 | 3300025295 | Ga0209564_1001261 | Ga0209564_10012618 | 270 |
| 238 | iso_pu_bacteria | 2842698319 | 2842701893 | 271 |
| 239 | 3300031548 | Ga0307408_100119558 | Ga0307408_1001195582 | 272 |
| 240 | 3300031911 | Ga0307412_10000106 | Ga0307412_1000010641 | 272 |
| 241 | 3300032002 | Ga0307416_100221734 | Ga0307416_1002217342 | 272 |
| 242 | 3300044694 | Ga0466963_0394222 | Ga0466963_0394222_14_886 | 272 |
| 243 | iso_pu_bacteria | 2513237087 | 2513590286 | 272 |
| 244 | iso_pu_bacteria | 2937843397 | 2937847601 | 272 |
| 245 | 3300006847 | Ga0075431_100434518 | Ga0075431_1004345182 | 273 |
| 246 | 3300025901 | Ga0207688_10161244 | Ga0207688_101612441 | 273 |
| 247 | 3300027682 | Ga0209971_1011152 | Ga0209971_10111522 | 273 |
| 248 | 3300027695 | Ga0209966_1005180 | Ga0209966_10051802 | 273 |
| 249 | 3300027876 | Ga0209974_10019543 | Ga0209974_100195432 | 273 |
| 250 | 3300042001 | Ga0439441_001355 | Ga0439441_001355_2276_3139 | 273 |
| 251 | 3300042013 | Ga0439456_012441 | Ga0439456_012441_301_1164 | 273 |
| 252 | 3300042435 | Ga0439434_0073702 | Ga0439434_0073702_124_987 | 273 |
| 253 | 3300042436 | Ga0439435_0004976 | Ga0439435_0004976_1499_2362 | 273 |
| 254 | 3300042437 | Ga0439444_0000141 | Ga0439444_0000141_3589_4452 | 273 |
| 255 | 3300042461 | Ga0439460_0013205 | Ga0439460_0013205_901_1764 | 273 |
| 256 | 3300048924 | Ga0496121_0016988 | Ga0496121_0016988_2415_3293 | 273 |
| 257 | 3300048927 | Ga0496124_0000046 | Ga0496124_0000046_256302_257180 | 273 |
| 258 | 3300050508 | nmdc:mga09592_52447_c1 | nmdc:mga09592_52447_c1_837_1700 | 273 |
| 259 | 3300050509 | nmdc:mga0qj67_71687_c1 | nmdc:mga0qj67_71687_c1_769_1632 | 273 |
| 260 | 3300050510 | nmdc:mga06r32_83503_c1 | nmdc:mga06r32_83503_c1_1874_2737 | 273 |
| 261 | 3300053125 | Ga0500618_000716 | Ga0500618_000716_10904_11782 | 273 |
| 262 | 3300053161 | Ga0500634_0098054 | Ga0500634_0098054_284_1162 | 273 |
| 263 | iso_pu_bacteria | 2574179768 | 2574432085 | 273 |
| 264 | iso_pu_bacteria | 2834641062 | 2834645804 | 273 |
| 265 | iso_pu_bacteria | 8003400568 | 8003405541 | 273 |
| 266 | 3300005329 | Ga0070683_100059947 | Ga0070683_1000599472 | 274 |
| 267 | 3300005330 | Ga0070690_100064341 | Ga0070690_1000643412 | 274 |
| 268 | 3300005334 | Ga0068869_100070709 | Ga0068869_1000707092 | 274 |
| 269 | 3300005354 | Ga0070675_100059881 | Ga0070675_1000598812 | 274 |
| 270 | 3300005364 | Ga0070673_100400962 | Ga0070673_1004009621 | 274 |
| 271 | 3300005406 | Ga0070703_10031739 | Ga0070703_100317392 | 274 |
| 272 | 3300005441 | Ga0070700_100044814 | Ga0070700_1000448142 | 274 |
| 273 | 3300005441 | Ga0070700_100338278 | Ga0070700_1003382781 | 274 |
| 274 | 3300005544 | Ga0070686_100004065 | Ga0070686_1000040655 | 274 |
| 275 | 3300005549 | Ga0070704_100426466 | Ga0070704_1004264662 | 274 |
| 276 | 3300005615 | Ga0070702_100008100 | Ga0070702_1000081002 | 274 |
| 277 | 3300005844 | Ga0068862_100005219 | Ga0068862_10000521911 | 274 |
| 278 | 3300005844 | Ga0068862_100270969 | Ga0068862_1002709691 | 274 |
| 279 | 3300006237 | Ga0097621_100004313 | Ga0097621_10000431311 | 274 |
| 280 | 3300006358 | Ga0068871_100008335 | Ga0068871_1000083354 | 274 |
| 281 | 3300006844 | Ga0075428_100213419 | Ga0075428_1002134192 | 274 |
| 282 | 3300006846 | Ga0075430_100125335 | Ga0075430_1001253352 | 274 |
| 283 | 3300009094 | Ga0111539_10059054 | Ga0111539_100590542 | 274 |
| 284 | 3300009094 | Ga0111539_10399916 | Ga0111539_103999162 | 274 |
| 285 | 3300009148 | Ga0105243_10002935 | Ga0105243_100029353 | 274 |
| 286 | 3300014969 | Ga0157376_10032509 | Ga0157376_100325093 | 274 |
| 287 | 3300025885 | Ga0207653_10071177 | Ga0207653_100711772 | 274 |
| 288 | 3300025908 | Ga0207643_10031169 | Ga0207643_100311692 | 274 |
| 289 | 3300025935 | Ga0207709_10013646 | Ga0207709_100136464 | 274 |
| 290 | 3300025938 | Ga0207704_10024596 | Ga0207704_100245962 | 274 |
| 291 | 3300025944 | Ga0207661_10040466 | Ga0207661_100404662 | 274 |
| 292 | 3300025972 | Ga0207668_10038805 | Ga0207668_100388054 | 274 |
| 293 | 3300026118 | Ga0207675_100020378 | Ga0207675_1000203786 | 274 |
| 294 | 3300027907 | Ga0207428_10198484 | Ga0207428_101984841 | 274 |
| 295 | 3300028380 | Ga0268265_10002203 | Ga0268265_1000220311 | 274 |
| 296 | 3300028380 | Ga0268265_10280955 | Ga0268265_102809552 | 274 |
| 297 | 3300031731 | Ga0307405_10279474 | Ga0307405_102794742 | 274 |
| 298 | 3300032002 | Ga0307416_100063467 | Ga0307416_1000634672 | 274 |
| 299 | 3300032005 | Ga0307411_10090119 | Ga0307411_100901192 | 274 |
| 300 | 3300035092 | Ga0373952_0019730 | Ga0373952_0019730_168_1034 | 274 |
| 301 | 3300035207 | Ga0373942_0051060 | Ga0373942_0051060_134_1000 | 274 |
| 302 | 3300035691 | Ga0373931_0026064 | Ga0373931_0026064_281_1147 | 274 |
| 303 | 3300048905 | Ga0496102_0064195 | Ga0496102_0064195_993_1868 | 274 |
| 304 | 3300048906 | Ga0496103_0048741 | Ga0496103_0048741_302_1177 | 274 |
| 305 | 3300050509 | nmdc:mga0qj67_215928_c1 | nmdc:mga0qj67_215928_c1_337_1203 | 274 |
| 306 | 3300050511 | nmdc:mga08y16_208965_c1 | nmdc:mga08y16_208965_c1_720_1586 | 274 |
| 307 | 3300050511 | nmdc:mga08y16_322987_c1 | nmdc:mga08y16_322987_c1_38_904 | 274 |
| 308 | iso_pu_bacteria | 2501025502 | 2501085711 | 274 |
| 309 | iso_pu_bacteria | 2510917013 | 2511094175 | 274 |
| 310 | iso_pu_bacteria | 2511231026 | 2511384284 | 274 |
| 311 | iso_pu_bacteria | 2521172590 | 2521559701 | 274 |
| 312 | iso_pu_bacteria | 2599185292 | 2599904324 | 274 |
| 313 | iso_pu_bacteria | 2643221569 | 2643863730 | 274 |
| 314 | iso_pu_bacteria | 2643221594 | 2643982933 | 274 |
| 315 | iso_pu_bacteria | 2643221621 | 2644123226 | 274 |
| 316 | iso_pu_bacteria | 2765235838 | 2765570959 | 274 |
| 317 | iso_pu_bacteria | 2808606386 | 2808984868 | 274 |
| 318 | iso_pu_bacteria | 2808606395 | 2809033523 | 274 |
| 319 | iso_pu_bacteria | 2808606415 | 2809128274 | 274 |
| 320 | iso_pu_bacteria | 2808606419 | 2809147895 | 274 |
| 321 | iso_pu_bacteria | 2818991449 | 2819616076 | 274 |
| 322 | iso_pu_bacteria | 2839094727 | 2839099350 | 274 |
| 323 | iso_pu_bacteria | 2852618963 | 2852620693 | 274 |
| 324 | iso_pu_bacteria | 2855730933 | 2855732900 | 274 |
| 325 | iso_pu_bacteria | 2855767633 | 2855771652 | 274 |
| 326 | iso_pu_bacteria | 2857357740 | 2857365990 | 274 |
| 327 | iso_pu_bacteria | 2857537821 | 2857537977 | 274 |
| 328 | iso_pu_bacteria | 2857542790 | 2857546546 | 274 |
| 329 | iso_pu_bacteria | 2881412998 | 2881413797 | 274 |
| 330 | iso_pu_bacteria | 2884811622 | 2884815355 | 274 |
| 331 | iso_pu_bacteria | 2884836552 | 2884841087 | 274 |
| 332 | iso_pu_bacteria | 2884852848 | 2884855962 | 274 |
| 333 | iso_pu_bacteria | 2896154374 | 2896157113 | 274 |
| 334 | iso_pu_bacteria | 2904479285 | 2904481438 | 274 |
| 335 | iso_pu_bacteria | 2904530477 | 2904533047 | 274 |
| 336 | iso_pu_bacteria | 2904584206 | 2904585602 | 274 |
| 337 | iso_pu_bacteria | 2904589729 | 2904593951 | 274 |
| 338 | iso_pu_bacteria | 2904601388 | 2904603896 | 274 |
| 339 | iso_pu_bacteria | 2919046199 | 2919047605 | 274 |
| 340 | iso_pu_bacteria | 2919079590 | 2919081866 | 274 |
| 341 | iso_pu_bacteria | 2919704043 | 2919708643 | 274 |
| 342 | iso_pu_bacteria | 2941479691 | 2941484218 | 274 |
| 343 | 3300003203 | JGI25406J46586_10047422 | JGI25406J46586_100474222 | 275 |
| 344 | 3300005330 | Ga0070690_100001504 | Ga0070690_1000015049 | 275 |
| 345 | 3300005334 | Ga0068869_100001561 | Ga0068869_1000015612 | 275 |
| 346 | 3300005336 | Ga0070680_100001721 | Ga0070680_1000017218 | 275 |
| 347 | 3300005337 | Ga0070682_100005629 | Ga0070682_1000056295 | 275 |
| 348 | 3300005338 | Ga0068868_100001141 | Ga0068868_10000114111 | 275 |
| 349 | 3300005341 | Ga0070691_10000844 | Ga0070691_100008446 | 275 |
| 350 | 3300005343 | Ga0070687_100000316 | Ga0070687_1000003169 | 275 |
| 351 | 3300005345 | Ga0070692_10003111 | Ga0070692_100031112 | 275 |
| 352 | 3300005354 | Ga0070675_100266311 | Ga0070675_1002663111 | 275 |
| 353 | 3300005355 | Ga0070671_100092729 | Ga0070671_1000927292 | 275 |
| 354 | 3300005364 | Ga0070673_100136273 | Ga0070673_1001362732 | 275 |
| 355 | 3300005406 | Ga0070703_10007083 | Ga0070703_100070832 | 275 |
| 356 | 3300005438 | Ga0070701_10006445 | Ga0070701_100064452 | 275 |
| 357 | 3300005440 | Ga0070705_100001322 | Ga0070705_1000013229 | 275 |
| 358 | 3300005444 | Ga0070694_100000228 | Ga0070694_10000022825 | 275 |
| 359 | 3300005445 | Ga0070708_100258455 | Ga0070708_1002584552 | 275 |
| 360 | 3300005458 | Ga0070681_10002377 | Ga0070681_1000237710 | 275 |
| 361 | 3300005459 | Ga0068867_100004278 | Ga0068867_1000042785 | 275 |
| 362 | 3300005530 | Ga0070679_100015857 | Ga0070679_1000158573 | 275 |
| 363 | 3300005536 | Ga0070697_100016288 | Ga0070697_1000162882 | 275 |
| 364 | 3300005544 | Ga0070686_100001157 | Ga0070686_10000115711 | 275 |
| 365 | 3300005545 | Ga0070695_100000946 | Ga0070695_1000009469 | 275 |
| 366 | 3300005545 | Ga0070695_100011344 | Ga0070695_1000113442 | 275 |
| 367 | 3300005545 | Ga0070695_100108288 | Ga0070695_1001082881 | 275 |
| 368 | 3300005546 | Ga0070696_100001500 | Ga0070696_10000150020 | 275 |
| 369 | 3300005546 | Ga0070696_100002309 | Ga0070696_10000230914 | 275 |
| 370 | 3300005547 | Ga0070693_100000451 | Ga0070693_10000045110 | 275 |
| 371 | 3300005547 | Ga0070693_100143976 | Ga0070693_1001439762 | 275 |
| 372 | 3300005549 | Ga0070704_100001349 | Ga0070704_1000013499 | 275 |
| 373 | 3300005563 | Ga0068855_100003762 | Ga0068855_10000376212 | 275 |
| 374 | 3300005578 | Ga0068854_100013003 | Ga0068854_1000130032 | 275 |
| 375 | 3300005615 | Ga0070702_100000148 | Ga0070702_10000014810 | 275 |
| 376 | 3300005616 | Ga0068852_100063710 | Ga0068852_1000637102 | 275 |
| 377 | 3300005617 | Ga0068859_100002466 | Ga0068859_1000024669 | 275 |
| 378 | 3300005718 | Ga0068866_10000302 | Ga0068866_1000030212 | 275 |
| 379 | 3300005719 | Ga0068861_100002875 | Ga0068861_1000028756 | 275 |
| 380 | 3300005842 | Ga0068858_100004157 | Ga0068858_1000041575 | 275 |
| 381 | 3300005843 | Ga0068860_100008220 | Ga0068860_1000082206 | 275 |
| 382 | 3300005844 | Ga0068862_100004540 | Ga0068862_10000454012 | 275 |
| 383 | 3300005985 | Ga0081539_10003560 | Ga0081539_100035604 | 275 |
| 384 | 3300006237 | Ga0097621_100003364 | Ga0097621_1000033649 | 275 |
| 385 | 3300006358 | Ga0068871_100001348 | Ga0068871_1000013489 | 275 |
| 386 | 3300006844 | Ga0075428_100001160 | Ga0075428_10000116027 | 275 |
| 387 | 3300006852 | Ga0075433_10078004 | Ga0075433_100780041 | 275 |
| 388 | 3300006871 | Ga0075434_100005264 | Ga0075434_10000526411 | 275 |
| 389 | 3300006880 | Ga0075429_100000076 | Ga0075429_10000007649 | 275 |
| 390 | 3300006881 | Ga0068865_100001770 | Ga0068865_1000017708 | 275 |
| 391 | 3300006914 | Ga0075436_100003398 | Ga0075436_1000033985 | 275 |
| 392 | 3300006931 | Ga0097620_100002466 | Ga0097620_1000024669 | 275 |
| 393 | 3300009094 | Ga0111539_10070243 | Ga0111539_100702432 | 275 |
| 394 | 3300009098 | Ga0105245_10001017 | Ga0105245_1000101712 | 275 |
| 395 | 3300009147 | Ga0114129_10000791 | Ga0114129_1000079138 | 275 |
| 396 | 3300009148 | Ga0105243_10002797 | Ga0105243_100027973 | 275 |
| 397 | 3300009176 | Ga0105242_10001715 | Ga0105242_1000171511 | 275 |
| 398 | 3300009177 | Ga0105248_10245441 | Ga0105248_102454412 | 275 |
| 399 | 3300009553 | Ga0105249_10004241 | Ga0105249_100042413 | 275 |
| 400 | 3300011119 | Ga0105246_10180676 | Ga0105246_101806762 | 275 |
| 401 | 3300013297 | Ga0157378_10003629 | Ga0157378_100036292 | 275 |
| 402 | 3300013306 | Ga0163162_10165328 | Ga0163162_101653282 | 275 |
| 403 | 3300014968 | Ga0157379_10290581 | Ga0157379_102905812 | 275 |
| 404 | 3300014969 | Ga0157376_10001701 | Ga0157376_100017019 | 275 |
| 405 | 3300025885 | Ga0207653_10010080 | Ga0207653_100100802 | 275 |
| 406 | 3300025899 | Ga0207642_10001745 | Ga0207642_100017453 | 275 |
| 407 | 3300025907 | Ga0207645_10103419 | Ga0207645_101034192 | 275 |
| 408 | 3300025912 | Ga0207707_10034183 | Ga0207707_100341832 | 275 |
| 409 | 3300025918 | Ga0207662_10000479 | Ga0207662_100004795 | 275 |
| 410 | 3300025926 | Ga0207659_10133119 | Ga0207659_101331192 | 275 |
| 411 | 3300025927 | Ga0207687_10001010 | Ga0207687_1000101012 | 275 |
| 412 | 3300025934 | Ga0207686_10002110 | Ga0207686_100021108 | 275 |
| 413 | 3300025935 | Ga0207709_10000532 | Ga0207709_1000053217 | 275 |
| 414 | 3300025936 | Ga0207670_10034477 | Ga0207670_100344772 | 275 |
| 415 | 3300025938 | Ga0207704_10003136 | Ga0207704_100031366 | 275 |
| 416 | 3300025941 | Ga0207711_10263704 | Ga0207711_102637042 | 275 |
| 417 | 3300025942 | Ga0207689_10001100 | Ga0207689_100011009 | 275 |
| 418 | 3300025949 | Ga0207667_10011796 | Ga0207667_100117963 | 275 |
| 419 | 3300025960 | Ga0207651_10069988 | Ga0207651_100699882 | 275 |
| 420 | 3300025961 | Ga0207712_10006700 | Ga0207712_100067004 | 275 |
| 421 | 3300025981 | Ga0207640_10013112 | Ga0207640_100131122 | 275 |
| 422 | 3300026023 | Ga0207677_10002179 | Ga0207677_100021794 | 275 |
| 423 | 3300026035 | Ga0207703_10018088 | Ga0207703_100180883 | 275 |
| 424 | 3300026075 | Ga0207708_10001959 | Ga0207708_100019598 | 275 |
| 425 | 3300026089 | Ga0207648_10001964 | Ga0207648_1000196410 | 275 |
| 426 | 3300026118 | Ga0207675_100000089 | Ga0207675_10000008964 | 275 |
| 427 | 3300026142 | Ga0207698_10049484 | Ga0207698_100494842 | 275 |
| 428 | 3300027907 | Ga0207428_10001985 | Ga0207428_1000198515 | 275 |
| 429 | 3300028380 | Ga0268265_10008737 | Ga0268265_100087373 | 275 |
| 430 | 3300028381 | Ga0268264_10003987 | Ga0268264_100039879 | 275 |
| 431 | 3300034818 | Ga0373950_0015194 | Ga0373950_0015194_341_1210 | 275 |
| 432 | 3300034819 | Ga0373958_0018831 | Ga0373958_0018831_191_1060 | 275 |
| 433 | 3300034820 | Ga0373959_0028411 | Ga0373959_0028411_143_1012 | 275 |
| 434 | 3300035083 | Ga0373926_0009660 | Ga0373926_0009660_288_1157 | 275 |
| 435 | 3300035084 | Ga0373928_0007841 | Ga0373928_0007841_1110_1979 | 275 |
| 436 | 3300035115 | Ga0373941_0008916 | Ga0373941_0008916_299_1168 | 275 |
| 437 | 3300035115 | Ga0373941_0021741 | Ga0373941_0021741_461_1330 | 275 |
| 438 | 3300035242 | Ga0373962_0008807 | Ga0373962_0008807_513_1382 | 275 |
| 439 | 3300035691 | Ga0373931_0002999 | Ga0373931_0002999_1368_2237 | 275 |
| 440 | 3300035692 | Ga0373935_0050988 | Ga0373935_0050988_1165_2034 | 275 |
| 441 | 3300035695 | Ga0373927_0018551 | Ga0373927_0018551_515_1384 | 275 |
| 442 | 3300035725 | Ga0373947_0146659 | Ga0373947_0146659_594_1463 | 275 |
| 443 | 3300037068 | Ga0373925_0032753 | Ga0373925_0032753_1237_2106 | 275 |
| 444 | 3300046455 | Ga0495603_0003735 | Ga0495603_0003735_1553_2422 | 275 |
| 445 | 3300046472 | Ga0495580_0014864 | Ga0495580_0014864_1472_2341 | 275 |
| 446 | 3300046526 | Ga0495666_0059438 | Ga0495666_0059438_293_1162 | 275 |
| 447 | 3300046535 | Ga0495586_0004499 | Ga0495586_0004499_837_1706 | 275 |
| 448 | 3300046674 | Ga0495588_0028228 | Ga0495588_0028228_549_1418 | 275 |
| 449 | 3300046681 | Ga0495647_0000551 | Ga0495647_0000551_2628_3497 | 275 |
| 450 | 3300047321 | Ga0495676_0034950 | Ga0495676_0034950_1771_2640 | 275 |
| 451 | 3300049577 | Ga0501041_0066512 | Ga0501041_0066512_602_1471 | 275 |
| 452 | 3300049578 | Ga0501042_0357326 | Ga0501042_0357326_39_908 | 275 |
| 453 | 3300049588 | Ga0501072_0243928 | Ga0501072_0243928_455_1324 | 275 |
| 454 | 3300049591 | Ga0501075_0020339 | Ga0501075_0020339_3913_4782 | 275 |
| 455 | 3300049592 | Ga0501076_0321160 | Ga0501076_0321160_327_1196 | 275 |
| 456 | 3300049741 | Ga0501079_0172978 | Ga0501079_0172978_72_941 | 275 |
| 457 | 3300050507 | nmdc:mga05p37_72_c1 | nmdc:mga05p37_72_c1_51822_52691 | 275 |
| 458 | 3300050508 | nmdc:mga09592_739_c1 | nmdc:mga09592_739_c1_16093_16962 | 275 |
| 459 | 3300050511 | nmdc:mga08y16_171471_c1 | nmdc:mga08y16_171471_c1_470_1339 | 275 |
| 460 | 3300050512 | nmdc:mga0n895_16072_c1 | nmdc:mga0n895_16072_c1_4657_5526 | 275 |
| 461 | 3300050513 | nmdc:mga0rr50_2265_c1 | nmdc:mga0rr50_2265_c1_2875_3744 | 275 |
| 462 | 3300050514 | nmdc:mga08x19_1264_c1 | nmdc:mga08x19_1264_c1_10703_11572 | 275 |
| 463 | 3300050514 | nmdc:mga08x19_67646_c1 | nmdc:mga08x19_67646_c1_866_1735 | 275 |
| 464 | 3300050515 | nmdc:mga0a205_3570_c1 | nmdc:mga0a205_3570_c1_9907_10776 | 275 |
| 465 | 3300061734 | Ga0530510_0112172 | Ga0530510_0112172_1075_1944 | 275 |
| 466 | 3300005331 | Ga0070670_100098452 | Ga0070670_1000984522 | 276 |
| 467 | 3300005331 | Ga0070670_100166975 | Ga0070670_1001669752 | 276 |
| 468 | 3300005334 | Ga0068869_100133284 | Ga0068869_1001332842 | 276 |
| 469 | 3300005336 | Ga0070680_100082831 | Ga0070680_1000828312 | 276 |
| 470 | 3300005345 | Ga0070692_10118551 | Ga0070692_101185512 | 276 |
| 471 | 3300005455 | Ga0070663_100062582 | Ga0070663_1000625822 | 276 |
| 472 | 3300005546 | Ga0070696_100063729 | Ga0070696_1000637292 | 276 |
| 473 | 3300005577 | Ga0068857_100113906 | Ga0068857_1001139062 | 276 |
| 474 | 3300005617 | Ga0068859_100034852 | Ga0068859_1000348523 | 276 |
| 475 | 3300006846 | Ga0075430_100021532 | Ga0075430_1000215324 | 276 |
| 476 | 3300006931 | Ga0097620_100034852 | Ga0097620_1000348522 | 276 |
| 477 | 3300009093 | Ga0105240_10017559 | Ga0105240_100175598 | 276 |
| 478 | 3300009101 | Ga0105247_10017168 | Ga0105247_100171683 | 276 |
| 479 | 3300009148 | Ga0105243_10229159 | Ga0105243_102291592 | 276 |
| 480 | 3300009174 | Ga0105241_10050931 | Ga0105241_100509312 | 276 |
| 481 | 3300009174 | Ga0105241_10149270 | Ga0105241_101492702 | 276 |
| 482 | 3300013104 | Ga0157370_10167458 | Ga0157370_101674582 | 276 |
| 483 | 3300013105 | Ga0157369_10002831 | Ga0157369_100028311 | 276 |
| 484 | 3300013307 | Ga0157372_10385642 | Ga0157372_103856422 | 276 |
| 485 | 3300014325 | Ga0163163_10114033 | Ga0163163_101140332 | 276 |
| 486 | 3300025901 | Ga0207688_10019224 | Ga0207688_100192242 | 276 |
| 487 | 3300025908 | Ga0207643_10047240 | Ga0207643_100472402 | 276 |
| 488 | 3300025911 | Ga0207654_10070263 | Ga0207654_100702631 | 276 |
| 489 | 3300025919 | Ga0207657_10022419 | Ga0207657_100224194 | 276 |
| 490 | 3300025921 | Ga0207652_10320551 | Ga0207652_103205512 | 276 |
| 491 | 3300025924 | Ga0207694_10022358 | Ga0207694_100223583 | 276 |
| 492 | 3300025927 | Ga0207687_10153040 | Ga0207687_101530402 | 276 |
| 493 | 3300025942 | Ga0207689_10009573 | Ga0207689_100095732 | 276 |
| 494 | 3300025981 | Ga0207640_10418639 | Ga0207640_104186391 | 276 |
| 495 | 3300026067 | Ga0207678_10000797 | Ga0207678_100007979 | 276 |
| 496 | 3300026078 | Ga0207702_10073673 | Ga0207702_100736732 | 276 |
| 497 | 3300026095 | Ga0207676_10097972 | Ga0207676_100979722 | 276 |
| 498 | 3300027614 | Ga0209970_1008636 | Ga0209970_10086362 | 276 |
| 499 | 3300031344 | Ga0265316_10083565 | Ga0265316_100835652 | 276 |
| 500 | 3300032002 | Ga0307416_100534844 | Ga0307416_1005348442 | 276 |
| 501 | 3300042156 | Ga0439446_0036701 | Ga0439446_0036701_347_1222 | 276 |
| 502 | 3300045051 | Ga0451576_0143917 | Ga0451576_0143917_1322_2197 | 276 |
| 503 | 3300045976 | Ga0466967_0512990 | Ga0466967_0512990_52_969 | 276 |
| 504 | 3300046474 | Ga0495605_0038636 | Ga0495605_0038636_1313_2188 | 276 |
| 505 | 3300046642 | Ga0495634_0141893 | Ga0495634_0141893_86_958 | 276 |
| 506 | 3300046674 | Ga0495588_0091117 | Ga0495588_0091117_32_907 | 276 |
| 507 | 3300049570 | Ga0501033_0104094 | Ga0501033_0104094_718_1590 | 276 |
| 508 | 3300049571 | Ga0501034_0219609 | Ga0501034_0219609_637_1509 | 276 |
| 509 | 3300049573 | Ga0501037_0030270 | Ga0501037_0030270_1004_1876 | 276 |
| 510 | 3300049574 | Ga0501038_0018785 | Ga0501038_0018785_1176_2048 | 276 |
| 511 | 3300049575 | Ga0501039_0034728 | Ga0501039_0034728_135_1010 | 276 |
| 512 | 3300049588 | Ga0501072_0159215 | Ga0501072_0159215_374_1246 | 276 |
| 513 | 3300049592 | Ga0501076_0168335 | Ga0501076_0168335_527_1402 | 276 |
| 514 | 3300049741 | Ga0501079_0100210 | Ga0501079_0100210_769_1641 | 276 |
| 515 | 3300049742 | Ga0501080_0025403 | Ga0501080_0025403_3695_4567 | 276 |
| 516 | 3300049823 | Ga0501044_0013470 | Ga0501044_0013470_4274_5146 | 276 |
| 517 | 3300049824 | Ga0501045_0014711 | Ga0501045_0014711_2271_3146 | 276 |
| 518 | 3300050509 | nmdc:mga0qj67_135341_c1 | nmdc:mga0qj67_135341_c1_855_1727 | 276 |
| 519 | 3300050510 | nmdc:mga06r32_10136_c2 | nmdc:mga06r32_10136_c2_10_882 | 276 |
| 520 | 3300050514 | nmdc:mga08x19_91732_c1 | nmdc:mga08x19_91732_c1_467_1339 | 276 |
| 521 | 3300060353 | Ga0501082_0184640 | Ga0501082_0184640_432_1304 | 276 |
| 522 | 3300060353 | Ga0501082_0229799 | Ga0501082_0229799_356_1228 | 276 |
| 523 | 3300003771 | Ga0055526_1023825 | Ga0055526_10238252 | 277 |
| 524 | 3300003773 | Ga0055537_1000780 | Ga0055537_10007808 | 277 |
| 525 | 3300003784 | Ga0055534_1000394 | Ga0055534_10003947 | 277 |
| 526 | 3300006051 | Ga0075364_10131018 | Ga0075364_101310182 | 277 |
| 527 | 3300025263 | Ga0209565_1000426 | Ga0209565_100042623 | 277 |
| 528 | 3300025291 | Ga0209675_1000426 | Ga0209675_10004268 | 277 |
| 529 | 3300025294 | Ga0209025_1001800 | Ga0209025_10018003 | 277 |
| 530 | 3300025295 | Ga0209564_1004730 | Ga0209564_10047308 | 277 |
| 531 | 3300025297 | Ga0209758_1015363 | Ga0209758_10153632 | 277 |
| 532 | 3300025299 | Ga0209256_1003493 | Ga0209256_10034938 | 277 |
| 533 | 3300050491 | nmdc:mga00v17_158968_c1 | nmdc:mga00v17_158968_c1_59_934 | 277 |
| 534 | 3300003187 | JGI25151J46595_10002159 | JGI25151J46595_100021592 | 278 |
| 535 | 3300003187 | JGI25151J46595_10013441 | JGI25151J46595_100134413 | 278 |
| 536 | 3300003751 | Ga0055538_1000141 | Ga0055538_100014115 | 278 |
| 537 | 3300003752 | Ga0055539_1000192 | Ga0055539_100019215 | 278 |
| 538 | 3300003756 | Ga0055533_1000192 | Ga0055533_100019215 | 278 |
| 539 | 3300003759 | Ga0055525_1000260 | Ga0055525_100026035 | 278 |
| 540 | 3300003775 | Ga0055524_1001799 | Ga0055524_10017993 | 278 |
| 541 | 3300003841 | Ga0055541_1000127 | Ga0055541_100012715 | 278 |
| 542 | 3300005563 | Ga0068855_100047077 | Ga0068855_1000470775 | 278 |
| 543 | 3300005577 | Ga0068857_100299946 | Ga0068857_1002999462 | 278 |
| 544 | 3300009093 | Ga0105240_10030486 | Ga0105240_100304862 | 278 |
| 545 | 3300009545 | Ga0105237_10021166 | Ga0105237_100211666 | 278 |
| 546 | 3300009545 | Ga0105237_10581476 | Ga0105237_105814761 | 278 |
| 547 | 3300009551 | Ga0105238_10000006 | Ga0105238_10000006237 | 278 |
| 548 | 3300010375 | Ga0105239_10002999 | Ga0105239_100029999 | 278 |
| 549 | 3300015261 | Ga0182006_1001498 | Ga0182006_10014985 | 278 |
| 550 | 3300021361 | Ga0213872_10018675 | Ga0213872_100186752 | 278 |
| 551 | 3300025224 | Ga0209784_100009 | Ga0209784_100009529 | 278 |
| 552 | 3300025225 | Ga0209566_100007 | Ga0209566_100007529 | 278 |
| 553 | 3300025226 | Ga0209674_100018 | Ga0209674_100018529 | 278 |
| 554 | 3300025230 | Ga0209563_100020 | Ga0209563_100020529 | 278 |
| 555 | 3300025253 | Ga0209677_100010 | Ga0209677_100010529 | 278 |
| 556 | 3300025284 | Ga0209130_1009566 | Ga0209130_10095662 | 278 |
| 557 | 3300025294 | Ga0209025_1000019 | Ga0209025_1000019188 | 278 |
| 558 | 3300025298 | Ga0209050_1026989 | Ga0209050_10269892 | 278 |
| 559 | 3300025304 | Ga0209257_1011872 | Ga0209257_10118722 | 278 |
| 560 | 3300025321 | Ga0207656_10085700 | Ga0207656_100857001 | 278 |
| 561 | 3300025913 | Ga0207695_10002139 | Ga0207695_1000213915 | 278 |
| 562 | 3300025914 | Ga0207671_10009496 | Ga0207671_100094962 | 278 |
| 563 | 3300025924 | Ga0207694_10000110 | Ga0207694_1000011048 | 278 |
| 564 | 3300025949 | Ga0207667_10016670 | Ga0207667_100166708 | 278 |
| 565 | 3300026116 | Ga0207674_10235166 | Ga0207674_102351663 | 278 |
| 566 | 3300027614 | Ga0209970_1000507 | Ga0209970_10005073 | 278 |
| 567 | 3300028794 | Ga0307515_10095051 | Ga0307515_100950512 | 278 |
| 568 | 3300033180 | Ga0307510_10037495 | Ga0307510_100374954 | 278 |
| 569 | 3300039447 | Ga0436361_0168918 | Ga0436361_0168918_1461_2339 | 278 |
| 570 | 3300042004 | Ga0439445_0012060 | Ga0439445_0012060_797_1675 | 278 |
| 571 | 3300042115 | Ga0450911_000322 | Ga0450911_000322_5235_6113 | 278 |
| 572 | 3300046530 | Ga0495654_0003050 | Ga0495654_0003050_4951_5829 | 278 |
| 573 | 3300047472 | Ga0495686_0124868 | Ga0495686_0124868_299_1177 | 278 |
| 574 | 3300048924 | Ga0496121_0004161 | Ga0496121_0004161_5069_5947 | 278 |
| 575 | 3300048928 | Ga0496125_0022455 | Ga0496125_0022455_4170_5048 | 278 |
| 576 | 3300048928 | Ga0496125_0029702 | Ga0496125_0029702_388_1266 | 278 |
| 577 | 3300053088 | Ga0500644_0027330 | Ga0500644_0027330_91_969 | 278 |
| 578 | 3300053088 | Ga0500644_0044142 | Ga0500644_0044142_393_1271 | 278 |
| 579 | 3300053108 | Ga0500562_002948 | Ga0500562_002948_714_1592 | 278 |
| 580 | 3300053118 | Ga0500594_0011571 | Ga0500594_0011571_653_1531 | 278 |
| 581 | 3300053136 | Ga0500559_0000047 | Ga0500559_0000047_94187_95065 | 278 |
| 582 | 3300053145 | Ga0500586_051960 | Ga0500586_051960_431_1309 | 278 |
| 583 | 3300053156 | Ga0500622_0006088 | Ga0500622_0006088_496_1374 | 278 |
| 584 | iso_pu_bacteria | 2904439833 | 2904443338 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.568 | 5 | 261 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5412 | 1 | 263 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5362 | 4 | 263 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5324 | 4 | 264 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5272 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7946 | 7 | 261 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7867 | 10 | 261 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7697 | 7 | 260 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7664 | 7 | 262 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.758 | 10 | 260 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I7PDL1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8683 | 4 | 271 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A7V9JNY4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.868 | 3 | 265 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1M3NRV2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8576 | 3 | 268 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1N7CM48-F1-model_v4 | Branched-chain amino acid transport system permease protein | 0.8571 | 2 | 265 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A7C8EH00-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8559 | 2 | 268 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar