F466099

General Info

Members Datasets Scaffolds Average Seq Length
581 365 572 206

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0107782|Ga0495648_0107782_305_1057
Length 250
Sequence MRWQPLWPPVSRDVLSACRDYHSSALVWPLTPVNFRKTRTQGKPETPTVIPVASHPERNVIRVQLKQNEALKDLADADRAELESHLVVVEGNKGDFLLHQGVREMEQYFILDGILKRVVSNQEGKEMILRFADQNDMETSYAALRLGTPTPYGIVCVTKARVASLPLKEWITFLNRHAETKELFEYLVMKGMSEIMAHTITLHLLDAPGRVHRFVRKHPELAERIPKKELAAYLNLAAETLSRLKQQGKI

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
6 2928070936 Variovorax gossypii 1167 Isolate Unclassified
7 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
8 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
9 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
314 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
315 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
316 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
321 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
337 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
341 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
342 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
345 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
346 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
347 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
348 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
352 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
358 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
363 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.2
Nodule 0
Rhizoplane 4.3
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010267 3300001979 Bacteria 3617
2 JGI24739J22299_10012366 3300001989 Bacteria 3136
3 JGI25152J39213_1004480 3300002773 Bacteria 4390
4 JGI25150J39212_1003617 3300002774 Bacteria 3592
5 JGI25159J45721_1019792 3300002987 Bacteria 1315
6 JGI25151J46595_10011657 3300003187 Bacteria 4034
7 JGI25153J46596_10001867 3300003215 Bacteria 12477
8 rootH1_10021104 3300003316 Bacteria 1108
9 rootH2_10013705 3300003320 Bacteria 1831
10 rootH2_10067880 3300003320 Bacteria 1141
11 JGI25161J50226_1007551 3300003374 Bacteria 1804
12 Ga0055535_1000378 3300003761 Bacteria 42270
13 Ga0055542_1000036 3300003762 Bacteria 227346
14 Ga0055526_1029483 3300003771 Bacteria 1627
15 Ga0055537_1007928 3300003773 Bacteria 2499
16 Ga0055524_1025578 3300003775 Bacteria 1845
17 Ga0055536_1005507 3300003781 Bacteria 6165
18 Ga0055536_1008391 3300003781 Bacteria 4447
19 Ga0055528_1026183 3300003790 Bacteria 1687
20 Ga0055530_10003783 3300003791 Bacteria 8342
21 Ga0055530_10006987 3300003791 Bacteria 4871
22 Ga0055540_1004457 3300003792 Bacteria 6289
23 Ga0055540_1022163 3300003792 Bacteria 1631
24 Ga0055531_10001303 3300003794 Bacteria 18799
25 Ga0055531_10006289 3300003794 Bacteria 6768
26 Ga0065714_10103921 3300005288 Bacteria 1594
27 Ga0070658_10024683 3300005327 Bacteria 4820
28 Ga0070683_100054744 3300005329 Bacteria 3700
29 Ga0070683_101283494 3300005329 Bacteria 704
30 Ga0070690_100005700 3300005330 Bacteria 7015
31 Ga0070670_100607057 3300005331 Bacteria 979
32 Ga0070677_10067252 3300005333 Bacteria 1496
33 Ga0070666_10010460 3300005335 Bacteria 5806
34 Ga0070666_10085482 3300005335 Bacteria 2160
35 Ga0070682_100366483 3300005337 Bacteria 1079
36 Ga0070682_100715252 3300005337 Bacteria 804
37 Ga0068868_100044505 3300005338 Bacteria 3470
38 Ga0070660_100504617 3300005339 Bacteria 1006
39 Ga0070689_100027094 3300005340 Bacteria 4319
40 Ga0070689_100134541 3300005340 Bacteria 1984
41 Ga0070687_100071796 3300005343 Bacteria 1861
42 Ga0070661_100099997 3300005344 Bacteria 2156
43 Ga0070668_100061617 3300005347 Bacteria 2906
44 Ga0070668_100820052 3300005347 Bacteria 827
45 Ga0070669_100026299 3300005353 Bacteria 4186
46 Ga0070669_100266442 3300005353 Bacteria 1368
47 Ga0070675_100012318 3300005354 Bacteria 6702
48 Ga0070671_100094971 3300005355 Bacteria 2499
49 Ga0070671_100256013 3300005355 Bacteria 1487
50 Ga0070671_100494839 3300005355 Bacteria 1051
51 Ga0070674_100105131 3300005356 Bacteria 2064
52 Ga0070674_100149986 3300005356 Bacteria 1758
53 Ga0070674_100226944 3300005356 Bacteria 1456
54 Ga0070673_100007204 3300005364 Bacteria 7313
55 Ga0070673_100069810 3300005364 Bacteria 2817
56 Ga0070673_100125587 3300005364 Bacteria 2146
57 Ga0070673_100184690 3300005364 Bacteria 1787
58 Ga0070688_100015547 3300005365 Bacteria 4334
59 Ga0070667_100012330 3300005367 Bacteria 7072
60 Ga0070667_100176237 3300005367 Bacteria 1890
61 Ga0070667_100484614 3300005367 Bacteria 1132
62 Ga0070667_100654661 3300005367 Bacteria 970
63 Ga0070714_100005767 3300005435 Bacteria 9495
64 Ga0070713_100015249 3300005436 Bacteria 5734
65 Ga0070713_100286072 3300005436 Bacteria 1514
66 Ga0070711_100060830 3300005439 Bacteria 2627
67 Ga0070700_100382653 3300005441 Bacteria 1053
68 Ga0070663_100132315 3300005455 Bacteria 1895
69 Ga0070663_100172767 3300005455 Bacteria 1671
70 Ga0070678_100059633 3300005456 Bacteria 2805
71 Ga0070678_100112197 3300005456 Bacteria 2135
72 Ga0070678_100373039 3300005456 Bacteria 1232
73 Ga0070678_100463233 3300005456 Bacteria 1112
74 Ga0070662_100112117 3300005457 Bacteria 2079
75 Ga0070662_100645707 3300005457 Bacteria 892
76 Ga0070681_10038217 3300005458 Bacteria 4813
77 Ga0070681_10258443 3300005458 Bacteria 1654
78 Ga0070681_10907202 3300005458 Bacteria 800
79 Ga0068867_100124832 3300005459 Bacteria 1993
80 Ga0068867_100830297 3300005459 Bacteria 826
81 Ga0070685_10314186 3300005466 Bacteria 1060
82 Ga0070706_100207786 3300005467 Bacteria 1828
83 Ga0070707_100067458 3300005468 Bacteria 3441
84 Ga0070707_100231147 3300005468 Bacteria 1800
85 Ga0070699_100420962 3300005518 Bacteria 1209
86 Ga0070679_100036685 3300005530 Bacteria 4865
87 Ga0070684_100057619 3300005535 Bacteria 3392
88 Ga0068853_100101829 3300005539 Bacteria 2541
89 Ga0068853_100178016 3300005539 Bacteria 1928
90 Ga0070672_100047045 3300005543 Bacteria 3346
91 Ga0070672_100059871 3300005543 Bacteria 2997
92 Ga0070672_100337573 3300005543 Bacteria 1283
93 Ga0070672_100613100 3300005543 Bacteria 949
94 Ga0070665_100781913 3300005548 Bacteria 967
95 Ga0070665_100988455 3300005548 Bacteria 854
96 Ga0070704_100282329 3300005549 Bacteria 1376
97 Ga0068855_100003441 3300005563 Bacteria 19369
98 Ga0068855_100005041 3300005563 Bacteria 16117
99 Ga0070664_100010652 3300005564 Bacteria 7451
100 Ga0070664_100397752 3300005564 Bacteria 1259
101 Ga0070664_100438789 3300005564 Bacteria 1197
102 Ga0068857_100088615 3300005577 Bacteria 2768
103 Ga0068856_100445296 3300005614 Bacteria 1316
104 Ga0070702_100645125 3300005615 Bacteria 800
105 Ga0068852_100073013 3300005616 Bacteria 3017
106 Ga0068852_100112526 3300005616 Bacteria 2477
107 Ga0068852_100782175 3300005616 Bacteria 968
108 Ga0068859_100005136 3300005617 Bacteria 13293
109 Ga0068864_100009415 3300005618 Bacteria 8059
110 Ga0068864_100234055 3300005618 Bacteria 1700
111 Ga0068864_100286653 3300005618 Bacteria 1538
112 Ga0068864_100354337 3300005618 Bacteria 1385
113 Ga0068851_10080163 3300005834 Bacteria 1704
114 Ga0068851_10083261 3300005834 Bacteria 1673
115 Ga0068863_100045854 3300005841 Bacteria 4149
116 Ga0068863_100330639 3300005841 Bacteria 1481
117 Ga0068858_100008304 3300005842 Bacteria 9984
118 Ga0068862_100201122 3300005844 Bacteria 1796
119 Ga0068862_100273199 3300005844 Bacteria 1546
120 Ga0070717_10068762 3300006028 Bacteria 2948
121 Ga0075365_10398935 3300006038 Bacteria 971
122 Ga0075362_10125114 3300006177 Bacteria 1219
123 Ga0075367_10033449 3300006178 Bacteria 2963
124 Ga0075369_10079480 3300006186 Bacteria 1453
125 Ga0097621_100054643 3300006237 Bacteria 3258
126 Ga0097621_100150903 3300006237 Bacteria 1993
127 Ga0097621_100312785 3300006237 Bacteria 1390
128 Ga0097621_100331671 3300006237 Bacteria 1349
129 Ga0075370_10011450 3300006353 Bacteria 4660
130 Ga0075370_10060241 3300006353 Bacteria 2162
131 Ga0075370_10062376 3300006353 Bacteria 2124
132 Ga0075370_10086706 3300006353 Bacteria 1803
133 Ga0075430_100738553 3300006846 Bacteria 811
134 Ga0075429_100012958 3300006880 Bacteria 7233
135 Ga0097620_100005136 3300006931 Bacteria 13293
136 Ga0105244_10024726 3300009036 Bacteria 3274
137 Ga0105240_10002337 3300009093 Bacteria 30662
138 Ga0105240_10020056 3300009093 Bacteria 8924
139 Ga0111539_10848431 3300009094 Bacteria 1063
140 Ga0105245_10301228 3300009098 Bacteria 1573
141 Ga0114129_10604104 3300009147 Bacteria 1421
142 Ga0105243_10024314 3300009148 Bacteria 4620
143 Ga0105243_10189350 3300009148 Bacteria 1796
144 Ga0105243_10271575 3300009148 Bacteria 1523
145 Ga0105243_10326992 3300009148 Bacteria 1399
146 Ga0105241_10031759 3300009174 Bacteria 3955
147 Ga0105242_10001654 3300009176 Bacteria 17608
148 Ga0105242_10193224 3300009176 Bacteria 1803
149 Ga0105242_10406649 3300009176 Bacteria 1272
150 Ga0105248_10038088 3300009177 Bacteria 5381
151 Ga0105237_10000407 3300009545 Bacteria 61234
152 Ga0105237_10336513 3300009545 Bacteria 1514
153 Ga0105238_10013664 3300009551 Bacteria 8199
154 Ga0105238_10032068 3300009551 Bacteria 5347
155 Ga0105238_10124680 3300009551 Bacteria 2555
156 Ga0105238_10253569 3300009551 Bacteria 1738
157 Ga0105238_10483859 3300009551 Bacteria 1237
158 Ga0105249_10269535 3300009553 Bacteria 1696
159 Ga0105239_10000335 3300010375 Bacteria 68810
160 Ga0105246_10024778 3300011119 Bacteria 3903
161 Ga0105246_10178035 3300011119 Bacteria 1635
162 Ga0105246_10582822 3300011119 Bacteria 964
163 Ga0157347_1001530 3300012502 Bacteria 1832
164 Ga0157316_1009859 3300012510 Bacteria 866
165 Ga0157371_10115087 3300013102 Bacteria 1910
166 Ga0157370_10001435 3300013104 Bacteria 29541
167 Ga0157370_10152790 3300013104 Bacteria 2148
168 Ga0157378_10215544 3300013297 Bacteria 1823
169 Ga0157378_10323325 3300013297 Bacteria 1499
170 Ga0157378_11425416 3300013297 Bacteria 736
171 Ga0163162_10035213 3300013306 Bacteria 4984
172 Ga0163162_10112217 3300013306 Bacteria 2825
173 Ga0163162_10253862 3300013306 Bacteria 1890
174 Ga0157372_10145921 3300013307 Bacteria 2729
175 Ga0157372_10156403 3300013307 Bacteria 2633
176 Ga0157372_10216447 3300013307 Bacteria 2220
177 Ga0157375_10001395 3300013308 Bacteria 20856
178 Ga0157375_10210762 3300013308 Bacteria 2100
179 Ga0163163_10007322 3300014325 Bacteria 9733
180 Ga0163163_10146101 3300014325 Bacteria 2408
181 Ga0163163_10582623 3300014325 Bacteria 1182
182 Ga0157380_10100761 3300014326 Bacteria 2405
183 Ga0157380_10149293 3300014326 Bacteria 2018
184 Ga0157380_10625048 3300014326 Bacteria 1070
185 Ga0157380_11023268 3300014326 Bacteria 861
186 Ga0182008_10009207 3300014497 Bacteria 5339
187 Ga0182008_10036405 3300014497 Bacteria 2463
188 Ga0157377_10108816 3300014745 Bacteria 1663
189 Ga0157376_10294903 3300014969 Bacteria 1533
190 Ga0182006_1013696 3300015261 Bacteria 3510
191 Ga0182007_10001904 3300015262 Bacteria 10866
192 Ga0163161_10000201 3300017792 Bacteria 54704
193 Ga0163161_10180073 3300017792 Bacteria 1620
194 Ga0163161_10239386 3300017792 Bacteria 1411
195 Ga0163161_10248548 3300017792 Bacteria 1386
196 Ga0209672_101176 3300025228 Bacteria 10682
197 Ga0209147_100472 3300025229 Bacteria 24613
198 Ga0209258_100091 3300025242 Bacteria 227454
199 Ga0207425_1000190 3300025245 Bacteria 49963
200 Ga0209148_1000033 3300025254 Bacteria 555508
201 Ga0209129_1000091 3300025258 Bacteria 175716
202 Ga0209129_1001758 3300025258 Bacteria 11609
203 Ga0209129_1007810 3300025258 Bacteria 3094
204 Ga0209565_1000335 3300025263 Bacteria 41834
205 Ga0209565_1001489 3300025263 Bacteria 10233
206 Ga0209673_1000154 3300025273 Bacteria 146394
207 Ga0209673_1003688 3300025273 Bacteria 8814
208 Ga0209673_1038127 3300025273 Bacteria 1403
209 Ga0209673_1041298 3300025273 Bacteria 1310
210 Ga0209130_1000140 3300025284 Bacteria 115434
211 Ga0209130_1000782 3300025284 Bacteria 27407
212 Ga0209130_1001760 3300025284 Bacteria 12841
213 Ga0209675_1001002 3300025291 Bacteria 17764
214 Ga0209675_1001248 3300025291 Bacteria 15267
215 Ga0209675_1005234 3300025291 Bacteria 5497
216 Ga0209676_1000048 3300025292 Bacteria 403716
217 Ga0209676_1001621 3300025292 Bacteria 19914
218 Ga0209676_1017331 3300025292 Bacteria 2555
219 Ga0209025_1000207 3300025294 Bacteria 140774
220 Ga0209025_1000286 3300025294 Bacteria 114096
221 Ga0209025_1000356 3300025294 Bacteria 98547
222 Ga0209025_1007807 3300025294 Bacteria 7865
223 Ga0209025_1016840 3300025294 Bacteria 4271
224 Ga0209564_1000103 3300025295 Bacteria 221166
225 Ga0209564_1000597 3300025295 Bacteria 56580
226 Ga0209758_1000092 3300025297 Bacteria 241910
227 Ga0209758_1000262 3300025297 Bacteria 104339
228 Ga0209758_1032569 3300025297 Bacteria 2112
229 Ga0209758_1044133 3300025297 Bacteria 1634
230 Ga0209050_1000012 3300025298 Bacteria 813717
231 Ga0209050_1000511 3300025298 Bacteria 65746
232 Ga0209256_1000065 3300025299 Bacteria 248104
233 Ga0209256_1000094 3300025299 Bacteria 208177
234 Ga0207426_1000084 3300025302 Bacteria 298123
235 Ga0207426_1000161 3300025302 Bacteria 172765
236 Ga0209051_1000273 3300025303 Bacteria 84847
237 Ga0209051_1000326 3300025303 Bacteria 71572
238 Ga0209051_1000644 3300025303 Bacteria 39711
239 Ga0209051_1014092 3300025303 Bacteria 3751
240 Ga0209051_1020750 3300025303 Bacteria 2817
241 Ga0209257_1000012 3300025304 Bacteria 1111138
242 Ga0209257_1000045 3300025304 Bacteria 484429
243 Ga0209257_1000249 3300025304 Bacteria 124522
244 Ga0209257_1001999 3300025304 Bacteria 21868
245 Ga0209257_1007808 3300025304 Bacteria 6340
246 Ga0207697_10030636 3300025315 Bacteria 2201
247 Ga0207656_10050387 3300025321 Bacteria 1798
248 Ga0207656_10056644 3300025321 Bacteria 1709
249 Ga0207656_10126632 3300025321 Bacteria 1194
250 Ga0207655_1003575 3300025728 Bacteria 11504
251 Ga0207682_10020913 3300025893 Bacteria 2572
252 Ga0207682_10132731 3300025893 Bacteria 1112
253 Ga0207682_10141708 3300025893 Bacteria 1079
254 Ga0207680_10006674 3300025903 Bacteria 5598
255 Ga0207680_10067605 3300025903 Bacteria 2202
256 Ga0207699_10025169 3300025906 Bacteria 3265
257 Ga0207643_10076497 3300025908 Bacteria 1933
258 Ga0207643_10315539 3300025908 Bacteria 975
259 Ga0207705_10111137 3300025909 Bacteria 2025
260 Ga0207654_10174656 3300025911 Bacteria 1398
261 Ga0207707_10246144 3300025912 Bacteria 1553
262 Ga0207695_10059818 3300025913 Bacteria 3948
263 Ga0207695_10344407 3300025913 Bacteria 1378
264 Ga0207695_10556436 3300025913 Bacteria 1029
265 Ga0207671_10001396 3300025914 Bacteria 28078
266 Ga0207671_10298476 3300025914 Bacteria 1272
267 Ga0207657_10257226 3300025919 Bacteria 1390
268 Ga0207657_10333612 3300025919 Bacteria 1197
269 Ga0207657_10773737 3300025919 Bacteria 743
270 Ga0207649_10094148 3300025920 Bacteria 1968
271 Ga0207652_10041183 3300025921 Bacteria 3925
272 Ga0207646_10236684 3300025922 Bacteria 1650
273 Ga0207681_10077489 3300025923 Bacteria 2337
274 Ga0207694_10015293 3300025924 Bacteria 5790
275 Ga0207694_10187489 3300025924 Bacteria 1679
276 Ga0207694_10375547 3300025924 Bacteria 1179
277 Ga0207650_10424797 3300025925 Bacteria 1103
278 Ga0207659_10003908 3300025926 Bacteria 8987
279 Ga0207659_10106261 3300025926 Bacteria 2125
280 Ga0207687_10361930 3300025927 Bacteria 1184
281 Ga0207700_10173905 3300025928 Bacteria 1798
282 Ga0207664_10032555 3300025929 Bacteria 3998
283 Ga0207644_10009027 3300025931 Bacteria 6534
284 Ga0207706_10101365 3300025933 Bacteria 2533
285 Ga0207706_10490393 3300025933 Bacteria 1061
286 Ga0207686_10006099 3300025934 Bacteria 6475
287 Ga0207686_10139875 3300025934 Bacteria 1671
288 Ga0207709_10001312 3300025935 Bacteria 17674
289 Ga0207709_10521937 3300025935 Bacteria 930
290 Ga0207670_10021741 3300025936 Bacteria 3963
291 Ga0207669_10118963 3300025937 Bacteria 1789
292 Ga0207704_10121287 3300025938 Bacteria 1790
293 Ga0207704_10156688 3300025938 Bacteria 1615
294 Ga0207691_10047657 3300025940 Bacteria 3932
295 Ga0207691_10093501 3300025940 Bacteria 2692
296 Ga0207691_10230084 3300025940 Bacteria 1605
297 Ga0207711_10029564 3300025941 Bacteria 4624
298 Ga0207711_10126914 3300025941 Bacteria 2283
299 Ga0207711_10315101 3300025941 Bacteria 1445
300 Ga0207711_10402275 3300025941 Bacteria 1272
301 Ga0207711_10512895 3300025941 Bacteria 1118
302 Ga0207661_10118452 3300025944 Bacteria 2251
303 Ga0207679_10142882 3300025945 Bacteria 1937
304 Ga0207667_10012604 3300025949 Bacteria 9719
305 Ga0207667_10022683 3300025949 Bacteria 6925
306 Ga0207667_10084330 3300025949 Bacteria 3289
307 Ga0207651_10001572 3300025960 Bacteria 10454
308 Ga0207651_10038100 3300025960 Bacteria 3156
309 Ga0207712_10082355 3300025961 Bacteria 2346
310 Ga0207640_10410606 3300025981 Bacteria 1105
311 Ga0207640_11076773 3300025981 Bacteria 710
312 Ga0207658_10028843 3300025986 Bacteria 3912
313 Ga0207658_10106749 3300025986 Bacteria 2205
314 Ga0207658_10168406 3300025986 Bacteria 1802
315 Ga0207677_10001764 3300026023 Bacteria 11437
316 Ga0207703_10013263 3300026035 Bacteria 6419
317 Ga0207678_10168650 3300026067 Bacteria 1869
318 Ga0207678_10258203 3300026067 Bacteria 1493
319 Ga0207678_10270203 3300026067 Bacteria 1458
320 Ga0207708_10241634 3300026075 Bacteria 1452
321 Ga0207702_10374981 3300026078 Bacteria 1367
322 Ga0207641_10104443 3300026088 Bacteria 2501
323 Ga0207676_10000860 3300026095 Bacteria 23595
324 Ga0207674_10043572 3300026116 Bacteria 4626
325 Ga0207675_100071167 3300026118 Bacteria 3251
326 Ga0207683_10111828 3300026121 Bacteria 2446
327 Ga0207683_10130831 3300026121 Bacteria 2257
328 Ga0207683_10227369 3300026121 Bacteria 1701
329 Ga0207698_10017771 3300026142 Bacteria 4834
330 Ga0207698_10090604 3300026142 Bacteria 2501
331 Ga0207698_10240379 3300026142 Bacteria 1650
332 Ga0268266_10508095 3300028379 Bacteria 1151
333 Ga0268265_10320490 3300028380 Bacteria 1403
334 Ga0268264_10009846 3300028381 Bacteria 7912
335 Ga0268264_10053300 3300028381 Bacteria 3374
336 Ga0307517_10239552 3300028786 Bacteria 1078
337 Ga0307515_10000030 3300028794 Bacteria 364482
338 Ga0307515_10000034 3300028794 Bacteria 344640
339 Ga0307515_10000586 3300028794 Bacteria 85517
340 Ga0307515_10005841 3300028794 Bacteria 24838
341 Ga0307515_10076382 3300028794 Bacteria 4445
342 Ga0307515_10139879 3300028794 Bacteria 2604
343 Ga0307512_10094956 3300030522 Bacteria 2054
344 Ga0307512_10106244 3300030522 Bacteria 1874
345 Ga0307512_10309400 3300030522 Bacteria 728
346 Ga0265330_10182455 3300031235 Bacteria 889
347 Ga0307513_10000285 3300031456 Bacteria 73356
348 Ga0307513_10008606 3300031456 Bacteria 13021
349 Ga0307513_10063034 3300031456 Bacteria 3914
350 Ga0307513_10196324 3300031456 Bacteria 1864
351 Ga0307513_10414554 3300031456 Bacteria 1078
352 Ga0307509_10003393 3300031507 Bacteria 24259
353 Ga0307509_10008236 3300031507 Bacteria 13333
354 Ga0307509_10105334 3300031507 Bacteria 2842
355 Ga0307508_10000649 3300031616 Bacteria 41802
356 Ga0307514_10004105 3300031649 Bacteria 13508
357 Ga0265314_10122614 3300031711 Bacteria 1634
358 Ga0307516_10000839 3300031730 Bacteria 42125
359 Ga0307516_10001570 3300031730 Bacteria 31465
360 Ga0307516_10030714 3300031730 Bacteria 5420
361 Ga0307406_10534714 3300031901 Bacteria 956
362 Ga0307412_10027901 3300031911 Bacteria 3526
363 Ga0307412_10188006 3300031911 Bacteria 1559
364 Ga0307412_10756877 3300031911 Bacteria 839
365 Ga0307411_10318457 3300032005 Bacteria 1255
366 Ga0307411_10477163 3300032005 Bacteria 1049
367 Ga0307507_10062762 3300033179 Bacteria 3447
368 Ga0307510_10006302 3300033180 Bacteria 14153
369 Ga0307510_10016329 3300033180 Bacteria 8764
370 Ga0307510_10174022 3300033180 Bacteria 1726
371 Ga0373944_0094673 3300035089 Bacteria 1002
372 Ga0373946_0322521 3300035171 Bacteria 768
373 Ga0373924_0105601 3300035410 Bacteria 1214
374 Ga0373935_0207694 3300035692 Bacteria 1356
375 Ga0373927_0095438 3300035695 Bacteria 1933
376 Ga0373927_0302962 3300035695 Bacteria 1052
377 Ga0373937_0414157 3300036401 Bacteria 1279
378 Ga0373925_0287906 3300037068 Bacteria 1324
379 Ga0395899_0002908 3300037312 Bacteria 13761
380 Ga0395900_0070739 3300037418 Bacteria 3586
381 Ga0395898_0005675 3300037466 Bacteria 13453
382 Ga0395905_0000235 3300037471 Bacteria 83772
383 Ga0395905_0081796 3300037471 Bacteria 3026
384 Ga0395905_0487319 3300037471 Bacteria 1132
385 Ga0395901_0090756 3300038443 Bacteria 3198
386 Ga0395901_0484732 3300038443 Bacteria 1261
387 Ga0436365_1383684 3300039437 Bacteria 1219
388 Ga0439436_0002169 3300041404 Bacteria 5872
389 Ga0439436_0115208 3300041404 Bacteria 751
390 Ga0439447_005090 3300041407 Bacteria 4417
391 Ga0439466_0017929 3300041411 Bacteria 2545
392 Ga0439465_0000906 3300041413 Bacteria 9383
393 Ga0451793_0890613 3300041452 Bacteria 1546
394 Ga0451800_0270333 3300041459 Bacteria 1001
395 Ga0451800_1206011 3300041459 Bacteria 1233
396 Ga0451802_1353732 3300041460 Bacteria 2169
397 Ga0451807_0257418 3300041486 Bacteria 2447
398 Ga0451839_0670304 3300041496 Bacteria 1076
399 Ga0451851_1239324 3300041507 Bacteria 1140
400 Ga0451843_1371007 3300041509 Bacteria 1531
401 Ga0451855_0272045 3300041511 Bacteria 1439
402 Ga0451853_0418287 3300041512 Bacteria 4040
403 Ga0439431_0006328 3300041997 Bacteria 2616
404 Ga0439433_0009672 3300041999 Bacteria 2103
405 Ga0439445_0004467 3300042004 Bacteria 3170
406 Ga0439432_005173 3300042006 Bacteria 4713
407 Ga0439449_0009320 3300042007 Bacteria 3719
408 Ga0439452_015169 3300042010 Bacteria 2120
409 Ga0439462_0008844 3300042015 Bacteria 2544
410 Ga0451577_0049885 3300042876 Bacteria 3736
411 Ga0466969_0011806 3300044656 Bacteria 4620
412 Ga0466972_0027448 3300044658 Bacteria 2816
413 Ga0466965_0008961 3300044683 Bacteria 4638
414 Ga0466966_0018209 3300044684 Bacteria 4634
415 Ga0466961_0122698 3300044693 Bacteria 1630
416 Ga0466964_0134817 3300044706 Bacteria 1129
417 Ga0453684_0200783 3300044712 Bacteria 2324
418 Ga0466970_0096814 3300044765 Bacteria 1605
419 Ga0466957_0293428 3300044842 Bacteria 1091
420 Ga0466960_0003291 3300044901 Bacteria 6199
421 Ga0466959_0038422 3300045049 Bacteria 3537
422 Ga0451576_0002187 3300045051 Bacteria 30196
423 Ga0495638_0050605 3300046460 Bacteria 2594
424 Ga0495596_0214867 3300046500 Bacteria 747
425 Ga0495610_0024551 3300046512 Bacteria 3250
426 Ga0495610_0141450 3300046512 Bacteria 1035
427 Ga0495616_0014367 3300046513 Bacteria 4434
428 Ga0495620_0076295 3300046515 Bacteria 1362
429 Ga0495631_0000901 3300046518 Bacteria 18559
430 Ga0495637_0008435 3300046520 Bacteria 5061
431 Ga0495643_0018867 3300046522 Bacteria 3996
432 Ga0495648_0061025 3300046524 Bacteria 2241
433 Ga0495648_0107782 3300046524 Bacteria 1523
434 Ga0495663_0049349 3300046525 Bacteria 1300
435 Ga0495642_0060565 3300046528 Bacteria 1570
436 Ga0495654_0008561 3300046530 Bacteria 5642
437 Ga0495654_0171223 3300046530 Bacteria 946
438 Ga0495654_0188355 3300046530 Bacteria 890
439 Ga0495598_0011021 3300046537 Bacteria 2181
440 Ga0495598_0020011 3300046537 Bacteria 1762
441 Ga0495621_0001043 3300046539 Bacteria 7103
442 Ga0495621_0038648 3300046539 Bacteria 1666
443 Ga0495621_0056020 3300046539 Bacteria 1420
444 Ga0495622_0131016 3300046557 Bacteria 1142
445 Ga0495633_0087490 3300046558 Bacteria 1449
446 Ga0495656_0000270 3300046615 Bacteria 18372
447 Ga0495625_0001836 3300046660 Bacteria 24291
448 Ga0495625_0065474 3300046660 Bacteria 2561
449 Ga0495588_0119051 3300046674 Bacteria 1392
450 Ga0495588_0123935 3300046674 Bacteria 1362
451 Ga0495658_0012766 3300046683 Bacteria 4265
452 Ga0495613_0515961 3300046689 Bacteria 803
453 Ga0495670_0125644 3300046691 Bacteria 1335
454 Ga0495671_0001980 3300046692 Bacteria 13161
455 Ga0495676_0125626 3300047321 Bacteria 1859
456 Ga0495687_016741 3300047443 Bacteria 3678
457 Ga0495684_0110503 3300047471 Bacteria 2074
458 Ga0495686_0001547 3300047472 Bacteria 24575
459 Ga0495615_0001036 3300048090 Bacteria 3959
460 Ga0496100_0079972 3300048903 Bacteria 2204
461 Ga0496102_0028401 3300048905 Bacteria 4996
462 Ga0496102_0070707 3300048905 Bacteria 3204
463 Ga0496102_0415157 3300048905 Bacteria 1264
464 Ga0496103_0026318 3300048906 Bacteria 3522
465 Ga0496104_0027579 3300048907 Bacteria 5257
466 Ga0496105_0366479 3300048908 Bacteria 1148
467 Ga0496106_0117354 3300048909 Bacteria 2077
468 Ga0496106_0288833 3300048909 Bacteria 1315
469 Ga0496106_0309759 3300048909 Bacteria 1267
470 Ga0496107_0017711 3300048910 Bacteria 5013
471 Ga0496108_0015466 3300048911 Bacteria 6224
472 Ga0496110_1024184 3300048913 Bacteria 733
473 Ga0496113_0229364 3300048916 Bacteria 1481
474 Ga0496113_0328510 3300048916 Bacteria 1226
475 Ga0496114_0106743 3300048917 Bacteria 2396
476 Ga0496114_0627112 3300048917 Bacteria 947
477 Ga0496116_0011687 3300048919 Bacteria 7235
478 Ga0496117_0075576 3300048920 Bacteria 2237
479 Ga0496118_0035486 3300048921 Bacteria 4047
480 Ga0496118_0234296 3300048921 Bacteria 1056
481 Ga0496119_0048469 3300048922 Bacteria 2634
482 Ga0496119_0197157 3300048922 Bacteria 1045
483 Ga0496122_0359744 3300048925 Bacteria 756
484 Ga0496124_0121416 3300048927 Bacteria 2087
485 Ga0496125_0060933 3300048928 Bacteria 3029
486 Ga0496125_0144386 3300048928 Bacteria 1648
487 Ga0496126_0381431 3300048929 Bacteria 1147
488 Ga0501032_0235166 3300049569 Bacteria 1191
489 Ga0501033_0036647 3300049570 Bacteria 3674
490 Ga0501034_0171821 3300049571 Bacteria 2134
491 Ga0501036_0084645 3300049572 Bacteria 2681
492 Ga0501037_0288251 3300049573 Bacteria 1143
493 Ga0501047_0002291 3300049581 Bacteria 18316
494 Ga0501047_0052645 3300049581 Bacteria 3935
495 Ga0501069_0000781 3300049585 Bacteria 14959
496 Ga0501070_0000645 3300049586 Bacteria 32122
497 Ga0501073_0000370 3300049589 Bacteria 30322
498 Ga0501073_0064188 3300049589 Bacteria 2561
499 Ga0501074_0000213 3300049590 Bacteria 31865
500 Ga0501076_0520650 3300049592 Bacteria 980
501 Ga0501206_032265 3300049653 Bacteria 783
502 Ga0501217_048164 3300049661 Bacteria 1106
503 Ga0501239_012621 3300049672 Bacteria 958
504 Ga0501253_005411 3300049683 Bacteria 1674
505 Ga0501225_0066790 3300049705 Bacteria 1017
506 Ga0501079_0002160 3300049741 Bacteria 14166
507 Ga0501080_0001759 3300049742 Bacteria 18574
508 Ga0501080_0021746 3300049742 Bacteria 5942
509 Ga0501262_000465 3300049759 Bacteria 4826
510 Ga0501265_000251 3300049762 Bacteria 5366
511 Ga0501035_0542388 3300049822 Bacteria 953
512 Ga0501044_0044663 3300049823 Bacteria 4597
513 Ga0501044_0172309 3300049823 Bacteria 2134
514 Ga0501044_0399064 3300049823 Bacteria 1288
515 nmdc:mga03n38_41568_c1 3300050490 Bacteria 2004
516 nmdc:mga0k408_168015_c1 3300050493 Bacteria 1307
517 nmdc:mga0k408_172140_c1 3300050493 Bacteria 1291
518 nmdc:mga0k408_9944_c1 3300050493 Bacteria 5136
519 nmdc:mga06z11_50928_c1 3300050494 Bacteria 2118
520 nmdc:mga07m45_103524_c1 3300050496 Bacteria 1636
521 nmdc:mga07m45_19542_c1 3300050496 Bacteria 3672
522 nmdc:mga07m45_199272_c1 3300050496 Bacteria 1164
523 nmdc:mga07m45_205776_c1 3300050496 Bacteria 1145
524 nmdc:mga05p37_485668_c1 3300050507 Bacteria 1421
525 nmdc:mga09592_187549_c1 3300050508 Bacteria 1790
526 nmdc:mga0qj67_613237_c1 3300050509 Bacteria 870
527 nmdc:mga0n895_159993_c1 3300050512 Bacteria 2283
528 nmdc:mga08x19_2660_c1 3300050514 Bacteria 10809
529 Ga0500610_0005030 3300053079 Bacteria 5362
530 Ga0500610_0105157 3300053079 Bacteria 1456
531 Ga0495619_0065047 3300053085 Bacteria 2432
532 Ga0500643_005905 3300053087 Bacteria 5194
533 Ga0500643_060048 3300053087 Bacteria 1069
534 Ga0500644_0023398 3300053088 Bacteria 1876
535 Ga0500644_0055632 3300053088 Bacteria 1374
536 Ga0500647_0090296 3300053091 Bacteria 1467
537 Ga0500651_0000082 3300053093 Bacteria 60329
538 Ga0500651_0075438 3300053093 Bacteria 2095
539 Ga0500651_0140949 3300053093 Bacteria 1453
540 Ga0500651_0200741 3300053093 Bacteria 1177
541 Ga0500562_021120 3300053108 Bacteria 1692
542 Ga0500562_128221 3300053108 Bacteria 691
543 Ga0500571_000152 3300053110 Bacteria 23934
544 Ga0500592_010925 3300053116 Bacteria 1450
545 Ga0500593_000664 3300053117 Bacteria 13093
546 Ga0500594_0004880 3300053118 Bacteria 2965
547 Ga0500597_093856 3300053120 Bacteria 1304
548 Ga0500607_000049 3300053121 Bacteria 80941
549 Ga0500618_035638 3300053125 Bacteria 1155
550 Ga0500626_031951 3300053128 Bacteria 2379
551 Ga0500655_000668 3300053133 Bacteria 6814
552 Ga0500655_020210 3300053133 Bacteria 1243
553 Ga0500658_0018781 3300053134 Bacteria 2597
554 Ga0500559_0000021 3300053136 Bacteria 129980
555 Ga0500559_0006291 3300053136 Bacteria 5367
556 Ga0500561_0012355 3300053137 Bacteria 1820
557 Ga0500564_002728 3300053138 Bacteria 6631
558 Ga0500568_0003226 3300053139 Bacteria 9229
559 Ga0500604_0017693 3300053151 Bacteria 1977
560 Ga0500616_0011758 3300053153 Bacteria 5150
561 Ga0500622_0001453 3300053156 Bacteria 18934
562 Ga0500634_0041585 3300053161 Bacteria 2495
563 Ga0500634_0067724 3300053161 Bacteria 1876
564 Ga0500638_039409 3300053162 Bacteria 2293
565 Ga0500636_0019501 3300053177 Bacteria 4014
566 Ga0500636_0156302 3300053177 Bacteria 1248
567 Ga0500570_133490 3300053724 Bacteria 935
568 Ga0500645_001446 3300053730 Bacteria 12024
569 Ga0500565_016503 3300053734 Bacteria 839
570 Ga0500587_001719 3300053739 Bacteria 3107
571 Ga0501082_0016781 3300060353 Bacteria 6306
572 Ga0466962_0332047 3300061719 Bacteria 755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0094673 Ga0373944_0094673_218_820 200
2 3300035171 Ga0373946_0322521 Ga0373946_0322521_31_633 200
3 3300048907 Ga0496104_0027579 Ga0496104_0027579_4042_4644 200
4 iso_pu_bacteria 2928084124 2928088404 200
5 3300028786 Ga0307517_10239552 Ga0307517_102395522 201
6 3300031730 Ga0307516_10000839 Ga0307516_100008395 201
7 3300001979 JGI24740J21852_10010267 JGI24740J21852_100102672 202
8 3300001989 JGI24739J22299_10012366 JGI24739J22299_100123663 202
9 3300002773 JGI25152J39213_1004480 JGI25152J39213_10044802 202
10 3300002774 JGI25150J39212_1003617 JGI25150J39212_10036173 202
11 3300002987 JGI25159J45721_1019792 JGI25159J45721_10197921 202
12 3300003187 JGI25151J46595_10011657 JGI25151J46595_100116573 202
13 3300003215 JGI25153J46596_10001867 JGI25153J46596_100018673 202
14 3300003316 rootH1_10021104 rootH1_100211042 202
15 3300003320 rootH2_10013705 rootH2_100137052 202
16 3300003320 rootH2_10067880 rootH2_100678801 202
17 3300003374 JGI25161J50226_1007551 JGI25161J50226_10075512 202
18 3300003761 Ga0055535_1000378 Ga0055535_10003787 202
19 3300003762 Ga0055542_1000036 Ga0055542_1000036180 202
20 3300003771 Ga0055526_1029483 Ga0055526_10294832 202
21 3300003773 Ga0055537_1007928 Ga0055537_10079283 202
22 3300003775 Ga0055524_1025578 Ga0055524_10255782 202
23 3300003781 Ga0055536_1005507 Ga0055536_10055073 202
24 3300003781 Ga0055536_1008391 Ga0055536_10083913 202
25 3300003790 Ga0055528_1026183 Ga0055528_10261832 202
26 3300003791 Ga0055530_10003783 Ga0055530_100037833 202
27 3300003791 Ga0055530_10006987 Ga0055530_100069873 202
28 3300003792 Ga0055540_1004457 Ga0055540_10044573 202
29 3300003792 Ga0055540_1022163 Ga0055540_10221632 202
30 3300003794 Ga0055531_10001303 Ga0055531_1000130320 202
31 3300003794 Ga0055531_10006289 Ga0055531_100062894 202
32 3300005288 Ga0065714_10103921 Ga0065714_101039212 202
33 3300005327 Ga0070658_10024683 Ga0070658_100246831 202
34 3300005329 Ga0070683_100054744 Ga0070683_1000547444 202
35 3300005329 Ga0070683_101283494 Ga0070683_1012834941 202
36 3300005330 Ga0070690_100005700 Ga0070690_1000057002 202
37 3300005331 Ga0070670_100607057 Ga0070670_1006070572 202
38 3300005333 Ga0070677_10067252 Ga0070677_100672522 202
39 3300005335 Ga0070666_10010460 Ga0070666_100104602 202
40 3300005335 Ga0070666_10085482 Ga0070666_100854822 202
41 3300005337 Ga0070682_100366483 Ga0070682_1003664832 202
42 3300005337 Ga0070682_100715252 Ga0070682_1007152521 202
43 3300005338 Ga0068868_100044505 Ga0068868_1000445052 202
44 3300005339 Ga0070660_100504617 Ga0070660_1005046172 202
45 3300005340 Ga0070689_100027094 Ga0070689_1000270944 202
46 3300005340 Ga0070689_100134541 Ga0070689_1001345411 202
47 3300005343 Ga0070687_100071796 Ga0070687_1000717963 202
48 3300005344 Ga0070661_100099997 Ga0070661_1000999972 202
49 3300005347 Ga0070668_100061617 Ga0070668_1000616173 202
50 3300005347 Ga0070668_100820052 Ga0070668_1008200521 202
51 3300005353 Ga0070669_100026299 Ga0070669_1000262992 202
52 3300005353 Ga0070669_100266442 Ga0070669_1002664422 202
53 3300005354 Ga0070675_100012318 Ga0070675_1000123182 202
54 3300005355 Ga0070671_100094971 Ga0070671_1000949712 202
55 3300005355 Ga0070671_100256013 Ga0070671_1002560131 202
56 3300005355 Ga0070671_100494839 Ga0070671_1004948392 202
57 3300005356 Ga0070674_100105131 Ga0070674_1001051312 202
58 3300005356 Ga0070674_100149986 Ga0070674_1001499862 202
59 3300005356 Ga0070674_100226944 Ga0070674_1002269441 202
60 3300005364 Ga0070673_100007204 Ga0070673_1000072042 202
61 3300005364 Ga0070673_100069810 Ga0070673_1000698104 202
62 3300005364 Ga0070673_100125587 Ga0070673_1001255872 202
63 3300005364 Ga0070673_100184690 Ga0070673_1001846902 202
64 3300005365 Ga0070688_100015547 Ga0070688_1000155472 202
65 3300005367 Ga0070667_100012330 Ga0070667_1000123307 202
66 3300005367 Ga0070667_100176237 Ga0070667_1001762372 202
67 3300005367 Ga0070667_100484614 Ga0070667_1004846142 202
68 3300005367 Ga0070667_100654661 Ga0070667_1006546611 202
69 3300005435 Ga0070714_100005767 Ga0070714_1000057679 202
70 3300005436 Ga0070713_100015249 Ga0070713_1000152492 202
71 3300005436 Ga0070713_100286072 Ga0070713_1002860722 202
72 3300005439 Ga0070711_100060830 Ga0070711_1000608302 202
73 3300005441 Ga0070700_100382653 Ga0070700_1003826531 202
74 3300005455 Ga0070663_100132315 Ga0070663_1001323152 202
75 3300005455 Ga0070663_100172767 Ga0070663_1001727672 202
76 3300005456 Ga0070678_100059633 Ga0070678_1000596332 202
77 3300005456 Ga0070678_100112197 Ga0070678_1001121972 202
78 3300005456 Ga0070678_100373039 Ga0070678_1003730392 202
79 3300005456 Ga0070678_100463233 Ga0070678_1004632331 202
80 3300005457 Ga0070662_100112117 Ga0070662_1001121172 202
81 3300005457 Ga0070662_100645707 Ga0070662_1006457071 202
82 3300005458 Ga0070681_10038217 Ga0070681_100382174 202
83 3300005458 Ga0070681_10258443 Ga0070681_102584432 202
84 3300005458 Ga0070681_10907202 Ga0070681_109072021 202
85 3300005459 Ga0068867_100124832 Ga0068867_1001248322 202
86 3300005459 Ga0068867_100830297 Ga0068867_1008302971 202
87 3300005466 Ga0070685_10314186 Ga0070685_103141862 202
88 3300005467 Ga0070706_100207786 Ga0070706_1002077862 202
89 3300005468 Ga0070707_100067458 Ga0070707_1000674581 202
90 3300005468 Ga0070707_100231147 Ga0070707_1002311471 202
91 3300005518 Ga0070699_100420962 Ga0070699_1004209621 202
92 3300005530 Ga0070679_100036685 Ga0070679_1000366853 202
93 3300005535 Ga0070684_100057619 Ga0070684_1000576192 202
94 3300005539 Ga0068853_100101829 Ga0068853_1001018293 202
95 3300005539 Ga0068853_100178016 Ga0068853_1001780163 202
96 3300005543 Ga0070672_100047045 Ga0070672_1000470452 202
97 3300005543 Ga0070672_100059871 Ga0070672_1000598712 202
98 3300005543 Ga0070672_100337573 Ga0070672_1003375732 202
99 3300005543 Ga0070672_100613100 Ga0070672_1006131001 202
100 3300005548 Ga0070665_100781913 Ga0070665_1007819131 202
101 3300005548 Ga0070665_100988455 Ga0070665_1009884551 202
102 3300005549 Ga0070704_100282329 Ga0070704_1002823292 202
103 3300005563 Ga0068855_100003441 Ga0068855_10000344116 202
104 3300005563 Ga0068855_100005041 Ga0068855_1000050418 202
105 3300005564 Ga0070664_100010652 Ga0070664_10001065210 202
106 3300005564 Ga0070664_100397752 Ga0070664_1003977522 202
107 3300005564 Ga0070664_100438789 Ga0070664_1004387891 202
108 3300005577 Ga0068857_100088615 Ga0068857_1000886152 202
109 3300005614 Ga0068856_100445296 Ga0068856_1004452962 202
110 3300005615 Ga0070702_100645125 Ga0070702_1006451251 202
111 3300005616 Ga0068852_100073013 Ga0068852_1000730132 202
112 3300005616 Ga0068852_100112526 Ga0068852_1001125263 202
113 3300005616 Ga0068852_100782175 Ga0068852_1007821751 202
114 3300005617 Ga0068859_100005136 Ga0068859_10000513610 202
115 3300005618 Ga0068864_100009415 Ga0068864_1000094153 202
116 3300005618 Ga0068864_100234055 Ga0068864_1002340552 202
117 3300005618 Ga0068864_100286653 Ga0068864_1002866532 202
118 3300005618 Ga0068864_100354337 Ga0068864_1003543372 202
119 3300005834 Ga0068851_10080163 Ga0068851_100801631 202
120 3300005834 Ga0068851_10083261 Ga0068851_100832612 202
121 3300005841 Ga0068863_100045854 Ga0068863_1000458541 202
122 3300005841 Ga0068863_100330639 Ga0068863_1003306391 202
123 3300005842 Ga0068858_100008304 Ga0068858_1000083046 202
124 3300005844 Ga0068862_100201122 Ga0068862_1002011222 202
125 3300005844 Ga0068862_100273199 Ga0068862_1002731991 202
126 3300006028 Ga0070717_10068762 Ga0070717_100687623 202
127 3300006038 Ga0075365_10398935 Ga0075365_103989351 202
128 3300006177 Ga0075362_10125114 Ga0075362_101251141 202
129 3300006178 Ga0075367_10033449 Ga0075367_100334492 202
130 3300006186 Ga0075369_10079480 Ga0075369_100794802 202
131 3300006237 Ga0097621_100054643 Ga0097621_1000546432 202
132 3300006237 Ga0097621_100150903 Ga0097621_1001509032 202
133 3300006237 Ga0097621_100312785 Ga0097621_1003127853 202
134 3300006237 Ga0097621_100331671 Ga0097621_1003316712 202
135 3300006353 Ga0075370_10011450 Ga0075370_100114502 202
136 3300006353 Ga0075370_10060241 Ga0075370_100602412 202
137 3300006353 Ga0075370_10062376 Ga0075370_100623762 202
138 3300006353 Ga0075370_10086706 Ga0075370_100867062 202
139 3300006846 Ga0075430_100738553 Ga0075430_1007385531 202
140 3300006880 Ga0075429_100012958 Ga0075429_1000129585 202
141 3300006931 Ga0097620_100005136 Ga0097620_1000051364 202
142 3300009036 Ga0105244_10024726 Ga0105244_100247262 202
143 3300009093 Ga0105240_10002337 Ga0105240_100023373 202
144 3300009093 Ga0105240_10020056 Ga0105240_100200562 202
145 3300009094 Ga0111539_10848431 Ga0111539_108484312 202
146 3300009098 Ga0105245_10301228 Ga0105245_103012282 202
147 3300009147 Ga0114129_10604104 Ga0114129_106041042 202
148 3300009148 Ga0105243_10024314 Ga0105243_100243143 202
149 3300009148 Ga0105243_10189350 Ga0105243_101893501 202
150 3300009148 Ga0105243_10271575 Ga0105243_102715752 202
151 3300009148 Ga0105243_10326992 Ga0105243_103269922 202
152 3300009174 Ga0105241_10031759 Ga0105241_100317592 202
153 3300009176 Ga0105242_10001654 Ga0105242_100016544 202
154 3300009176 Ga0105242_10193224 Ga0105242_101932242 202
155 3300009176 Ga0105242_10406649 Ga0105242_104066492 202
156 3300009177 Ga0105248_10038088 Ga0105248_100380885 202
157 3300009545 Ga0105237_10000407 Ga0105237_1000040744 202
158 3300009545 Ga0105237_10336513 Ga0105237_103365132 202
159 3300009551 Ga0105238_10013664 Ga0105238_100136647 202
160 3300009551 Ga0105238_10032068 Ga0105238_100320682 202
161 3300009551 Ga0105238_10124680 Ga0105238_101246802 202
162 3300009551 Ga0105238_10253569 Ga0105238_102535693 202
163 3300009551 Ga0105238_10483859 Ga0105238_104838591 202
164 3300009553 Ga0105249_10269535 Ga0105249_102695352 202
165 3300010375 Ga0105239_10000335 Ga0105239_1000033553 202
166 3300011119 Ga0105246_10024778 Ga0105246_100247783 202
167 3300011119 Ga0105246_10178035 Ga0105246_101780352 202
168 3300011119 Ga0105246_10582822 Ga0105246_105828222 202
169 3300012502 Ga0157347_1001530 Ga0157347_10015302 202
170 3300012510 Ga0157316_1009859 Ga0157316_10098591 202
171 3300013102 Ga0157371_10115087 Ga0157371_101150872 202
172 3300013104 Ga0157370_10001435 Ga0157370_1000143516 202
173 3300013104 Ga0157370_10152790 Ga0157370_101527902 202
174 3300013297 Ga0157378_10215544 Ga0157378_102155442 202
175 3300013297 Ga0157378_10323325 Ga0157378_103233252 202
176 3300013297 Ga0157378_11425416 Ga0157378_114254162 202
177 3300013306 Ga0163162_10035213 Ga0163162_100352135 202
178 3300013306 Ga0163162_10112217 Ga0163162_101122171 202
179 3300013306 Ga0163162_10253862 Ga0163162_102538621 202
180 3300013307 Ga0157372_10145921 Ga0157372_101459212 202
181 3300013307 Ga0157372_10156403 Ga0157372_101564032 202
182 3300013307 Ga0157372_10216447 Ga0157372_102164472 202
183 3300013308 Ga0157375_10001395 Ga0157375_100013952 202
184 3300013308 Ga0157375_10210762 Ga0157375_102107622 202
185 3300014325 Ga0163163_10007322 Ga0163163_100073222 202
186 3300014325 Ga0163163_10146101 Ga0163163_101461013 202
187 3300014325 Ga0163163_10582623 Ga0163163_105826231 202
188 3300014326 Ga0157380_10100761 Ga0157380_101007611 202
189 3300014326 Ga0157380_10149293 Ga0157380_101492931 202
190 3300014326 Ga0157380_10625048 Ga0157380_106250482 202
191 3300014326 Ga0157380_11023268 Ga0157380_110232681 202
192 3300014497 Ga0182008_10009207 Ga0182008_100092073 202
193 3300014497 Ga0182008_10036405 Ga0182008_100364052 202
194 3300014745 Ga0157377_10108816 Ga0157377_101088162 202
195 3300014969 Ga0157376_10294903 Ga0157376_102949031 202
196 3300015261 Ga0182006_1013696 Ga0182006_10136963 202
197 3300015262 Ga0182007_10001904 Ga0182007_100019049 202
198 3300017792 Ga0163161_10000201 Ga0163161_100002012 202
199 3300017792 Ga0163161_10180073 Ga0163161_101800732 202
200 3300017792 Ga0163161_10239386 Ga0163161_102393862 202
201 3300017792 Ga0163161_10248548 Ga0163161_102485482 202
202 3300025228 Ga0209672_101176 Ga0209672_1011767 202
203 3300025229 Ga0209147_100472 Ga0209147_10047219 202
204 3300025242 Ga0209258_100091 Ga0209258_100091181 202
205 3300025245 Ga0207425_1000190 Ga0207425_100019019 202
206 3300025254 Ga0209148_1000033 Ga0209148_1000033303 202
207 3300025258 Ga0209129_1000091 Ga0209129_100009124 202
208 3300025258 Ga0209129_1001758 Ga0209129_100175817 202
209 3300025258 Ga0209129_1007810 Ga0209129_10078102 202
210 3300025263 Ga0209565_1000335 Ga0209565_100033514 202
211 3300025263 Ga0209565_1001489 Ga0209565_10014893 202
212 3300025273 Ga0209673_1000154 Ga0209673_100015427 202
213 3300025273 Ga0209673_1003688 Ga0209673_10036882 202
214 3300025273 Ga0209673_1038127 Ga0209673_10381272 202
215 3300025273 Ga0209673_1041298 Ga0209673_10412982 202
216 3300025284 Ga0209130_1000140 Ga0209130_100014094 202
217 3300025284 Ga0209130_1000782 Ga0209130_10007828 202
218 3300025284 Ga0209130_1001760 Ga0209130_10017603 202
219 3300025291 Ga0209675_1001002 Ga0209675_100100212 202
220 3300025291 Ga0209675_1001248 Ga0209675_100124814 202
221 3300025291 Ga0209675_1005234 Ga0209675_10052343 202
222 3300025292 Ga0209676_1000048 Ga0209676_100004820 202
223 3300025292 Ga0209676_1001621 Ga0209676_100162121 202
224 3300025292 Ga0209676_1017331 Ga0209676_10173312 202
225 3300025294 Ga0209025_1000207 Ga0209025_1000207110 202
226 3300025294 Ga0209025_1000286 Ga0209025_100028669 202
227 3300025294 Ga0209025_1000356 Ga0209025_100035669 202
228 3300025294 Ga0209025_1007807 Ga0209025_10078073 202
229 3300025294 Ga0209025_1016840 Ga0209025_10168404 202
230 3300025295 Ga0209564_1000103 Ga0209564_100010333 202
231 3300025295 Ga0209564_1000597 Ga0209564_100059714 202
232 3300025297 Ga0209758_1000092 Ga0209758_1000092124 202
233 3300025297 Ga0209758_1000262 Ga0209758_100026232 202
234 3300025297 Ga0209758_1032569 Ga0209758_10325692 202
235 3300025297 Ga0209758_1044133 Ga0209758_10441332 202
236 3300025298 Ga0209050_1000012 Ga0209050_100001220 202
237 3300025298 Ga0209050_1000511 Ga0209050_100051125 202
238 3300025299 Ga0209256_1000065 Ga0209256_10000653 202
239 3300025299 Ga0209256_1000094 Ga0209256_100009494 202
240 3300025302 Ga0207426_1000084 Ga0207426_1000084109 202
241 3300025302 Ga0207426_1000161 Ga0207426_1000161153 202
242 3300025303 Ga0209051_1000273 Ga0209051_100027354 202
243 3300025303 Ga0209051_1000326 Ga0209051_100032640 202
244 3300025303 Ga0209051_1000644 Ga0209051_100064440 202
245 3300025303 Ga0209051_1014092 Ga0209051_10140923 202
246 3300025303 Ga0209051_1020750 Ga0209051_10207502 202
247 3300025304 Ga0209257_1000012 Ga0209257_10000121022 202
248 3300025304 Ga0209257_1000045 Ga0209257_1000045428 202
249 3300025304 Ga0209257_1000249 Ga0209257_100024935 202
250 3300025304 Ga0209257_1001999 Ga0209257_10019993 202
251 3300025304 Ga0209257_1007808 Ga0209257_10078082 202
252 3300025315 Ga0207697_10030636 Ga0207697_100306362 202
253 3300025321 Ga0207656_10050387 Ga0207656_100503871 202
254 3300025321 Ga0207656_10056644 Ga0207656_100566442 202
255 3300025321 Ga0207656_10126632 Ga0207656_101266322 202
256 3300025728 Ga0207655_1003575 Ga0207655_10035758 202
257 3300025893 Ga0207682_10020913 Ga0207682_100209133 202
258 3300025893 Ga0207682_10132731 Ga0207682_101327311 202
259 3300025893 Ga0207682_10141708 Ga0207682_101417082 202
260 3300025903 Ga0207680_10006674 Ga0207680_100066742 202
261 3300025903 Ga0207680_10067605 Ga0207680_100676052 202
262 3300025906 Ga0207699_10025169 Ga0207699_100251694 202
263 3300025908 Ga0207643_10076497 Ga0207643_100764971 202
264 3300025908 Ga0207643_10315539 Ga0207643_103155391 202
265 3300025909 Ga0207705_10111137 Ga0207705_101111372 202
266 3300025911 Ga0207654_10174656 Ga0207654_101746562 202
267 3300025912 Ga0207707_10246144 Ga0207707_102461442 202
268 3300025913 Ga0207695_10059818 Ga0207695_100598182 202
269 3300025913 Ga0207695_10344407 Ga0207695_103444072 202
270 3300025913 Ga0207695_10556436 Ga0207695_105564361 202
271 3300025914 Ga0207671_10001396 Ga0207671_1000139615 202
272 3300025914 Ga0207671_10298476 Ga0207671_102984762 202
273 3300025919 Ga0207657_10257226 Ga0207657_102572262 202
274 3300025919 Ga0207657_10333612 Ga0207657_103336121 202
275 3300025919 Ga0207657_10773737 Ga0207657_107737371 202
276 3300025920 Ga0207649_10094148 Ga0207649_100941482 202
277 3300025921 Ga0207652_10041183 Ga0207652_100411833 202
278 3300025922 Ga0207646_10236684 Ga0207646_102366841 202
279 3300025923 Ga0207681_10077489 Ga0207681_100774892 202
280 3300025924 Ga0207694_10015293 Ga0207694_100152933 202
281 3300025924 Ga0207694_10187489 Ga0207694_101874891 202
282 3300025924 Ga0207694_10375547 Ga0207694_103755472 202
283 3300025925 Ga0207650_10424797 Ga0207650_104247971 202
284 3300025926 Ga0207659_10003908 Ga0207659_100039084 202
285 3300025926 Ga0207659_10106261 Ga0207659_101062612 202
286 3300025927 Ga0207687_10361930 Ga0207687_103619302 202
287 3300025928 Ga0207700_10173905 Ga0207700_101739052 202
288 3300025929 Ga0207664_10032555 Ga0207664_100325551 202
289 3300025931 Ga0207644_10009027 Ga0207644_100090276 202
290 3300025933 Ga0207706_10101365 Ga0207706_101013652 202
291 3300025933 Ga0207706_10490393 Ga0207706_104903931 202
292 3300025934 Ga0207686_10006099 Ga0207686_100060994 202
293 3300025934 Ga0207686_10139875 Ga0207686_101398752 202
294 3300025935 Ga0207709_10001312 Ga0207709_1000131214 202
295 3300025935 Ga0207709_10521937 Ga0207709_105219371 202
296 3300025936 Ga0207670_10021741 Ga0207670_100217412 202
297 3300025937 Ga0207669_10118963 Ga0207669_101189632 202
298 3300025938 Ga0207704_10121287 Ga0207704_101212872 202
299 3300025938 Ga0207704_10156688 Ga0207704_101566882 202
300 3300025940 Ga0207691_10047657 Ga0207691_100476574 202
301 3300025940 Ga0207691_10093501 Ga0207691_100935013 202
302 3300025940 Ga0207691_10230084 Ga0207691_102300842 202
303 3300025941 Ga0207711_10029564 Ga0207711_100295642 202
304 3300025941 Ga0207711_10126914 Ga0207711_101269142 202
305 3300025941 Ga0207711_10315101 Ga0207711_103151012 202
306 3300025941 Ga0207711_10402275 Ga0207711_104022752 202
307 3300025941 Ga0207711_10512895 Ga0207711_105128952 202
308 3300025944 Ga0207661_10118452 Ga0207661_101184521 202
309 3300025945 Ga0207679_10142882 Ga0207679_101428822 202
310 3300025949 Ga0207667_10012604 Ga0207667_100126043 202
311 3300025949 Ga0207667_10022683 Ga0207667_100226834 202
312 3300025949 Ga0207667_10084330 Ga0207667_100843303 202
313 3300025960 Ga0207651_10001572 Ga0207651_100015727 202
314 3300025960 Ga0207651_10038100 Ga0207651_100381003 202
315 3300025961 Ga0207712_10082355 Ga0207712_100823552 202
316 3300025981 Ga0207640_10410606 Ga0207640_104106061 202
317 3300025981 Ga0207640_11076773 Ga0207640_110767731 202
318 3300025986 Ga0207658_10028843 Ga0207658_100288433 202
319 3300025986 Ga0207658_10106749 Ga0207658_101067493 202
320 3300025986 Ga0207658_10168406 Ga0207658_101684062 202
321 3300026023 Ga0207677_10001764 Ga0207677_1000176411 202
322 3300026035 Ga0207703_10013263 Ga0207703_100132633 202
323 3300026067 Ga0207678_10168650 Ga0207678_101686503 202
324 3300026067 Ga0207678_10258203 Ga0207678_102582032 202
325 3300026067 Ga0207678_10270203 Ga0207678_102702032 202
326 3300026075 Ga0207708_10241634 Ga0207708_102416341 202
327 3300026078 Ga0207702_10374981 Ga0207702_103749812 202
328 3300026088 Ga0207641_10104443 Ga0207641_101044431 202
329 3300026095 Ga0207676_10000860 Ga0207676_1000086015 202
330 3300026116 Ga0207674_10043572 Ga0207674_100435722 202
331 3300026118 Ga0207675_100071167 Ga0207675_1000711673 202
332 3300026121 Ga0207683_10111828 Ga0207683_101118283 202
333 3300026121 Ga0207683_10130831 Ga0207683_101308312 202
334 3300026121 Ga0207683_10227369 Ga0207683_102273692 202
335 3300026142 Ga0207698_10017771 Ga0207698_100177712 202
336 3300026142 Ga0207698_10090604 Ga0207698_100906043 202
337 3300026142 Ga0207698_10240379 Ga0207698_102403792 202
338 3300028379 Ga0268266_10508095 Ga0268266_105080951 202
339 3300028380 Ga0268265_10320490 Ga0268265_103204902 202
340 3300028381 Ga0268264_10009846 Ga0268264_100098467 202
341 3300028381 Ga0268264_10053300 Ga0268264_100533002 202
342 3300028794 Ga0307515_10000030 Ga0307515_10000030167 202
343 3300028794 Ga0307515_10000034 Ga0307515_10000034238 202
344 3300028794 Ga0307515_10000586 Ga0307515_1000058618 202
345 3300028794 Ga0307515_10005841 Ga0307515_100058413 202
346 3300028794 Ga0307515_10076382 Ga0307515_100763824 202
347 3300028794 Ga0307515_10139879 Ga0307515_101398793 202
348 3300030522 Ga0307512_10094956 Ga0307512_100949562 202
349 3300030522 Ga0307512_10106244 Ga0307512_101062442 202
350 3300030522 Ga0307512_10309400 Ga0307512_103094001 202
351 3300031235 Ga0265330_10182455 Ga0265330_101824551 202
352 3300031456 Ga0307513_10000285 Ga0307513_1000028569 202
353 3300031456 Ga0307513_10008606 Ga0307513_1000860611 202
354 3300031456 Ga0307513_10063034 Ga0307513_100630344 202
355 3300031456 Ga0307513_10196324 Ga0307513_101963243 202
356 3300031456 Ga0307513_10414554 Ga0307513_104145542 202
357 3300031507 Ga0307509_10003393 Ga0307509_100033933 202
358 3300031507 Ga0307509_10008236 Ga0307509_1000823611 202
359 3300031507 Ga0307509_10105334 Ga0307509_101053343 202
360 3300031616 Ga0307508_10000649 Ga0307508_1000064931 202
361 3300031649 Ga0307514_10004105 Ga0307514_100041051 202
362 3300031711 Ga0265314_10122614 Ga0265314_101226142 202
363 3300031730 Ga0307516_10001570 Ga0307516_1000157015 202
364 3300031730 Ga0307516_10030714 Ga0307516_100307144 202
365 3300031901 Ga0307406_10534714 Ga0307406_105347142 202
366 3300031911 Ga0307412_10027901 Ga0307412_100279011 202
367 3300031911 Ga0307412_10188006 Ga0307412_101880062 202
368 3300031911 Ga0307412_10756877 Ga0307412_107568771 202
369 3300032005 Ga0307411_10318457 Ga0307411_103184572 202
370 3300032005 Ga0307411_10477163 Ga0307411_104771631 202
371 3300033179 Ga0307507_10062762 Ga0307507_100627622 202
372 3300033180 Ga0307510_10006302 Ga0307510_1000630215 202
373 3300033180 Ga0307510_10016329 Ga0307510_100163292 202
374 3300033180 Ga0307510_10174022 Ga0307510_101740222 202
375 3300035410 Ga0373924_0105601 Ga0373924_0105601_225_839 202
376 3300035692 Ga0373935_0207694 Ga0373935_0207694_281_895 202
377 3300035695 Ga0373927_0095438 Ga0373927_0095438_664_1278 202
378 3300035695 Ga0373927_0302962 Ga0373927_0302962_399_1007 202
379 3300036401 Ga0373937_0414157 Ga0373937_0414157_492_1106 202
380 3300037068 Ga0373925_0287906 Ga0373925_0287906_368_982 202
381 3300037312 Ga0395899_0002908 Ga0395899_0002908_6131_6739 202
382 3300037418 Ga0395900_0070739 Ga0395900_0070739_2404_3012 202
383 3300037466 Ga0395898_0005675 Ga0395898_0005675_11147_11755 202
384 3300037471 Ga0395905_0000235 Ga0395905_0000235_66181_66789 202
385 3300037471 Ga0395905_0081796 Ga0395905_0081796_1051_1659 202
386 3300037471 Ga0395905_0487319 Ga0395905_0487319_504_1112 202
387 3300038443 Ga0395901_0090756 Ga0395901_0090756_1916_2524 202
388 3300038443 Ga0395901_0484732 Ga0395901_0484732_600_1208 202
389 3300039437 Ga0436365_1383684 Ga0436365_1383684_525_1139 202
390 3300041404 Ga0439436_0002169 Ga0439436_0002169_3874_4563 202
391 3300041404 Ga0439436_0115208 Ga0439436_0115208_49_657 202
392 3300041407 Ga0439447_005090 Ga0439447_005090_2356_3045 202
393 3300041411 Ga0439466_0017929 Ga0439466_0017929_746_1435 202
394 3300041413 Ga0439465_0000906 Ga0439465_0000906_2017_2706 202
395 3300041452 Ga0451793_0890613 Ga0451793_0890613_408_1016 202
396 3300041459 Ga0451800_0270333 Ga0451800_0270333_331_939 202
397 3300041459 Ga0451800_1206011 Ga0451800_1206011_305_1006 202
398 3300041460 Ga0451802_1353732 Ga0451802_1353732_934_1542 202
399 3300041486 Ga0451807_0257418 Ga0451807_0257418_479_1087 202
400 3300041496 Ga0451839_0670304 Ga0451839_0670304_83_691 202
401 3300041507 Ga0451851_1239324 Ga0451851_1239324_483_1091 202
402 3300041509 Ga0451843_1371007 Ga0451843_1371007_503_1111 202
403 3300041511 Ga0451855_0272045 Ga0451855_0272045_162_770 202
404 3300041512 Ga0451853_0418287 Ga0451853_0418287_1476_2084 202
405 3300041997 Ga0439431_0006328 Ga0439431_0006328_1364_2053 202
406 3300041999 Ga0439433_0009672 Ga0439433_0009672_204_893 202
407 3300042004 Ga0439445_0004467 Ga0439445_0004467_1310_1999 202
408 3300042006 Ga0439432_005173 Ga0439432_005173_580_1269 202
409 3300042007 Ga0439449_0009320 Ga0439449_0009320_2387_3076 202
410 3300042010 Ga0439452_015169 Ga0439452_015169_121_810 202
411 3300042015 Ga0439462_0008844 Ga0439462_0008844_1311_2000 202
412 3300042876 Ga0451577_0049885 Ga0451577_0049885_465_1094 202
413 3300044656 Ga0466969_0011806 Ga0466969_0011806_1373_1981 202
414 3300044658 Ga0466972_0027448 Ga0466972_0027448_519_1127 202
415 3300044683 Ga0466965_0008961 Ga0466965_0008961_3565_4173 202
416 3300044684 Ga0466966_0018209 Ga0466966_0018209_495_1103 202
417 3300044693 Ga0466961_0122698 Ga0466961_0122698_939_1547 202
418 3300044706 Ga0466964_0134817 Ga0466964_0134817_399_1007 202
419 3300044712 Ga0453684_0200783 Ga0453684_0200783_839_1447 202
420 3300044765 Ga0466970_0096814 Ga0466970_0096814_21_629 202
421 3300044842 Ga0466957_0293428 Ga0466957_0293428_88_696 202
422 3300044901 Ga0466960_0003291 Ga0466960_0003291_825_1433 202
423 3300045049 Ga0466959_0038422 Ga0466959_0038422_1495_2103 202
424 3300045051 Ga0451576_0002187 Ga0451576_0002187_29135_29743 202
425 3300046460 Ga0495638_0050605 Ga0495638_0050605_154_801 202
426 3300046500 Ga0495596_0214867 Ga0495596_0214867_67_675 202
427 3300046512 Ga0495610_0024551 Ga0495610_0024551_1255_1902 202
428 3300046512 Ga0495610_0141450 Ga0495610_0141450_82_690 202
429 3300046513 Ga0495616_0014367 Ga0495616_0014367_162_809 202
430 3300046515 Ga0495620_0076295 Ga0495620_0076295_506_1219 202
431 3300046518 Ga0495631_0000901 Ga0495631_0000901_115_762 202
432 3300046520 Ga0495637_0008435 Ga0495637_0008435_2982_3695 202
433 3300046522 Ga0495643_0018867 Ga0495643_0018867_3360_3968 202
434 3300046524 Ga0495648_0061025 Ga0495648_0061025_1378_1986 202
435 3300046524 Ga0495648_0107782 Ga0495648_0107782_305_1057 202
436 3300046525 Ga0495663_0049349 Ga0495663_0049349_460_1068 202
437 3300046528 Ga0495642_0060565 Ga0495642_0060565_254_862 202
438 3300046530 Ga0495654_0008561 Ga0495654_0008561_3676_4323 202
439 3300046530 Ga0495654_0171223 Ga0495654_0171223_86_694 202
440 3300046530 Ga0495654_0188355 Ga0495654_0188355_10_624 202
441 3300046537 Ga0495598_0011021 Ga0495598_0011021_477_1085 202
442 3300046537 Ga0495598_0020011 Ga0495598_0020011_536_1144 202
443 3300046539 Ga0495621_0001043 Ga0495621_0001043_1244_1891 202
444 3300046539 Ga0495621_0038648 Ga0495621_0038648_684_1292 202
445 3300046539 Ga0495621_0056020 Ga0495621_0056020_25_633 202
446 3300046557 Ga0495622_0131016 Ga0495622_0131016_225_872 202
447 3300046558 Ga0495633_0087490 Ga0495633_0087490_398_1063 202
448 3300046615 Ga0495656_0000270 Ga0495656_0000270_14026_14691 202
449 3300046660 Ga0495625_0001836 Ga0495625_0001836_15512_16120 202
450 3300046660 Ga0495625_0065474 Ga0495625_0065474_1656_2303 202
451 3300046674 Ga0495588_0119051 Ga0495588_0119051_731_1339 202
452 3300046674 Ga0495588_0123935 Ga0495588_0123935_160_807 202
453 3300046683 Ga0495658_0012766 Ga0495658_0012766_549_1163 202
454 3300046689 Ga0495613_0515961 Ga0495613_0515961_72_686 202
455 3300046691 Ga0495670_0125644 Ga0495670_0125644_574_1221 202
456 3300046692 Ga0495671_0001980 Ga0495671_0001980_55_768 202
457 3300047321 Ga0495676_0125626 Ga0495676_0125626_587_1234 202
458 3300047443 Ga0495687_016741 Ga0495687_016741_2928_3536 202
459 3300047471 Ga0495684_0110503 Ga0495684_0110503_1194_1808 202
460 3300047472 Ga0495686_0001547 Ga0495686_0001547_16691_17302 202
461 3300048090 Ga0495615_0001036 Ga0495615_0001036_390_1055 202
462 3300048903 Ga0496100_0079972 Ga0496100_0079972_1571_2179 202
463 3300048905 Ga0496102_0028401 Ga0496102_0028401_921_1529 202
464 3300048905 Ga0496102_0070707 Ga0496102_0070707_2336_3040 202
465 3300048905 Ga0496102_0415157 Ga0496102_0415157_548_1156 202
466 3300048906 Ga0496103_0026318 Ga0496103_0026318_208_915 202
467 3300048908 Ga0496105_0366479 Ga0496105_0366479_63_671 202
468 3300048909 Ga0496106_0117354 Ga0496106_0117354_1446_2054 202
469 3300048909 Ga0496106_0288833 Ga0496106_0288833_442_1050 202
470 3300048909 Ga0496106_0309759 Ga0496106_0309759_592_1206 202
471 3300048910 Ga0496107_0017711 Ga0496107_0017711_1057_1764 202
472 3300048911 Ga0496108_0015466 Ga0496108_0015466_1460_2068 202
473 3300048913 Ga0496110_1024184 Ga0496110_1024184_26_634 202
474 3300048916 Ga0496113_0229364 Ga0496113_0229364_261_875 202
475 3300048916 Ga0496113_0328510 Ga0496113_0328510_425_1033 202
476 3300048917 Ga0496114_0106743 Ga0496114_0106743_1250_1858 202
477 3300048917 Ga0496114_0627112 Ga0496114_0627112_12_677 202
478 3300048919 Ga0496116_0011687 Ga0496116_0011687_4282_4890 202
479 3300048920 Ga0496117_0075576 Ga0496117_0075576_854_1462 202
480 3300048921 Ga0496118_0035486 Ga0496118_0035486_1315_1923 202
481 3300048921 Ga0496118_0234296 Ga0496118_0234296_438_1046 202
482 3300048922 Ga0496119_0048469 Ga0496119_0048469_151_798 202
483 3300048922 Ga0496119_0197157 Ga0496119_0197157_422_1030 202
484 3300048925 Ga0496122_0359744 Ga0496122_0359744_131_739 202
485 3300048927 Ga0496124_0121416 Ga0496124_0121416_570_1178 202
486 3300048928 Ga0496125_0060933 Ga0496125_0060933_1070_1678 202
487 3300048928 Ga0496125_0144386 Ga0496125_0144386_412_1020 202
488 3300048929 Ga0496126_0381431 Ga0496126_0381431_86_733 202
489 3300049569 Ga0501032_0235166 Ga0501032_0235166_400_1008 202
490 3300049570 Ga0501033_0036647 Ga0501033_0036647_2590_3198 202
491 3300049571 Ga0501034_0171821 Ga0501034_0171821_501_1109 202
492 3300049572 Ga0501036_0084645 Ga0501036_0084645_1232_1840 202
493 3300049573 Ga0501037_0288251 Ga0501037_0288251_373_981 202
494 3300049581 Ga0501047_0002291 Ga0501047_0002291_4904_5512 202
495 3300049581 Ga0501047_0052645 Ga0501047_0052645_1716_2324 202
496 3300049585 Ga0501069_0000781 Ga0501069_0000781_4977_5585 202
497 3300049586 Ga0501070_0000645 Ga0501070_0000645_860_1468 202
498 3300049589 Ga0501073_0000370 Ga0501073_0000370_22887_23495 202
499 3300049589 Ga0501073_0064188 Ga0501073_0064188_723_1331 202
500 3300049590 Ga0501074_0000213 Ga0501074_0000213_3490_4098 202
501 3300049592 Ga0501076_0520650 Ga0501076_0520650_20_628 202
502 3300049653 Ga0501206_032265 Ga0501206_032265_89_769 202
503 3300049661 Ga0501217_048164 Ga0501217_048164_243_851 202
504 3300049672 Ga0501239_012621 Ga0501239_012621_52_732 202
505 3300049683 Ga0501253_005411 Ga0501253_005411_900_1580 202
506 3300049705 Ga0501225_0066790 Ga0501225_0066790_363_971 202
507 3300049741 Ga0501079_0002160 Ga0501079_0002160_3645_4253 202
508 3300049742 Ga0501080_0001759 Ga0501080_0001759_5637_6245 202
509 3300049742 Ga0501080_0021746 Ga0501080_0021746_2053_2661 202
510 3300049759 Ga0501262_000465 Ga0501262_000465_3826_4506 202
511 3300049762 Ga0501265_000251 Ga0501265_000251_1607_2287 202
512 3300049822 Ga0501035_0542388 Ga0501035_0542388_326_934 202
513 3300049823 Ga0501044_0044663 Ga0501044_0044663_16_624 202
514 3300049823 Ga0501044_0172309 Ga0501044_0172309_1249_1857 202
515 3300049823 Ga0501044_0399064 Ga0501044_0399064_387_995 202
516 3300050490 nmdc:mga03n38_41568_c1 nmdc:mga03n38_41568_c1_446_1054 202
517 3300050493 nmdc:mga0k408_168015_c1 nmdc:mga0k408_168015_c1_106_714 202
518 3300050493 nmdc:mga0k408_172140_c1 nmdc:mga0k408_172140_c1_49_657 202
519 3300050493 nmdc:mga0k408_9944_c1 nmdc:mga0k408_9944_c1_3286_3894 202
520 3300050494 nmdc:mga06z11_50928_c1 nmdc:mga06z11_50928_c1_164_772 202
521 3300050496 nmdc:mga07m45_103524_c1 nmdc:mga07m45_103524_c1_707_1315 202
522 3300050496 nmdc:mga07m45_19542_c1 nmdc:mga07m45_19542_c1_1859_2467 202
523 3300050496 nmdc:mga07m45_199272_c1 nmdc:mga07m45_199272_c1_144_752 202
524 3300050496 nmdc:mga07m45_205776_c1 nmdc:mga07m45_205776_c1_55_663 202
525 3300050507 nmdc:mga05p37_485668_c1 nmdc:mga05p37_485668_c1_437_1045 202
526 3300050508 nmdc:mga09592_187549_c1 nmdc:mga09592_187549_c1_1081_1689 202
527 3300050509 nmdc:mga0qj67_613237_c1 nmdc:mga0qj67_613237_c1_130_738 202
528 3300050512 nmdc:mga0n895_159993_c1 nmdc:mga0n895_159993_c1_1227_1835 202
529 3300050514 nmdc:mga08x19_2660_c1 nmdc:mga08x19_2660_c1_2072_2686 202
530 3300053079 Ga0500610_0005030 Ga0500610_0005030_2602_3315 202
531 3300053079 Ga0500610_0105157 Ga0500610_0105157_39_647 202
532 3300053085 Ga0495619_0065047 Ga0495619_0065047_1804_2418 202
533 3300053087 Ga0500643_005905 Ga0500643_005905_4424_5071 202
534 3300053087 Ga0500643_060048 Ga0500643_060048_106_714 202
535 3300053088 Ga0500644_0023398 Ga0500644_0023398_270_878 202
536 3300053088 Ga0500644_0055632 Ga0500644_0055632_251_859 202
537 3300053091 Ga0500647_0090296 Ga0500647_0090296_234_842 202
538 3300053093 Ga0500651_0000082 Ga0500651_0000082_25550_26197 202
539 3300053093 Ga0500651_0075438 Ga0500651_0075438_1314_1922 202
540 3300053093 Ga0500651_0140949 Ga0500651_0140949_389_997 202
541 3300053093 Ga0500651_0200741 Ga0500651_0200741_41_691 202
542 3300053108 Ga0500562_021120 Ga0500562_021120_958_1605 202
543 3300053108 Ga0500562_128221 Ga0500562_128221_60_668 202
544 3300053110 Ga0500571_000152 Ga0500571_000152_17467_18114 202
545 3300053116 Ga0500592_010925 Ga0500592_010925_195_842 202
546 3300053117 Ga0500593_000664 Ga0500593_000664_54_767 202
547 3300053118 Ga0500594_0004880 Ga0500594_0004880_1920_2528 202
548 3300053120 Ga0500597_093856 Ga0500597_093856_136_783 202
549 3300053121 Ga0500607_000049 Ga0500607_000049_62459_63172 202
550 3300053125 Ga0500618_035638 Ga0500618_035638_485_1132 202
551 3300053128 Ga0500626_031951 Ga0500626_031951_1424_2071 202
552 3300053133 Ga0500655_000668 Ga0500655_000668_5990_6637 202
553 3300053133 Ga0500655_020210 Ga0500655_020210_111_719 202
554 3300053134 Ga0500658_0018781 Ga0500658_0018781_739_1347 202
555 3300053136 Ga0500559_0000021 Ga0500559_0000021_98770_99378 202
556 3300053136 Ga0500559_0006291 Ga0500559_0006291_1475_2122 202
557 3300053137 Ga0500561_0012355 Ga0500561_0012355_363_1010 202
558 3300053138 Ga0500564_002728 Ga0500564_002728_57_704 202
559 3300053139 Ga0500568_0003226 Ga0500568_0003226_2090_2737 202
560 3300053151 Ga0500604_0017693 Ga0500604_0017693_36_683 202
561 3300053153 Ga0500616_0011758 Ga0500616_0011758_3477_4124 202
562 3300053156 Ga0500622_0001453 Ga0500622_0001453_4462_5070 202
563 3300053161 Ga0500634_0041585 Ga0500634_0041585_1656_2369 202
564 3300053161 Ga0500634_0067724 Ga0500634_0067724_592_1239 202
565 3300053162 Ga0500638_039409 Ga0500638_039409_116_763 202
566 3300053177 Ga0500636_0019501 Ga0500636_0019501_1066_1713 202
567 3300053177 Ga0500636_0156302 Ga0500636_0156302_253_861 202
568 3300053724 Ga0500570_133490 Ga0500570_133490_132_740 202
569 3300053730 Ga0500645_001446 Ga0500645_001446_1724_2332 202
570 3300053734 Ga0500565_016503 Ga0500565_016503_114_761 202
571 3300053739 Ga0500587_001719 Ga0500587_001719_1290_1898 202
572 3300060353 Ga0501082_0016781 Ga0501082_0016781_1729_2337 202
573 3300061719 Ga0466962_0332047 Ga0466962_0332047_125_733 202
574 iso_pu_bacteria 2599185214 2599626466 202
575 iso_pu_bacteria 2599185226 2599677081 202
576 iso_pu_bacteria 2599185227 2599682167 202
577 iso_pu_bacteria 2599185229 2599695818 202
578 iso_pu_bacteria 2885192300 2885194408 202
579 iso_pu_bacteria 2928070936 2928075437 202
580 iso_pu_bacteria 2945909444 2945909702 202
581 iso_pu_bacteria 2945984333 2945988329 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

88

177

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.8694 16 199
5j48-assembly1.cif.gz_A pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8663 11 127
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8633 11 126
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8603 39 199
4cyd-assembly2.cif.gz_C glxr bound to camp 0.8563 13 200
ID Description Score Start End Superfamily
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8911 31 157 2.60.120.10
2gauA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8893 16 154 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8846 38 154 2.60.120.10
af_P9WIY7_12_147_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8832 13 146 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8803 39 154 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A109CEU4-F1-model_v4 deleted 0.9993 1 202
AF-A0A127PBF5-F1-model_v4 Cyclic nucleotide-binding domain protein 0.9984 39 190
AF-A0A127QZ33-F1-model_v4 Cyclic nucleotide-binding domain protein 0.9966 1 202
AF-A0A1F4GZX6-F1-model_v4 Cyclic nucleotide-binding protein 0.9954 18 199
AF-A0A109CEU4-F1-model_v4 deleted 0.9944 1 202

Feature Viewer

pLDDT pTM Quality
94.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map