F466230

General Info

Members Datasets Scaffolds Average Seq Length
582 380 443 427

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885409591|2885410605
Length 463
Sequence VEQAKPFSVRRAALAATVGNMLEFYDFITYSFFAIQIGHAFFPTQSEYSSLMLSLATFGAGFVTRPIGGIVLGIYSDRIGRRPAMLLSFALMGASILTIALTPSYQAIGLAAPIIVIAARMAQGFALGGEVGPTTAYLIEIAPPEHRALVVAWQPASQEIAATAGALVGVILSKTMAPEMLDSHGWRVAFLIGAVCLPFGLWMRRTLPETIPQAGAAVAAKERTGHLSLARRHLGVIALALMILASGTISTYVTQYMTTYAQNTLHVSSTLAFAVSLVSNGIQFVGALVGGWLADRLGRKPVMIWPQLATLLLTYPTFLWIVHAPGSLSLLVGFGLLSVIGSLPFTAFYATFTEALPQNIRGGVFATVYAVAIASFGGTAQLVVTWLLHVTGNPLAPAWYLLLAAIVGLVAMSLMPRDCARETASVADLKAPRSQAGDLRFAGKCRRMRRLKGQGQASGRINR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
17 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
18 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
24 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
28 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
29 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
30 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
31 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
32 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
33 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
34 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
35 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
36 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
37 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
38 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
39 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
40 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
41 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
42 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
43 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
44 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
45 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
46 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
47 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
48 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
49 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
52 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
53 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
54 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
55 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
56 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
57 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
58 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
59 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
60 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
61 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
62 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
63 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
64 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
65 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
66 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
67 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
68 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
69 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
70 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
71 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
72 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
73 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
74 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
75 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
76 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
77 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
78 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
79 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
80 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
81 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
82 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
83 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
84 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
85 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
86 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
87 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
88 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
89 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
90 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
91 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
92 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
93 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
94 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
95 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
96 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
97 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
98 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
99 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
100 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
101 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
102 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
103 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
104 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
105 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
106 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
107 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
108 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
109 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
113 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
117 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
118 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
119 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
120 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
126 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
127 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
128 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
129 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
130 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
133 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
134 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
139 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
140 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
141 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
145 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
146 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
149 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
152 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
155 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
158 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
159 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
178 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
179 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
180 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
181 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
182 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
215 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
216 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
217 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
349 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
355 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
356 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
357 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
358 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
359 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
360 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
361 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
362 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
363 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
364 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
365 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
366 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
367 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
368 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
369 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
370 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
371 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
372 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
373 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
374 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
375 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
376 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
377 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
378 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
379 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
380 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.21
Metatranscriptomes 0
Isolates 23.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 21.13
Rhizoplane 2.92
Rhizosphere 64.26
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10136250 3300003320 Bacteria 1834
2 rootH1_10000078 3300003316 Eukaryota 42637
3 rootH1_10000078 3300003323 Bacteria 67721
4 rootH1_10044398 3300003323 Bacteria 2449
5 Ga0065165_1001979 3300005262 Bacteria 19337
6 Ga0070658_10007786 3300005327 Bacteria 8636
7 Ga0070658_10016353 3300005327 Bacteria 5937
8 Ga0070666_10004407 3300005335 Bacteria 8573
9 Ga0070666_10051770 3300005335 Bacteria 2766
10 Ga0070680_100119061 3300005336 Bacteria 2203
11 Ga0070680_100134469 3300005336 Unclassified 2070
12 Ga0070680_100189927 3300005336 Bacteria 1731
13 Ga0070682_100022924 3300005337 Bacteria 3704
14 Ga0070660_100001478 3300005339 Bacteria 16088
15 Ga0070660_100024150 3300005339 Bacteria 4510
16 Ga0070660_100117743 3300005339 Bacteria 2118
17 Ga0070689_100024190 3300005340 Bacteria 4554
18 Ga0070691_10003145 3300005341 Bacteria 7387
19 Ga0070691_10003712 3300005341 Bacteria 6897
20 Ga0070687_100068196 3300005343 Bacteria 1901
21 Ga0070661_100000973 3300005344 Bacteria 20394
22 Ga0070692_10071052 3300005345 Bacteria 1854
23 Ga0070669_100000666 3300005353 Bacteria 25307
24 Ga0070675_100000119 3300005354 Bacteria 46621
25 Ga0070671_100000052 3300005355 Bacteria 78614
26 Ga0070659_100024053 3300005366 Bacteria 4667
27 Ga0070659_100026753 3300005366 Bacteria 4441
28 Ga0070709_10003415 3300005434 Bacteria 8527
29 Ga0070709_10105681 3300005434 Bacteria 1883
30 Ga0070714_100041715 3300005435 Bacteria 3874
31 Ga0070714_100114728 3300005435 Bacteria 2390
32 Ga0070713_100000098 3300005436 Bacteria 55237
33 Ga0070713_100040171 3300005436 Bacteria 3803
34 Ga0070711_100077093 3300005439 Unclassified 2365
35 Ga0070705_100017833 3300005440 Unclassified 3711
36 Ga0070663_100017202 3300005455 Bacteria 4713
37 Ga0070663_100049099 3300005455 Bacteria 2995
38 Ga0070663_100113945 3300005455 Bacteria 2035
39 Ga0070681_10008604 3300005458 Bacteria 10005
40 Ga0070681_10066680 3300005458 Bacteria 3568
41 Ga0070681_10073729 3300005458 Bacteria 3375
42 Ga0070681_10080543 3300005458 Bacteria 3212
43 Ga0070681_10085862 3300005458 Bacteria 3100
44 Ga0070681_10263229 3300005458 Unclassified 1636
45 Ga0070707_100335807 3300005468 Bacteria 1468
46 Ga0070679_100097236 3300005530 Bacteria 2932
47 Ga0070679_100121645 3300005530 Bacteria 2594
48 Ga0070679_100173165 3300005530 Bacteria 2131
49 Ga0070679_100188802 3300005530 Unclassified 2030
50 Ga0070679_100220006 3300005530 Bacteria 1860
51 Ga0070684_100064787 3300005535 Bacteria 3206
52 Ga0068853_100106225 3300005539 Bacteria 2488
53 Ga0068853_100186338 3300005539 Bacteria 1884
54 Ga0070665_100111044 3300005548 Bacteria 2744
55 Ga0070665_100197241 3300005548 Bacteria 2014
56 Ga0068855_100000969 3300005563 Bacteria 35741
57 Ga0068855_100004762 3300005563 Bacteria 16574
58 Ga0068855_100062658 3300005563 Bacteria 4341
59 Ga0068855_100065064 3300005563 Bacteria 4251
60 Ga0068855_100119481 3300005563 Bacteria 3018
61 Ga0068857_100058501 3300005577 Bacteria 3423
62 Ga0068854_100197022 3300005578 Bacteria 1581
63 Ga0068856_100000185 3300005614 Bacteria 64973
64 Ga0068856_100011089 3300005614 Bacteria 8753
65 Ga0070702_100041779 3300005615 Bacteria 2574
66 Ga0068852_100002430 3300005616 Bacteria 12818
67 Ga0068852_100095842 3300005616 Bacteria 2665
68 Ga0068859_100003457 3300005617 Bacteria 16054
69 Ga0068859_100006645 3300005617 Bacteria 11745
70 Ga0068864_100095962 3300005618 Bacteria 2624
71 Ga0068858_100064691 3300005842 Bacteria 3385
72 Ga0068860_100163597 3300005843 Bacteria 2146
73 Ga0068862_100082776 3300005844 Bacteria 2786
74 Ga0068862_100111594 3300005844 Bacteria 2401
75 Ga0081540_1015177 3300005983 Bacteria 4889
76 Ga0070717_10070911 3300006028 Bacteria 2905
77 Ga0070712_100001103 3300006175 Bacteria 16258
78 Ga0068871_100023256 3300006358 Bacteria 4791
79 Ga0075428_100005189 3300006844 Bacteria 14466
80 Ga0075433_10100649 3300006852 Bacteria 2559
81 Ga0075429_100076823 3300006880 Bacteria 2909
82 Ga0075436_100000092 3300006914 Bacteria 52229
83 Ga0097620_100003457 3300006931 Bacteria 16054
84 Ga0097620_100006646 3300006931 Bacteria 11745
85 Ga0099824_1024320 3300006942 Bacteria 3574
86 Ga0099822_1017407 3300006943 Bacteria 7683
87 Ga0099823_1001127 3300006944 Bacteria 21041
88 Ga0105240_10000174 3300009093 Bacteria 131157
89 Ga0105240_10004270 3300009093 Bacteria 21845
90 Ga0105240_10004424 3300009093 Bacteria 21427
91 Ga0105240_10022005 3300009093 Bacteria 8467
92 Ga0105240_10022411 3300009093 Bacteria 8373
93 Ga0105240_10055701 3300009093 Bacteria 4950
94 Ga0105240_10155938 3300009093 Bacteria 2716
95 Ga0105240_10248443 3300009093 Bacteria 2059
96 Ga0114129_10001734 3300009147 Bacteria 29705
97 Ga0105241_10007495 3300009174 Bacteria 8031
98 Ga0105241_10069696 3300009174 Bacteria 2727
99 Ga0105248_10010547 3300009177 Bacteria 10179
100 Ga0105248_10110648 3300009177 Bacteria 3097
101 Ga0105248_10324650 3300009177 Bacteria 1734
102 Ga0105237_10006823 3300009545 Bacteria 12586
103 Ga0105237_10046867 3300009545 Bacteria 4346
104 Ga0105237_10111042 3300009545 Bacteria 2733
105 Ga0105238_10013556 3300009551 Bacteria 8230
106 Ga0105238_10024972 3300009551 Bacteria 6091
107 Ga0105238_10027218 3300009551 Bacteria 5826
108 Ga0105238_10131174 3300009551 Bacteria 2484
109 Ga0105238_10332520 3300009551 Bacteria 1506
110 Ga0105239_10004250 3300010375 Bacteria 17201
111 Ga0105239_10015385 3300010375 Bacteria 8476
112 Ga0105239_10039339 3300010375 Bacteria 5182
113 Ga0105239_10057021 3300010375 Bacteria 4285
114 Ga0105239_10144193 3300010375 Bacteria 2655
115 Ga0157373_10000750 3300013100 Bacteria 25167
116 Ga0157373_10007009 3300013100 Bacteria 8396
117 Ga0157371_10023530 3300013102 Bacteria 4505
118 Ga0157370_10027803 3300013104 Bacteria 5574
119 Ga0157370_10133451 3300013104 Unclassified 2315
120 Ga0157369_10003147 3300013105 Bacteria 19702
121 Ga0157369_10015815 3300013105 Bacteria 8499
122 Ga0157369_10041195 3300013105 Bacteria 5041
123 Ga0157369_10054573 3300013105 Bacteria 4315
124 Ga0157369_10112957 3300013105 Bacteria 2886
125 Ga0157374_10006163 3300013296 Bacteria 10162
126 Ga0157374_10081973 3300013296 Bacteria 3062
127 Ga0157372_10013120 3300013307 Bacteria 8839
128 Ga0157372_10029012 3300013307 Bacteria 6037
129 Ga0157372_10049646 3300013307 Bacteria 4666
130 Ga0157372_10097663 3300013307 Bacteria 3350
131 Ga0157372_10171779 3300013307 Bacteria 2508
132 Ga0157372_10286273 3300013307 Bacteria 1916
133 Ga0157375_10041910 3300013308 Bacteria 4425
134 Ga0157375_10091083 3300013308 Unclassified 3110
135 Ga0163163_10044799 3300014325 Bacteria 4341
136 Ga0163163_10256669 3300014325 Bacteria 1799
137 Ga0157379_10061572 3300014968 Bacteria 3356
138 Ga0157379_10113226 3300014968 Bacteria 2438
139 Ga0157376_10146842 3300014969 Bacteria 2122
140 Ga0214544_1008275 3300021320 Bacteria 17448
141 Ga0214542_1012703 3300021321 Bacteria 10649
142 Ga0214545_1012219 3300021324 Bacteria 11354
143 Ga0214543_1012996 3300021327 Bacteria 10733
144 Ga0213873_10008076 3300021358 Bacteria 2136
145 Ga0213876_10000211 3300021384 Bacteria 58741
146 Ga0213876_10000254 3300021384 Bacteria 50324
147 Ga0213876_10058872 3300021384 Bacteria 2028
148 Ga0209148_1000303 3300025254 Bacteria 70843
149 Ga0209455_1004209 3300025272 Bacteria 4799
150 Ga0209455_1016084 3300025272 Bacteria 1620
151 Ga0207426_1000504 3300025302 Bacteria 57637
152 Ga0207680_10001907 3300025903 Bacteria 9781
153 Ga0207680_10013305 3300025903 Bacteria 4223
154 Ga0207680_10032019 3300025903 Bacteria 2984
155 Ga0207699_10000212 3300025906 Bacteria 34595
156 Ga0207699_10013284 3300025906 Bacteria 4211
157 Ga0207699_10068473 3300025906 Bacteria 2161
158 Ga0207705_10000575 3300025909 Bacteria 30759
159 Ga0207654_10021094 3300025911 Bacteria 3460
160 Ga0207707_10000173 3300025912 Bacteria 67122
161 Ga0207707_10000995 3300025912 Bacteria 27205
162 Ga0207707_10201548 3300025912 Bacteria 1735
163 Ga0207695_10000004 3300025913 Bacteria 1288665
164 Ga0207695_10002655 3300025913 Bacteria 26142
165 Ga0207695_10016347 3300025913 Bacteria 8684
166 Ga0207695_10028448 3300025913 Bacteria 6198
167 Ga0207695_10159361 3300025913 Bacteria 2189
168 Ga0207695_10201670 3300025913 Bacteria 1903
169 Ga0207671_10083837 3300025914 Bacteria 2393
170 Ga0207671_10102216 3300025914 Bacteria 2172
171 Ga0207693_10001052 3300025915 Bacteria 24678
172 Ga0207660_10006560 3300025917 Bacteria 7553
173 Ga0207657_10000555 3300025919 Bacteria 39797
174 Ga0207657_10006619 3300025919 Bacteria 11995
175 Ga0207657_10034795 3300025919 Bacteria 4524
176 Ga0207657_10069596 3300025919 Bacteria 2985
177 Ga0207649_10000140 3300025920 Bacteria 60523
178 Ga0207652_10028456 3300025921 Bacteria 4662
179 Ga0207652_10061293 3300025921 Bacteria 3248
180 Ga0207652_10153423 3300025921 Bacteria 2063
181 Ga0207694_10000015 3300025924 Bacteria 363898
182 Ga0207694_10022466 3300025924 Bacteria 4786
183 Ga0207694_10029323 3300025924 Bacteria 4199
184 Ga0207694_10102085 3300025924 Bacteria 2274
185 Ga0207694_10231444 3300025924 Bacteria 1509
186 Ga0207700_10000010 3300025928 Bacteria 298473
187 Ga0207700_10099556 3300025928 Bacteria 2315
188 Ga0207664_10075226 3300025929 Bacteria 2730
189 Ga0207664_10203501 3300025929 Bacteria 1710
190 Ga0207644_10000003 3300025931 Bacteria 585905
191 Ga0207690_10013172 3300025932 Bacteria 4964
192 Ga0207670_10001608 3300025936 Bacteria 11778
193 Ga0207679_10074669 3300025945 Bacteria 2570
194 Ga0207667_10000012 3300025949 Bacteria 445492
195 Ga0207667_10094030 3300025949 Bacteria 3095
196 Ga0207667_10102261 3300025949 Bacteria 2956
197 Ga0207667_10102324 3300025949 Bacteria 2955
198 Ga0207658_10029296 3300025986 Bacteria 3887
199 Ga0207658_10171870 3300025986 Bacteria 1786
200 Ga0207703_10009575 3300026035 Bacteria 7607
201 Ga0207703_10016394 3300026035 Bacteria 5776
202 Ga0207703_10018761 3300026035 Bacteria 5403
203 Ga0207678_10021070 3300026067 Bacteria 5715
204 Ga0207678_10102649 3300026067 Bacteria 2441
205 Ga0207708_10146393 3300026075 Bacteria 1857
206 Ga0207702_10000174 3300026078 Bacteria 77455
207 Ga0207702_10017467 3300026078 Bacteria 5934
208 Ga0207676_10102383 3300026095 Bacteria 2377
209 Ga0207674_10000614 3300026116 Bacteria 46786
210 Ga0207698_10002922 3300026142 Bacteria 10211
211 Ga0207698_10103417 3300026142 Bacteria 2367
212 Ga0209389_1000106 3300027296 Bacteria 74313
213 Ga0209389_1000164 3300027296 Bacteria 54792
214 Ga0209589_1000002 3300027357 Bacteria 708598
215 Ga0209589_1000441 3300027357 Bacteria 57562
216 Ga0209489_100002 3300027361 Bacteria 708609
217 Ga0209489_100721 3300027361 Bacteria 65035
218 Ga0209700_100002 3300027363 Bacteria 708598
219 Ga0268266_10080012 3300028379 Bacteria 2846
220 Ga0268265_10078343 3300028380 Bacteria 2599
221 Ga0265334_10037692 3300028573 Bacteria 1905
222 Ga0265318_10001236 3300028577 Bacteria 15530
223 Ga0265338_10000007 3300028800 Bacteria 498229
224 Ga0265338_10000225 3300028800 Bacteria 105326
225 Ga0265338_10010352 3300028800 Bacteria 10950
226 Ga0265338_10016905 3300028800 Bacteria 7895
227 Ga0265338_10064961 3300028800 Bacteria 3169
228 Ga0265338_10081325 3300028800 Bacteria 2717
229 Ga0307511_10015503 3300030521 Bacteria 7384
230 Ga0265332_10010003 3300031238 Bacteria 4224
231 Ga0265332_10040902 3300031238 Bacteria 2006
232 Ga0265320_10000214 3300031240 Bacteria 46846
233 Ga0265325_10000001 3300031241 Bacteria 726814
234 Ga0265325_10000251 3300031241 Bacteria 38232
235 Ga0265325_10002698 3300031241 Bacteria 11863
236 Ga0265340_10000034 3300031247 Bacteria 65594
237 Ga0265340_10011131 3300031247 Bacteria 4792
238 Ga0265339_10000206 3300031249 Bacteria 48417
239 Ga0265339_10010044 3300031249 Bacteria 5901
240 Ga0265339_10014367 3300031249 Bacteria 4772
241 Ga0265331_10000106 3300031250 Bacteria 113406
242 Ga0265331_10003605 3300031250 Bacteria 9913
243 Ga0265331_10005467 3300031250 Bacteria 7670
244 Ga0265331_10015943 3300031250 Bacteria 3955
245 Ga0265327_10000176 3300031251 Bacteria 137002
246 Ga0265327_10001040 3300031251 Bacteria 39084
247 Ga0265327_10001274 3300031251 Bacteria 33184
248 Ga0265327_10001569 3300031251 Bacteria 27986
249 Ga0265316_10005018 3300031344 Bacteria 12991
250 Ga0265316_10021082 3300031344 Bacteria 5530
251 Ga0265313_10001029 3300031595 Bacteria 27114
252 Ga0265313_10001217 3300031595 Bacteria 24613
253 Ga0265314_10008043 3300031711 Bacteria 9090
254 Ga0265314_10027364 3300031711 Bacteria 4270
255 Ga0265314_10061163 3300031711 Bacteria 2566
256 Ga0265342_10029900 3300031712 Bacteria 3380
257 Ga0307516_10016779 3300031730 Bacteria 7647
258 Ga0307415_100145003 3300032126 Unclassified 1819
259 Ga0373926_0012079 3300035083 Bacteria 2916
260 Ga0373954_0064855 3300035118 Bacteria 1727
261 Ga0373924_0016348 3300035410 Bacteria 2830
262 Ga0373931_0086528 3300035691 Bacteria 1739
263 Ga0373927_0004707 3300035695 Bacteria 9511
264 Ga0373937_0016947 3300036401 Bacteria 6479
265 Ga0373925_0244111 3300037068 Bacteria 1439
266 Ga0395900_0020812 3300037418 Bacteria 6705
267 Ga0395900_0084649 3300037418 Bacteria 3259
268 Ga0395900_0154697 3300037418 Bacteria 2342
269 Ga0395900_0238031 3300037418 Bacteria 1827
270 Ga0395898_0003068 3300037466 Bacteria 18931
271 Ga0395898_0015885 3300037466 Bacteria 7715
272 Ga0395898_0080261 3300037466 Bacteria 3147
273 Ga0395898_0220193 3300037466 Unclassified 1810
274 Ga0395898_0262562 3300037466 Bacteria 1647
275 Ga0436364_0733065 3300037853 Bacteria 1644
276 Ga0436364_1083293 3300037853 Bacteria 1601
277 Ga0395901_0016552 3300038443 Bacteria 7513
278 Ga0395901_0306400 3300038443 Bacteria 1646
279 Ga0436365_0663394 3300039437 Bacteria 6118
280 Ga0436365_1275535 3300039437 Bacteria 5158
281 Ga0436365_1464499 3300039437 Bacteria 56762
282 Ga0436365_1550329 3300039437 Bacteria 23481
283 Ga0436361_0176100 3300039447 Bacteria 2214
284 Ga0436361_0403821 3300039447 Bacteria 6928
285 Ga0436361_0901842 3300039447 Bacteria 2064
286 Ga0436363_0413605 3300039450 Bacteria 3285
287 Ga0436362_0917268 3300039453 Unclassified 1366
288 Ga0436362_1155163 3300039453 Bacteria 1905
289 Ga0436362_1155642 3300039453 Bacteria 3663
290 Ga0466969_0008462 3300044656 Bacteria 5459
291 Ga0466969_0057666 3300044656 Bacteria 1893
292 Ga0466966_0008896 3300044684 Bacteria 6650
293 Ga0466961_0000124 3300044693 Bacteria 51384
294 Ga0466959_0021085 3300045049 Bacteria 4804
295 Ga0466959_0206716 3300045049 Bacteria 1365
296 Ga0451576_0351412 3300045051 Bacteria 1543
297 Ga0495627_000330 3300046453 Bacteria 45482
298 Ga0495592_0122207 3300046454 Bacteria 1830
299 Ga0495603_0042187 3300046455 Bacteria 2727
300 Ga0495629_0016210 3300046459 Bacteria 5349
301 Ga0495650_0000570 3300046471 Bacteria 51756
302 Ga0495580_0001693 3300046472 Bacteria 19368
303 Ga0495580_0009462 3300046472 Bacteria 7664
304 Ga0495582_0000835 3300046473 Bacteria 17016
305 Ga0495639_0076608 3300046475 Bacteria 1551
306 Ga0495662_0056029 3300046476 Bacteria 1904
307 Ga0495664_0000543 3300046477 Bacteria 18992
308 Ga0495664_0004879 3300046477 Bacteria 7338
309 Ga0495664_0103105 3300046477 Bacteria 1719
310 Ga0495584_0069183 3300046491 Bacteria 1774
311 Ga0495585_0084569 3300046492 Bacteria 1716
312 Ga0495606_0118198 3300046507 Bacteria 1590
313 Ga0495618_0004237 3300046514 Bacteria 8852
314 Ga0495618_0006699 3300046514 Bacteria 6980
315 Ga0495628_0012278 3300046516 Bacteria 7220
316 Ga0495628_0065858 3300046516 Bacteria 2833
317 Ga0495630_0008870 3300046517 Bacteria 7220
318 Ga0495648_0002513 3300046524 Bacteria 16835
319 Ga0495648_0033620 3300046524 Bacteria 3346
320 Ga0495666_0005356 3300046526 Bacteria 6468
321 Ga0495652_0039243 3300046529 Bacteria 4094
322 Ga0495665_0010310 3300046531 Bacteria 5057
323 Ga0495640_0031620 3300046533 Bacteria 3775
324 Ga0495640_0054472 3300046533 Bacteria 2739
325 Ga0495586_0006289 3300046535 Bacteria 6343
326 Ga0495587_0000944 3300046536 Bacteria 19117
327 Ga0495621_0066330 3300046539 Unclassified 1320
328 Ga0495622_0002929 3300046557 Bacteria 8141
329 Ga0495668_0041532 3300046616 Bacteria 2562
330 Ga0495634_0012232 3300046642 Bacteria 6221
331 Ga0495635_0005994 3300046663 Bacteria 8481
332 Ga0495635_0084378 3300046663 Bacteria 2173
333 Ga0495659_0008157 3300046664 Unclassified 3329
334 Ga0495661_0006113 3300046665 Bacteria 8483
335 Ga0495588_0002203 3300046674 Bacteria 8346
336 Ga0495588_0026075 3300046674 Bacteria 2916
337 Ga0495599_0006450 3300046678 Bacteria 7076
338 Ga0495599_0011481 3300046678 Bacteria 5444
339 Ga0495623_0010842 3300046679 Bacteria 5900
340 Ga0495646_0052411 3300046680 Bacteria 2464
341 Ga0495646_0109527 3300046680 Bacteria 1574
342 Ga0495658_0019377 3300046683 Bacteria 3551
343 Ga0495613_0004325 3300046689 Bacteria 10633
344 Ga0495613_0079000 3300046689 Bacteria 2393
345 Ga0495624_0024980 3300046690 Bacteria 3928
346 Ga0495581_0000993 3300047315 Bacteria 15264
347 Ga0495604_0012527 3300047317 Bacteria 6746
348 Ga0495604_0167716 3300047317 Bacteria 1547
349 Ga0495674_0052956 3300047319 Bacteria 3569
350 Ga0495674_0110463 3300047319 Bacteria 2331
351 Ga0495676_0002659 3300047321 Bacteria 15992
352 Ga0495676_0058630 3300047321 Bacteria 3028
353 Ga0495680_0013331 3300047322 Bacteria 7177
354 Ga0495675_0003472 3300047444 Bacteria 9497
355 Ga0495679_000980 3300047446 Bacteria 17638
356 Ga0495681_0000350 3300047470 Bacteria 36063
357 Ga0495684_0028199 3300047471 Bacteria 4311
358 Ga0495684_0168153 3300047471 Bacteria 1632
359 Ga0495686_0000089 3300047472 Bacteria 194673
360 Ga0495593_0009058 3300047673 Bacteria 5775
361 Ga0495602_0024850 3300048088 Bacteria 5806
362 Ga0495614_0000540 3300048089 Bacteria 15643
363 Ga0496101_0029139 3300048904 Bacteria 3860
364 Ga0496101_0110112 3300048904 Bacteria 2072
365 Ga0496102_0020373 3300048905 Bacteria 5861
366 Ga0496102_0024996 3300048905 Bacteria 5314
367 Ga0496104_0080212 3300048907 Bacteria 3111
368 Ga0496105_0099764 3300048908 Bacteria 2398
369 Ga0496106_0004646 3300048909 Bacteria 10184
370 Ga0496107_0003659 3300048910 Bacteria 10333
371 Ga0496110_0022394 3300048913 Bacteria 5365
372 Ga0496110_0096899 3300048913 Bacteria 2643
373 Ga0496112_0015622 3300048915 Bacteria 7091
374 Ga0496112_0209204 3300048915 Bacteria 1908
375 Ga0496113_0017457 3300048916 Bacteria 4982
376 Ga0496113_0023942 3300048916 Bacteria 4335
377 Ga0496114_0032285 3300048917 Bacteria 4308
378 Ga0496114_0057140 3300048917 Bacteria 3257
379 Ga0496116_0023017 3300048919 Bacteria 4650
380 Ga0496117_0002833 3300048920 Bacteria 21104
381 Ga0496117_0047732 3300048920 Bacteria 3067
382 Ga0496118_0003808 3300048921 Bacteria 18588
383 Ga0496118_0056404 3300048921 Bacteria 2954
384 Ga0496119_0129166 3300048922 Bacteria 1379
385 Ga0496121_0010454 3300048924 Bacteria 10469
386 Ga0496123_0062187 3300048926 Bacteria 2394
387 Ga0496126_0093478 3300048929 Bacteria 2640
388 Ga0501031_0012396 3300049568 Bacteria 5559
389 Ga0501032_0037650 3300049569 Bacteria 3298
390 Ga0501032_0103067 3300049569 Bacteria 1891
391 Ga0501033_0027882 3300049570 Bacteria 4244
392 Ga0501033_0063573 3300049570 Bacteria 2716
393 Ga0501034_0050567 3300049571 Bacteria 4192
394 Ga0501034_0147070 3300049571 Bacteria 2333
395 Ga0501034_0150661 3300049571 Bacteria 2302
396 Ga0501036_0053438 3300049572 Bacteria 3421
397 Ga0501037_0026255 3300049573 Bacteria 4304
398 Ga0501037_0131536 3300049573 Bacteria 1794
399 Ga0501038_0095195 3300049574 Bacteria 2488
400 Ga0501046_0004938 3300049580 Bacteria 11986
401 Ga0501046_0018594 3300049580 Bacteria 5778
402 Ga0501047_0005044 3300049581 Bacteria 12391
403 Ga0501047_0006304 3300049581 Bacteria 11157
404 Ga0501068_0226032 3300049584 Bacteria 1190
405 Ga0501069_0013127 3300049585 Bacteria 4417
406 Ga0501070_0000033 3300049586 Bacteria 128626
407 Ga0501070_0039423 3300049586 Bacteria 3941
408 Ga0501070_0072706 3300049586 Bacteria 2846
409 Ga0501070_0103605 3300049586 Bacteria 2353
410 Ga0501070_0206658 3300049586 Bacteria 1612
411 Ga0501074_0015468 3300049590 Bacteria 5546
412 Ga0501079_0041787 3300049741 Bacteria 3540
413 Ga0501080_0007254 3300049742 Bacteria 10002
414 Ga0501080_0046071 3300049742 Bacteria 4061
415 Ga0501080_0167861 3300049742 Bacteria 2025
416 Ga0501080_0271654 3300049742 Bacteria 1543
417 Ga0501035_0004464 3300049822 Bacteria 13277
418 Ga0501035_0035905 3300049822 Bacteria 4496
419 Ga0501035_0096445 3300049822 Bacteria 2598
420 Ga0501044_0001915 3300049823 Bacteria 24086
421 Ga0501044_0005897 3300049823 Bacteria 13570
422 Ga0501044_0050001 3300049823 Bacteria 4315
423 Ga0501044_0064089 3300049823 Bacteria 3753
424 Ga0501044_0073577 3300049823 Bacteria 3473
425 Ga0501044_0171302 3300049823 Bacteria 2142
426 Ga0501044_0209662 3300049823 Bacteria 1903
427 Ga0501044_0263243 3300049823 Bacteria 1662
428 nmdc:mga0yw44_4430_c1 3300050492 Bacteria 6439
429 nmdc:mga05p37_11097_c1 3300050507 Bacteria 10706
430 nmdc:mga09592_17730_c1 3300050508 Bacteria 5835
431 nmdc:mga08x19_19199_c1 3300050514 Bacteria 4193
432 nmdc:mga0a205_114513_c1 3300050515 Bacteria 2595
433 Ga0495601_0044162 3300053077 Bacteria 2801
434 Ga0500566_0000384 3300053094 Bacteria 24438
435 Ga0500595_008383 3300053119 Bacteria 4224
436 Ga0500595_008456 3300053119 Bacteria 4203
437 Ga0500595_015996 3300053119 Bacteria 2802
438 Ga0500597_094646 3300053120 Bacteria 1298
439 Ga0500655_003266 3300053133 Bacteria 2935
440 Ga0500622_0074925 3300053156 Bacteria 1704
441 Ga0500637_0107218 3300053178 Bacteria 1620
442 Ga0501084_0000096 3300054114 Bacteria 65139
443 Ga0501084_0004088 3300054114 Bacteria 11884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0244111 Ga0373925_0244111_26_1099 313
2 3300047471 Ga0495684_0168153 Ga0495684_0168153_538_1620 328
3 3300049584 Ga0501068_0226032 Ga0501068_0226032_11_1153 330
4 3300046539 Ga0495621_0066330 Ga0495621_0066330_50_1162 331
5 3300026067 Ga0207678_10102649 Ga0207678_101026492 335
6 3300037466 Ga0395898_0262562 Ga0395898_0262562_488_1618 341
7 3300032126 Ga0307415_100145003 Ga0307415_1001450031 346
8 3300037418 Ga0395900_0154697 Ga0395900_0154697_478_1815 358
9 3300038443 Ga0395901_0306400 Ga0395901_0306400_81_1418 358
10 3300039453 Ga0436362_0917268 Ga0436362_0917268_16_1242 359
11 3300039453 Ga0436362_1155163 Ga0436362_1155163_458_1729 359
12 3300005842 Ga0068858_100064691 Ga0068858_1000646913 361
13 3300009177 Ga0105248_10110648 Ga0105248_101106482 361
14 3300025924 Ga0207694_10029323 Ga0207694_100293234 361
15 3300048917 Ga0496114_0032285 Ga0496114_0032285_2188_3453 361
16 3300005844 Ga0068862_100111594 Ga0068862_1001115942 363
17 3300028380 Ga0268265_10078343 Ga0268265_100783433 363
18 iso_pu_bacteria 8016575299 8016580004 363
19 3300021358 Ga0213873_10008076 Ga0213873_100080762 364
20 3300005458 Ga0070681_10085862 Ga0070681_100858623 365
21 3300037418 Ga0395900_0238031 Ga0395900_0238031_176_1390 365
22 3300037466 Ga0395898_0015885 Ga0395898_0015885_4988_6202 365
23 3300049580 Ga0501046_0018594 Ga0501046_0018594_2110_3330 365
24 3300049742 Ga0501080_0167861 Ga0501080_0167861_26_1240 365
25 3300005617 Ga0068859_100003457 Ga0068859_1000034572 366
26 3300006931 Ga0097620_100003457 Ga0097620_1000034572 366
27 3300026035 Ga0207703_10009575 Ga0207703_100095757 366
28 3300013308 Ga0157375_10091083 Ga0157375_100910833 367
29 3300045051 Ga0451576_0351412 Ga0451576_0351412_145_1485 367
30 iso_pu_bacteria 8016511872 8016516749 367
31 3300005353 Ga0070669_100000666 Ga0070669_10000066620 369
32 3300005435 Ga0070714_100041715 Ga0070714_1000417152 369
33 3300025929 Ga0207664_10075226 Ga0207664_100752262 369
34 3300013307 Ga0157372_10029012 Ga0157372_100290124 370
35 3300031251 Ga0265327_10001274 Ga0265327_1000127424 370
36 3300009093 Ga0105240_10022411 Ga0105240_100224117 371
37 3300013105 Ga0157369_10054573 Ga0157369_100545733 371
38 3300025913 Ga0207695_10028448 Ga0207695_100284482 371
39 3300028573 Ga0265334_10037692 Ga0265334_100376921 372
40 3300028800 Ga0265338_10000007 Ga0265338_10000007359 372
41 3300028800 Ga0265338_10064961 Ga0265338_100649614 372
42 3300031238 Ga0265332_10010003 Ga0265332_100100034 372
43 3300031241 Ga0265325_10000001 Ga0265325_10000001427 372
44 3300031249 Ga0265339_10000206 Ga0265339_1000020637 372
45 3300031250 Ga0265331_10005467 Ga0265331_100054673 372
46 3300031595 Ga0265313_10001029 Ga0265313_1000102914 372
47 3300031711 Ga0265314_10027364 Ga0265314_100273642 372
48 3300049569 Ga0501032_0037650 Ga0501032_0037650_1656_2945 372
49 iso_pu_bacteria 2881665667 2881666899 372
50 3300005335 Ga0070666_10004407 Ga0070666_100044072 373
51 3300005563 Ga0068855_100119481 Ga0068855_1001194814 373
52 3300025903 Ga0207680_10001907 Ga0207680_1000190711 373
53 3300025949 Ga0207667_10102261 Ga0207667_101022614 373
54 3300013307 Ga0157372_10013120 Ga0157372_100131204 374
55 3300014968 Ga0157379_10061572 Ga0157379_100615723 374
56 iso_pu_bacteria 2881364244 2881369329 374
57 3300028800 Ga0265338_10081325 Ga0265338_100813252 375
58 3300031251 Ga0265327_10001040 Ga0265327_1000104029 375
59 3300054114 Ga0501084_0004088 Ga0501084_0004088_9356_10645 375
60 iso_pu_bacteria 2617270735 2617348638 375
61 iso_pu_bacteria 2841966195 2841970266 375
62 iso_pu_bacteria 2874612657 2874613558 375
63 3300005355 Ga0070671_100000052 Ga0070671_10000005218 376
64 3300005530 Ga0070679_100173165 Ga0070679_1001731652 376
65 3300005539 Ga0068853_100186338 Ga0068853_1001863382 376
66 3300005563 Ga0068855_100065064 Ga0068855_1000650644 376
67 3300005577 Ga0068857_100058501 Ga0068857_1000585013 376
68 3300021384 Ga0213876_10000211 Ga0213876_100002112 376
69 3300025903 Ga0207680_10013305 Ga0207680_100133054 376
70 3300025931 Ga0207644_10000003 Ga0207644_10000003498 376
71 3300025949 Ga0207667_10094030 Ga0207667_100940302 376
72 3300025986 Ga0207658_10029296 Ga0207658_100292963 376
73 3300026142 Ga0207698_10103417 Ga0207698_101034172 376
74 3300039437 Ga0436365_1550329 Ga0436365_1550329_2049_3374 376
75 3300039450 Ga0436363_0413605 Ga0436363_0413605_878_2203 376
76 3300048916 Ga0496113_0017457 Ga0496113_0017457_794_2095 376
77 iso_pu_bacteria 8019608314 8019614197 376
78 3300005843 Ga0068860_100163597 Ga0068860_1001635972 377
79 3300005844 Ga0068862_100082776 Ga0068862_1000827762 377
80 3300006944 Ga0099823_1001127 Ga0099823_100112713 377
81 3300009093 Ga0105240_10022005 Ga0105240_100220051 377
82 3300009177 Ga0105248_10010547 Ga0105248_100105476 377
83 3300027296 Ga0209389_1000106 Ga0209389_100010630 377
84 3300048913 Ga0496110_0096899 Ga0496110_0096899_987_2291 377
85 3300049742 Ga0501080_0271654 Ga0501080_0271654_47_1249 377
86 3300005262 Ga0065165_1001979 Ga0065165_10019796 378
87 3300005548 Ga0070665_100111044 Ga0070665_1001110443 378
88 3300009551 Ga0105238_10332520 Ga0105238_103325201 378
89 3300025302 Ga0207426_1000504 Ga0207426_100050417 378
90 3300031730 Ga0307516_10016779 Ga0307516_100167793 378
91 3300049571 Ga0501034_0147070 Ga0501034_0147070_694_1983 378
92 3300049585 Ga0501069_0013127 Ga0501069_0013127_1221_2510 378
93 3300049586 Ga0501070_0072706 Ga0501070_0072706_802_2091 378
94 3300049741 Ga0501079_0041787 Ga0501079_0041787_1774_3063 378
95 3300049742 Ga0501080_0046071 Ga0501080_0046071_509_1798 378
96 3300049822 Ga0501035_0035905 Ga0501035_0035905_2054_3343 378
97 3300009093 Ga0105240_10155938 Ga0105240_101559383 379
98 3300010375 Ga0105239_10057021 Ga0105239_100570214 379
99 3300013307 Ga0157372_10097663 Ga0157372_100976633 379
100 3300028800 Ga0265338_10000225 Ga0265338_1000022589 379
101 3300048904 Ga0496101_0029139 Ga0496101_0029139_2357_3661 380
102 3300048909 Ga0496106_0004646 Ga0496106_0004646_5852_7156 380
103 3300048910 Ga0496107_0003659 Ga0496107_0003659_4880_6184 380
104 3300053119 Ga0500595_015996 Ga0500595_015996_1385_2692 380
105 iso_pu_bacteria 2824609381 2824614136 380
106 iso_pu_bacteria 2824653114 2824655376 380
107 iso_pu_bacteria 2824732956 2824733003 380
108 iso_pu_bacteria 2841983080 2841985788 380
109 iso_pu_bacteria 2904666416 2904673393 380
110 3300005468 Ga0070707_100335807 Ga0070707_1003358071 381
111 3300009545 Ga0105237_10046867 Ga0105237_100468675 381
112 3300030521 Ga0307511_10015503 Ga0307511_100155033 381
113 3300035691 Ga0373931_0086528 Ga0373931_0086528_76_1401 381
114 3300046453 Ga0495627_000330 Ga0495627_000330_33062_34351 381
115 3300046471 Ga0495650_0000570 Ga0495650_0000570_37926_39215 381
116 3300046477 Ga0495664_0004879 Ga0495664_0004879_1902_3152 381
117 3300046678 Ga0495599_0011481 Ga0495599_0011481_447_1697 381
118 3300047470 Ga0495681_0000350 Ga0495681_0000350_33080_34369 381
119 3300053077 Ga0495601_0044162 Ga0495601_0044162_1489_2739 381
120 3300005337 Ga0070682_100022924 Ga0070682_1000229242 382
121 3300005458 Ga0070681_10066680 Ga0070681_100666804 382
122 3300009093 Ga0105240_10055701 Ga0105240_100557015 382
123 3300013105 Ga0157369_10041195 Ga0157369_100411953 382
124 3300013307 Ga0157372_10171779 Ga0157372_101717791 382
125 3300025912 Ga0207707_10000173 Ga0207707_1000017334 382
126 3300035083 Ga0373926_0012079 Ga0373926_0012079_867_2120 382
127 3300046475 Ga0495639_0076608 Ga0495639_0076608_65_1318 382
128 3300046533 Ga0495640_0031620 Ga0495640_0031620_2496_3749 382
129 3300047317 Ga0495604_0167716 Ga0495604_0167716_269_1522 382
130 3300047319 Ga0495674_0110463 Ga0495674_0110463_27_1280 382
131 3300048920 Ga0496117_0002833 Ga0496117_0002833_695_2002 382
132 3300048921 Ga0496118_0003808 Ga0496118_0003808_16198_17505 382
133 3300049570 Ga0501033_0063573 Ga0501033_0063573_1322_2590 382
134 3300049571 Ga0501034_0150661 Ga0501034_0150661_611_1879 382
135 3300049823 Ga0501044_0073577 Ga0501044_0073577_533_1801 382
136 3300005458 Ga0070681_10008604 Ga0070681_100086049 383
137 3300005530 Ga0070679_100097236 Ga0070679_1000972363 383
138 3300025906 Ga0207699_10068473 Ga0207699_100684732 383
139 3300025912 Ga0207707_10201548 Ga0207707_102015482 383
140 3300005344 Ga0070661_100000973 Ga0070661_1000009732 384
141 3300025920 Ga0207649_10000140 Ga0207649_1000014012 384
142 3300031250 Ga0265331_10000106 Ga0265331_1000010695 384
143 3300031250 Ga0265331_10003605 Ga0265331_100036057 384
144 3300031251 Ga0265327_10000176 Ga0265327_1000017652 384
145 3300049586 Ga0501070_0206658 Ga0501070_0206658_139_1425 384
146 3300049823 Ga0501044_0263243 Ga0501044_0263243_161_1447 384
147 3300005563 Ga0068855_100062658 Ga0068855_1000626583 385
148 3300006358 Ga0068871_100023256 Ga0068871_1000232562 385
149 3300009093 Ga0105240_10248443 Ga0105240_102484431 385
150 3300009545 Ga0105237_10111042 Ga0105237_101110422 385
151 3300009551 Ga0105238_10013556 Ga0105238_100135564 385
152 3300010375 Ga0105239_10144193 Ga0105239_101441932 385
153 3300013102 Ga0157371_10023530 Ga0157371_100235307 385
154 3300013296 Ga0157374_10006163 Ga0157374_100061632 385
155 3300025913 Ga0207695_10201670 Ga0207695_102016702 385
156 3300037466 Ga0395898_0220193 Ga0395898_0220193_325_1569 385
157 3300048905 Ga0496102_0020373 Ga0496102_0020373_2797_4140 385
158 iso_pu_bacteria 2524023205 2524437944 385
159 iso_pu_bacteria 2744054633 2745082309 385
160 3300005336 Ga0070680_100189927 Ga0070680_1001899272 386
161 3300005366 Ga0070659_100026753 Ga0070659_1000267534 386
162 3300005439 Ga0070711_100077093 Ga0070711_1000770932 386
163 3300005458 Ga0070681_10080543 Ga0070681_100805431 386
164 3300005530 Ga0070679_100121645 Ga0070679_1001216451 386
165 3300005535 Ga0070684_100064787 Ga0070684_1000647874 386
166 3300009093 Ga0105240_10004270 Ga0105240_1000427019 386
167 3300013105 Ga0157369_10015815 Ga0157369_100158156 386
168 3300013307 Ga0157372_10286273 Ga0157372_102862732 386
169 3300025913 Ga0207695_10002655 Ga0207695_1000265519 386
170 3300025919 Ga0207657_10034795 Ga0207657_100347952 386
171 3300025924 Ga0207694_10022466 Ga0207694_100224663 386
172 3300025932 Ga0207690_10013172 Ga0207690_100131724 386
173 3300039447 Ga0436361_0403821 Ga0436361_0403821_3534_4832 386
174 3300046616 Ga0495668_0041532 Ga0495668_0041532_278_1585 386
175 3300048915 Ga0496112_0015622 Ga0496112_0015622_2176_3465 386
176 3300048921 Ga0496118_0056404 Ga0496118_0056404_1019_2362 386
177 3300048922 Ga0496119_0129166 Ga0496119_0129166_38_1327 386
178 3300053119 Ga0500595_008383 Ga0500595_008383_187_1500 386
179 iso_pu_bacteria 2508501128 2509149474 386
180 3300021384 Ga0213876_10058872 Ga0213876_100588722 387
181 3300037418 Ga0395900_0084649 Ga0395900_0084649_586_1947 387
182 3300037466 Ga0395898_0080261 Ga0395898_0080261_445_1806 387
183 3300037853 Ga0436364_0733065 Ga0436364_0733065_314_1621 387
184 3300039437 Ga0436365_0663394 Ga0436365_0663394_2022_3329 387
185 3300047472 Ga0495686_0000089 Ga0495686_0000089_130233_131546 387
186 3300049581 Ga0501047_0006304 Ga0501047_0006304_1820_3106 387
187 3300049586 Ga0501070_0103605 Ga0501070_0103605_678_1964 387
188 3300049590 Ga0501074_0015468 Ga0501074_0015468_2495_3781 387
189 3300049823 Ga0501044_0209662 Ga0501044_0209662_90_1376 387
190 3300053119 Ga0500595_008456 Ga0500595_008456_881_2206 387
191 3300053156 Ga0500622_0074925 Ga0500622_0074925_265_1581 387
192 iso_pu_bacteria 2524023210 2524470221 387
193 3300005327 Ga0070658_10007786 Ga0070658_100077862 388
194 3300005336 Ga0070680_100119061 Ga0070680_1001190611 388
195 3300005336 Ga0070680_100134469 Ga0070680_1001344693 388
196 3300005339 Ga0070660_100001478 Ga0070660_10000147816 388
197 3300005340 Ga0070689_100024190 Ga0070689_1000241903 388
198 3300005341 Ga0070691_10003145 Ga0070691_100031454 388
199 3300005341 Ga0070691_10003712 Ga0070691_100037123 388
200 3300005343 Ga0070687_100068196 Ga0070687_1000681962 388
201 3300005345 Ga0070692_10071052 Ga0070692_100710522 388
202 3300005354 Ga0070675_100000119 Ga0070675_10000011938 388
203 3300005366 Ga0070659_100024053 Ga0070659_1000240535 388
204 3300005434 Ga0070709_10003415 Ga0070709_100034154 388
205 3300005434 Ga0070709_10105681 Ga0070709_101056811 388
206 3300005435 Ga0070714_100114728 Ga0070714_1001147282 388
207 3300005436 Ga0070713_100000098 Ga0070713_1000000986 388
208 3300005436 Ga0070713_100040171 Ga0070713_1000401712 388
209 3300005440 Ga0070705_100017833 Ga0070705_1000178333 388
210 3300005455 Ga0070663_100049099 Ga0070663_1000490993 388
211 3300005458 Ga0070681_10073729 Ga0070681_100737293 388
212 3300005458 Ga0070681_10263229 Ga0070681_102632292 388
213 3300005530 Ga0070679_100188802 Ga0070679_1001888021 388
214 3300005563 Ga0068855_100004762 Ga0068855_1000047623 388
215 3300005578 Ga0068854_100197022 Ga0068854_1001970221 388
216 3300005614 Ga0068856_100000185 Ga0068856_10000018538 388
217 3300005614 Ga0068856_100011089 Ga0068856_1000110893 388
218 3300005615 Ga0070702_100041779 Ga0070702_1000417793 388
219 3300005617 Ga0068859_100006645 Ga0068859_1000066459 388
220 3300006028 Ga0070717_10070911 Ga0070717_100709112 388
221 3300006175 Ga0070712_100001103 Ga0070712_1000011033 388
222 3300006844 Ga0075428_100005189 Ga0075428_10000518915 388
223 3300006852 Ga0075433_10100649 Ga0075433_101006492 388
224 3300006880 Ga0075429_100076823 Ga0075429_1000768231 388
225 3300006914 Ga0075436_100000092 Ga0075436_1000000922 388
226 3300006931 Ga0097620_100006646 Ga0097620_1000066469 388
227 3300006942 Ga0099824_1024320 Ga0099824_10243204 388
228 3300009093 Ga0105240_10004424 Ga0105240_100044244 388
229 3300009147 Ga0114129_10001734 Ga0114129_100017346 388
230 3300009174 Ga0105241_10069696 Ga0105241_100696963 388
231 3300009545 Ga0105237_10006823 Ga0105237_100068234 388
232 3300009551 Ga0105238_10027218 Ga0105238_100272183 388
233 3300009551 Ga0105238_10131174 Ga0105238_101311742 388
234 3300010375 Ga0105239_10015385 Ga0105239_100153856 388
235 3300013100 Ga0157373_10000750 Ga0157373_100007506 388
236 3300013100 Ga0157373_10007009 Ga0157373_100070094 388
237 3300013104 Ga0157370_10027803 Ga0157370_100278033 388
238 3300013104 Ga0157370_10133451 Ga0157370_101334513 388
239 3300013105 Ga0157369_10003147 Ga0157369_1000314715 388
240 3300013296 Ga0157374_10081973 Ga0157374_100819732 388
241 3300013307 Ga0157372_10049646 Ga0157372_100496463 388
242 3300014968 Ga0157379_10113226 Ga0157379_101132262 388
243 3300025906 Ga0207699_10000212 Ga0207699_100002126 388
244 3300025906 Ga0207699_10013284 Ga0207699_100132841 388
245 3300025909 Ga0207705_10000575 Ga0207705_1000057516 388
246 3300025912 Ga0207707_10000995 Ga0207707_100009953 388
247 3300025913 Ga0207695_10016347 Ga0207695_100163474 388
248 3300025914 Ga0207671_10083837 Ga0207671_100838372 388
249 3300025915 Ga0207693_10001052 Ga0207693_100010528 388
250 3300025917 Ga0207660_10006560 Ga0207660_100065603 388
251 3300025919 Ga0207657_10000555 Ga0207657_1000055528 388
252 3300025921 Ga0207652_10028456 Ga0207652_100284563 388
253 3300025921 Ga0207652_10153423 Ga0207652_101534232 388
254 3300025924 Ga0207694_10231444 Ga0207694_102314441 388
255 3300025928 Ga0207700_10000010 Ga0207700_1000001024 388
256 3300025928 Ga0207700_10099556 Ga0207700_100995562 388
257 3300025929 Ga0207664_10203501 Ga0207664_102035011 388
258 3300025936 Ga0207670_10001608 Ga0207670_100016086 388
259 3300025945 Ga0207679_10074669 Ga0207679_100746692 388
260 3300025949 Ga0207667_10102324 Ga0207667_101023243 388
261 3300026035 Ga0207703_10016394 Ga0207703_100163942 388
262 3300026075 Ga0207708_10146393 Ga0207708_101463932 388
263 3300026078 Ga0207702_10000174 Ga0207702_1000017425 388
264 3300026078 Ga0207702_10017467 Ga0207702_100174672 388
265 3300026116 Ga0207674_10000614 Ga0207674_100006143 388
266 3300027296 Ga0209389_1000164 Ga0209389_100016433 388
267 3300027357 Ga0209589_1000441 Ga0209589_100044137 388
268 3300027361 Ga0209489_100721 Ga0209489_10072133 388
269 3300031249 Ga0265339_10014367 Ga0265339_100143673 388
270 3300031251 Ga0265327_10001569 Ga0265327_1000156914 388
271 3300035118 Ga0373954_0064855 Ga0373954_0064855_65_1354 388
272 3300035410 Ga0373924_0016348 Ga0373924_0016348_212_1501 388
273 3300035695 Ga0373927_0004707 Ga0373927_0004707_8157_9446 388
274 3300036401 Ga0373937_0016947 Ga0373937_0016947_1821_3137 388
275 3300037418 Ga0395900_0020812 Ga0395900_0020812_504_1799 388
276 3300037466 Ga0395898_0003068 Ga0395898_0003068_7693_8988 388
277 3300037853 Ga0436364_1083293 Ga0436364_1083293_37_1332 388
278 3300038443 Ga0395901_0016552 Ga0395901_0016552_72_1367 388
279 3300039447 Ga0436361_0176100 Ga0436361_0176100_387_1676 388
280 3300039453 Ga0436362_1155642 Ga0436362_1155642_1668_2957 388
281 3300045049 Ga0466959_0206716 Ga0466959_0206716_36_1325 388
282 3300046454 Ga0495592_0122207 Ga0495592_0122207_427_1716 388
283 3300046472 Ga0495580_0009462 Ga0495580_0009462_860_2149 388
284 3300046476 Ga0495662_0056029 Ga0495662_0056029_396_1685 388
285 3300046477 Ga0495664_0103105 Ga0495664_0103105_236_1525 388
286 3300046514 Ga0495618_0006699 Ga0495618_0006699_316_1605 388
287 3300046516 Ga0495628_0065858 Ga0495628_0065858_1448_2737 388
288 3300046663 Ga0495635_0084378 Ga0495635_0084378_456_1745 388
289 3300046664 Ga0495659_0008157 Ga0495659_0008157_305_1594 388
290 3300046683 Ga0495658_0019377 Ga0495658_0019377_1848_3137 388
291 3300046689 Ga0495613_0079000 Ga0495613_0079000_516_1805 388
292 3300047321 Ga0495676_0058630 Ga0495676_0058630_749_2038 388
293 3300047471 Ga0495684_0028199 Ga0495684_0028199_2408_3697 388
294 3300049568 Ga0501031_0012396 Ga0501031_0012396_1795_3063 388
295 3300049569 Ga0501032_0103067 Ga0501032_0103067_276_1544 388
296 3300049573 Ga0501037_0026255 Ga0501037_0026255_1333_2601 388
297 3300049573 Ga0501037_0131536 Ga0501037_0131536_477_1745 388
298 3300049574 Ga0501038_0095195 Ga0501038_0095195_891_2159 388
299 3300049586 Ga0501070_0000033 Ga0501070_0000033_50169_51437 388
300 3300049742 Ga0501080_0007254 Ga0501080_0007254_3190_4458 388
301 3300049822 Ga0501035_0004464 Ga0501035_0004464_9434_10702 388
302 3300049823 Ga0501044_0001915 Ga0501044_0001915_16965_18233 388
303 3300049823 Ga0501044_0050001 Ga0501044_0050001_88_1359 388
304 3300049823 Ga0501044_0064089 Ga0501044_0064089_1112_2380 388
305 3300049823 Ga0501044_0171302 Ga0501044_0171302_487_1755 388
306 3300050507 nmdc:mga05p37_11097_c1 nmdc:mga05p37_11097_c1_7463_8737 388
307 3300050508 nmdc:mga09592_17730_c1 nmdc:mga09592_17730_c1_4447_5721 388
308 3300050514 nmdc:mga08x19_19199_c1 nmdc:mga08x19_19199_c1_586_1902 388
309 3300050515 nmdc:mga0a205_114513_c1 nmdc:mga0a205_114513_c1_938_2212 388
310 3300054114 Ga0501084_0000096 Ga0501084_0000096_54252_55532 388
311 iso_pu_bacteria 2507262055 2507511246 388
312 iso_pu_bacteria 2508501009 2508545048 388
313 iso_pu_bacteria 2508501042 2508693794 388
314 iso_pu_bacteria 2515154112 2515625179 388
315 iso_pu_bacteria 2667528175 2671121717 388
316 iso_pu_bacteria 2879127579 2879134275 388
317 iso_pu_bacteria 2879142872 2879145914 388
318 iso_pu_bacteria 2935630451 2935637533 388
319 iso_pu_bacteria 2935769743 2935774632 388
320 iso_pu_bacteria 2935777560 2935781919 388
321 iso_pu_bacteria 2935785616 2935789353 388
322 iso_pu_bacteria 2935793552 2935797604 388
323 iso_pu_bacteria 2935975950 2935976910 388
324 iso_pu_bacteria 2941507105 2941514094 388
325 iso_pu_bacteria 2941515067 2941522055 388
326 iso_pu_bacteria 2941523033 2941529793 388
327 iso_pu_bacteria 8016530956 8016537636 388
328 iso_pu_bacteria 8016548790 8016551370 388
329 iso_pu_bacteria 8016557553 8016559758 388
330 iso_pu_bacteria 8016595262 8016597700 388
331 iso_pu_bacteria 8016603502 8016604620 388
332 iso_pu_bacteria 8016613128 8016620395 388
333 iso_pu_bacteria 8016622563 8016629578 388
334 iso_pu_bacteria 8019530166 8019537314 388
335 iso_pu_bacteria 8019538911 8019539028 388
336 iso_pu_bacteria 8019619141 8019624875 388
337 iso_pu_bacteria 8019668869 8019674697 388
338 iso_pu_bacteria 8019678201 8019681401 388
339 3300003323 rootH1_10000078 rootH1_1000007839 389
340 3300003323 rootH1_10044398 rootH1_100443982 389
341 3300005327 Ga0070658_10016353 Ga0070658_100163532 389
342 3300005335 Ga0070666_10051770 Ga0070666_100517703 389
343 3300005339 Ga0070660_100024150 Ga0070660_1000241503 389
344 3300005339 Ga0070660_100117743 Ga0070660_1001177431 389
345 3300005455 Ga0070663_100017202 Ga0070663_1000172025 389
346 3300005455 Ga0070663_100113945 Ga0070663_1001139452 389
347 3300005530 Ga0070679_100220006 Ga0070679_1002200062 389
348 3300005539 Ga0068853_100106225 Ga0068853_1001062252 389
349 3300005616 Ga0068852_100002430 Ga0068852_1000024304 389
350 3300005616 Ga0068852_100095842 Ga0068852_1000958422 389
351 3300005618 Ga0068864_100095962 Ga0068864_1000959622 389
352 3300006943 Ga0099822_1017407 Ga0099822_10174076 389
353 3300009093 Ga0105240_10000174 Ga0105240_1000017465 389
354 3300009174 Ga0105241_10007495 Ga0105241_100074957 389
355 3300009177 Ga0105248_10324650 Ga0105248_103246501 389
356 3300009551 Ga0105238_10024972 Ga0105238_100249724 389
357 3300010375 Ga0105239_10004250 Ga0105239_100042503 389
358 3300013105 Ga0157369_10112957 Ga0157369_101129572 389
359 3300013308 Ga0157375_10041910 Ga0157375_100419102 389
360 3300014325 Ga0163163_10044799 Ga0163163_100447993 389
361 3300014969 Ga0157376_10146842 Ga0157376_101468422 389
362 3300021384 Ga0213876_10000254 Ga0213876_1000025419 389
363 3300025254 Ga0209148_1000303 Ga0209148_100030313 389
364 3300025272 Ga0209455_1004209 Ga0209455_10042094 389
365 3300025272 Ga0209455_1016084 Ga0209455_10160841 389
366 3300025903 Ga0207680_10032019 Ga0207680_100320192 389
367 3300025911 Ga0207654_10021094 Ga0207654_100210945 389
368 3300025913 Ga0207695_10000004 Ga0207695_10000004313 389
369 3300025914 Ga0207671_10102216 Ga0207671_101022161 389
370 3300025919 Ga0207657_10006619 Ga0207657_100066196 389
371 3300025919 Ga0207657_10069596 Ga0207657_100695961 389
372 3300025921 Ga0207652_10061293 Ga0207652_100612931 389
373 3300025924 Ga0207694_10000015 Ga0207694_1000001552 389
374 3300025924 Ga0207694_10102085 Ga0207694_101020852 389
375 3300025986 Ga0207658_10171870 Ga0207658_101718701 389
376 3300026035 Ga0207703_10018761 Ga0207703_100187614 389
377 3300026067 Ga0207678_10021070 Ga0207678_100210702 389
378 3300026095 Ga0207676_10102383 Ga0207676_101023832 389
379 3300026142 Ga0207698_10002922 Ga0207698_100029228 389
380 3300027357 Ga0209589_1000002 Ga0209589_1000002222 389
381 3300027361 Ga0209489_100002 Ga0209489_100002222 389
382 3300027363 Ga0209700_100002 Ga0209700_100002222 389
383 3300028379 Ga0268266_10080012 Ga0268266_100800122 389
384 3300028800 Ga0265338_10010352 Ga0265338_100103528 389
385 3300031240 Ga0265320_10000214 Ga0265320_1000021420 389
386 3300031241 Ga0265325_10000251 Ga0265325_1000025129 389
387 3300031241 Ga0265325_10002698 Ga0265325_100026989 389
388 3300031247 Ga0265340_10011131 Ga0265340_100111313 389
389 3300039437 Ga0436365_1464499 Ga0436365_1464499_38876_40138 389
390 3300039447 Ga0436361_0901842 Ga0436361_0901842_347_1660 389
391 3300044656 Ga0466969_0008462 Ga0466969_0008462_2299_3597 389
392 3300044684 Ga0466966_0008896 Ga0466966_0008896_4585_5883 389
393 3300044693 Ga0466961_0000124 Ga0466961_0000124_9655_10953 389
394 3300045049 Ga0466959_0021085 Ga0466959_0021085_2529_3827 389
395 3300046491 Ga0495584_0069183 Ga0495584_0069183_133_1431 389
396 3300046492 Ga0495585_0084569 Ga0495585_0084569_312_1601 389
397 3300046524 Ga0495648_0033620 Ga0495648_0033620_1369_2730 389
398 3300046557 Ga0495622_0002929 Ga0495622_0002929_5917_7215 389
399 3300046674 Ga0495588_0002203 Ga0495588_0002203_5762_7060 389
400 3300046680 Ga0495646_0109527 Ga0495646_0109527_63_1418 389
401 3300048904 Ga0496101_0110112 Ga0496101_0110112_716_2014 389
402 3300048905 Ga0496102_0024996 Ga0496102_0024996_3072_4370 389
403 3300048907 Ga0496104_0080212 Ga0496104_0080212_525_1823 389
404 3300048908 Ga0496105_0099764 Ga0496105_0099764_963_2261 389
405 3300048913 Ga0496110_0022394 Ga0496110_0022394_963_2261 389
406 3300048915 Ga0496112_0209204 Ga0496112_0209204_180_1541 389
407 3300048916 Ga0496113_0023942 Ga0496113_0023942_1392_2690 389
408 3300048917 Ga0496114_0057140 Ga0496114_0057140_90_1451 389
409 3300048919 Ga0496116_0023017 Ga0496116_0023017_2617_3915 389
410 3300048920 Ga0496117_0047732 Ga0496117_0047732_1337_2698 389
411 3300048926 Ga0496123_0062187 Ga0496123_0062187_836_2161 389
412 3300048929 Ga0496126_0093478 Ga0496126_0093478_999_2324 389
413 3300050492 nmdc:mga0yw44_4430_c1 nmdc:mga0yw44_4430_c1_4551_5912 389
414 3300053120 Ga0500597_094646 Ga0500597_094646_19_1272 389
415 3300053133 Ga0500655_003266 Ga0500655_003266_168_1457 389
416 iso_pu_bacteria 2513237096 2513657730 389
417 iso_pu_bacteria 2513237098 2513677258 389
418 iso_pu_bacteria 2513237137 2513862586 389
419 iso_pu_bacteria 2513237141 2513892911 389
420 iso_pu_bacteria 2513237145 2513919729 389
421 iso_pu_bacteria 2517572143 2517895259 389
422 iso_pu_bacteria 2524023210 2524468974 389
423 iso_pu_bacteria 2728368998 2728752420 389
424 iso_pu_bacteria 2824661429 2824663395 389
425 iso_pu_bacteria 2844315083 2844316680 389
426 iso_pu_bacteria 2857509624 2857512419 389
427 iso_pu_bacteria 2876761206 2876768767 389
428 iso_pu_bacteria 2879099564 2879109089 389
429 iso_pu_bacteria 2903727486 2903733590 389
430 iso_pu_bacteria 2903768456 2903774153 389
431 iso_pu_bacteria 2906602504 2906608081 389
432 iso_pu_bacteria 2906635258 2906636323 389
433 iso_pu_bacteria 2906660503 2906665390 389
434 iso_pu_bacteria 2908756301 2908759334 389
435 iso_pu_bacteria 2922368715 2922370897 389
436 iso_pu_bacteria 2922425934 2922427353 389
437 iso_pu_bacteria 2929615660 2929619301 389
438 iso_pu_bacteria 2929624759 2929628229 389
439 iso_pu_bacteria 2932784394 2932785600 389
440 iso_pu_bacteria 2932809354 2932813815 389
441 iso_pu_bacteria 2932818245 2932822216 389
442 iso_pu_bacteria 2932828146 2932830664 389
443 iso_pu_bacteria 2933577622 2933581222 389
444 iso_pu_bacteria 2935616580 2935620705 389
445 iso_pu_bacteria 2935638405 2935639783 389
446 iso_pu_bacteria 2935656913 2935658571 389
447 iso_pu_bacteria 2935665750 2935667379 389
448 iso_pu_bacteria 2935675223 2935677562 389
449 iso_pu_bacteria 2935684952 2935690496 389
450 iso_pu_bacteria 2935694250 2935697173 389
451 iso_pu_bacteria 2935703347 2935705119 389
452 iso_pu_bacteria 2935713505 2935717808 389
453 iso_pu_bacteria 2935722832 2935727042 389
454 iso_pu_bacteria 2935732158 2935735812 389
455 iso_pu_bacteria 2935741537 2935744917 389
456 iso_pu_bacteria 2935750917 2935755505 389
457 iso_pu_bacteria 2935760218 2935761981 389
458 iso_pu_bacteria 2935801545 2935803480 389
459 iso_pu_bacteria 2935810662 2935811406 389
460 iso_pu_bacteria 2935827899 2935829266 389
461 iso_pu_bacteria 2935837841 2935842755 389
462 iso_pu_bacteria 2935855204 2935858513 389
463 iso_pu_bacteria 2935864058 2935867066 389
464 iso_pu_bacteria 2935873716 2935877196 389
465 iso_pu_bacteria 2935959822 2935961759 389
466 iso_pu_bacteria 2935984226 2935986133 389
467 iso_pu_bacteria 2935992306 2935995168 389
468 iso_pu_bacteria 2936002035 2936004055 389
469 iso_pu_bacteria 2936011229 2936013017 389
470 iso_pu_bacteria 2936019824 2936021896 389
471 iso_pu_bacteria 2936028420 2936030310 389
472 iso_pu_bacteria 2936037263 2936037988 389
473 iso_pu_bacteria 2936046547 2936048090 389
474 iso_pu_bacteria 2936055302 2936059722 389
475 iso_pu_bacteria 2940556831 2940561214 389
476 iso_pu_bacteria 2941531003 2941533464 389
477 iso_pu_bacteria 2941538514 2941544396 389
478 iso_pu_bacteria 3005474847 3005477076 389
479 iso_pu_bacteria 3005594810 3005596290 389
480 iso_pu_bacteria 3005710791 3005712340 389
481 iso_pu_bacteria 8017057580 8017059814 389
482 iso_pu_bacteria 8019576017 8019579293 389
483 iso_pu_bacteria 8019586578 8019597348 389
484 iso_pu_bacteria 8019597564 8019604339 389
485 iso_pu_bacteria 8019648815 8019650282 389
486 iso_pu_bacteria 8055742211 8055749441 389
487 iso_pu_bacteria 8056689827 8056695571 389
488 iso_pu_bacteria 8056967851 8056973686 389
489 3300005983 Ga0081540_1015177 Ga0081540_10151772 390
490 3300021320 Ga0214544_1008275 Ga0214544_10082753 390
491 3300021321 Ga0214542_1012703 Ga0214542_10127036 390
492 3300021324 Ga0214545_1012219 Ga0214545_10122194 390
493 3300021327 Ga0214543_1012996 Ga0214543_10129969 390
494 3300028800 Ga0265338_10016905 Ga0265338_100169055 390
495 3300031238 Ga0265332_10040902 Ga0265332_100409022 390
496 3300031250 Ga0265331_10015943 Ga0265331_100159432 390
497 3300031344 Ga0265316_10021082 Ga0265316_100210825 390
498 3300031711 Ga0265314_10008043 Ga0265314_100080438 390
499 3300031711 Ga0265314_10061163 Ga0265314_100611632 390
500 3300044656 Ga0466969_0057666 Ga0466969_0057666_513_1799 390
501 3300046455 Ga0495603_0042187 Ga0495603_0042187_538_1857 390
502 3300046459 Ga0495629_0016210 Ga0495629_0016210_136_1455 390
503 3300046472 Ga0495580_0001693 Ga0495580_0001693_3523_4842 390
504 3300046473 Ga0495582_0000835 Ga0495582_0000835_4989_6308 390
505 3300046477 Ga0495664_0000543 Ga0495664_0000543_14072_15391 390
506 3300046507 Ga0495606_0118198 Ga0495606_0118198_172_1506 390
507 3300046514 Ga0495618_0004237 Ga0495618_0004237_6730_8049 390
508 3300046516 Ga0495628_0012278 Ga0495628_0012278_3820_5139 390
509 3300046517 Ga0495630_0008870 Ga0495630_0008870_3820_5139 390
510 3300046524 Ga0495648_0002513 Ga0495648_0002513_3501_4820 390
511 3300046526 Ga0495666_0005356 Ga0495666_0005356_4472_5791 390
512 3300046529 Ga0495652_0039243 Ga0495652_0039243_264_1583 390
513 3300046531 Ga0495665_0010310 Ga0495665_0010310_2082_3401 390
514 3300046533 Ga0495640_0054472 Ga0495640_0054472_883_2202 390
515 3300046535 Ga0495586_0006289 Ga0495586_0006289_3895_5214 390
516 3300046536 Ga0495587_0000944 Ga0495587_0000944_14352_15671 390
517 3300046642 Ga0495634_0012232 Ga0495634_0012232_3662_4981 390
518 3300046663 Ga0495635_0005994 Ga0495635_0005994_544_1863 390
519 3300046665 Ga0495661_0006113 Ga0495661_0006113_3483_4802 390
520 3300046674 Ga0495588_0026075 Ga0495588_0026075_872_2191 390
521 3300046678 Ga0495599_0006450 Ga0495599_0006450_4972_6291 390
522 3300046679 Ga0495623_0010842 Ga0495623_0010842_270_1589 390
523 3300046680 Ga0495646_0052411 Ga0495646_0052411_883_2202 390
524 3300046689 Ga0495613_0004325 Ga0495613_0004325_3502_4821 390
525 3300046690 Ga0495624_0024980 Ga0495624_0024980_1186_2505 390
526 3300047315 Ga0495581_0000993 Ga0495581_0000993_2512_3831 390
527 3300047317 Ga0495604_0012527 Ga0495604_0012527_449_1768 390
528 3300047319 Ga0495674_0052956 Ga0495674_0052956_1065_2384 390
529 3300047321 Ga0495676_0002659 Ga0495676_0002659_10779_12098 390
530 3300047322 Ga0495680_0013331 Ga0495680_0013331_4266_5585 390
531 3300047444 Ga0495675_0003472 Ga0495675_0003472_5090_6409 390
532 3300047446 Ga0495679_000980 Ga0495679_000980_3820_5139 390
533 3300047673 Ga0495593_0009058 Ga0495593_0009058_562_1881 390
534 3300048088 Ga0495602_0024850 Ga0495602_0024850_799_2118 390
535 3300048089 Ga0495614_0000540 Ga0495614_0000540_1657_2976 390
536 3300049572 Ga0501036_0053438 Ga0501036_0053438_1319_2608 390
537 3300053094 Ga0500566_0000384 Ga0500566_0000384_21456_22739 390
538 3300053178 Ga0500637_0107218 Ga0500637_0107218_234_1517 390
539 iso_pu_bacteria 2617270741 2617379428 390
540 iso_pu_bacteria 2721755755 2723844156 390
541 iso_pu_bacteria 2824600985 2824608393 390
542 iso_pu_bacteria 2824609381 2824611482 390
543 iso_pu_bacteria 2824653114 2824657238 390
544 iso_pu_bacteria 2874604998 2874611859 390
545 iso_pu_bacteria 2876808645 2876812135 390
546 iso_pu_bacteria 2879110137 2879116353 390
547 iso_pu_bacteria 2885409591 2885410605 390
548 iso_pu_bacteria 2888419890 2888421710 390
549 iso_pu_bacteria 8006964411 8006970584 390
550 iso_pu_bacteria 8006984368 8006991337 390
551 iso_pu_bacteria 8006994254 8007000608 390
552 iso_pu_bacteria 8056673599 8056680222 390
553 3300005548 Ga0070665_100197241 Ga0070665_1001972412 391
554 3300031247 Ga0265340_10000034 Ga0265340_1000003471 391
555 3300031249 Ga0265339_10010044 Ga0265339_100100447 391
556 3300031344 Ga0265316_10005018 Ga0265316_1000501814 391
557 3300031595 Ga0265313_10001217 Ga0265313_100012173 391
558 3300031712 Ga0265342_10029900 Ga0265342_100299004 391
559 3300039437 Ga0436365_1275535 Ga0436365_1275535_3143_4492 391
560 iso_pu_bacteria 2524023210 2524471077 391
561 iso_pu_bacteria 2885374607 2885382028 391
562 iso_pu_bacteria 2922361189 2922366505 391
563 iso_pu_bacteria 2922386360 2922386412 391
564 iso_pu_bacteria 3003665799 3003667465 391
565 3300014325 Ga0163163_10256669 Ga0163163_102566691 392
566 3300028577 Ga0265318_10001236 Ga0265318_100012363 392
567 3300049570 Ga0501033_0027882 Ga0501033_0027882_1387_2637 392
568 3300049571 Ga0501034_0050567 Ga0501034_0050567_1976_3226 392
569 3300049580 Ga0501046_0004938 Ga0501046_0004938_10497_11747 392
570 3300049581 Ga0501047_0005044 Ga0501047_0005044_5243_6493 392
571 3300049823 Ga0501044_0005897 Ga0501044_0005897_11366_12616 392
572 3300005563 Ga0068855_100000969 Ga0068855_10000096913 393
573 3300010375 Ga0105239_10039339 Ga0105239_100393393 393
574 3300025913 Ga0207695_10159361 Ga0207695_101593611 393
575 3300025949 Ga0207667_10000012 Ga0207667_10000012131 393
576 3300049822 Ga0501035_0096445 Ga0501035_0096445_458_1717 393
577 3300048924 Ga0496121_0010454 Ga0496121_0010454_2729_4066 394
578 3300049586 Ga0501070_0039423 Ga0501070_0039423_1527_2849 394
579 iso_pu_bacteria 2643221562 2643830218 394
580 iso_pu_bacteria 2643221577 2643894325 394
581 iso_pu_bacteria 2643221685 2644476528 394
582 3300003320 rootH2_10136250 rootH2_101362501 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

12

212

0.9

PF07690

MFS_1

Major Facilitator Superfamily

16

285

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pmy-assembly1.cif.gz_A hspept2 bound to ala-phe in the inward facing partially occluded conformation 0.7402 11 209
7s8u-assembly1.cif.gz_A cryo-em structure of a mammalian peptide transporter (pept1/slc15a1) in nanodisc 0.6456 7 231
7nqk-assembly1.cif.gz_A cryo-em structure of the mammalian peptide transporter pept2 0.597 11 264
8hnh-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with simeprevir 0.5228 12 325
8hnc-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with bilirubin 0.5207 12 325
ID Description Score Start End Superfamily
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9575 10 209 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9556 11 209 1.20.1250.20
af_A0A1D6LG74_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9341 60 209 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.921 10 209 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9008 10 209 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9PLT9-F1-model_v4 deleted 0.9551 11 176
AF-R7U0W9-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9509 1 170 GO:0005886
GO:0015293
AF-A0A7V9PM44-F1-model_v4 deleted 0.9373 5 209
AF-A0A2D8K0Z2-F1-model_v4 MFS transporter 0.9363 11 170 GO:0005886
GO:0022857
AF-A0A3D0Q216-F1-model_v4 MFS transporter 0.9341 10 210 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.02 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map