F466099
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 365 | 572 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0107782|Ga0495648_0107782_305_1057 |
| Length | 250 |
| Sequence | MRWQPLWPPVSRDVLSACRDYHSSALVWPLTPVNFRKTRTQGKPETPTVIPVASHPERNVIRVQLKQNEALKDLADADRAELESHLVVVEGNKGDFLLHQGVREMEQYFILDGILKRVVSNQEGKEMILRFADQNDMETSYAALRLGTPTPYGIVCVTKARVASLPLKEWITFLNRHAETKELFEYLVMKGMSEIMAHTITLHLLDAPGRVHRFVRKHPELAERIPKKELAAYLNLAAETLSRLKQQGKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 2 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 3 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 4 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 5 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 6 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 7 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 8 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 9 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 107 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 224 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 231 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 232 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 233 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 314 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 315 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 336 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 346 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 357 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 363 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 0 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.2 |
| Nodule | 0 |
| Rhizoplane | 4.3 |
| Rhizosphere | 65.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010267 | 3300001979 | Bacteria | 3617 |
| 2 | JGI24739J22299_10012366 | 3300001989 | Bacteria | 3136 |
| 3 | JGI25152J39213_1004480 | 3300002773 | Bacteria | 4390 |
| 4 | JGI25150J39212_1003617 | 3300002774 | Bacteria | 3592 |
| 5 | JGI25159J45721_1019792 | 3300002987 | Bacteria | 1315 |
| 6 | JGI25151J46595_10011657 | 3300003187 | Bacteria | 4034 |
| 7 | JGI25153J46596_10001867 | 3300003215 | Bacteria | 12477 |
| 8 | rootH1_10021104 | 3300003316 | Bacteria | 1108 |
| 9 | rootH2_10013705 | 3300003320 | Bacteria | 1831 |
| 10 | rootH2_10067880 | 3300003320 | Bacteria | 1141 |
| 11 | JGI25161J50226_1007551 | 3300003374 | Bacteria | 1804 |
| 12 | Ga0055535_1000378 | 3300003761 | Bacteria | 42270 |
| 13 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 14 | Ga0055526_1029483 | 3300003771 | Bacteria | 1627 |
| 15 | Ga0055537_1007928 | 3300003773 | Bacteria | 2499 |
| 16 | Ga0055524_1025578 | 3300003775 | Bacteria | 1845 |
| 17 | Ga0055536_1005507 | 3300003781 | Bacteria | 6165 |
| 18 | Ga0055536_1008391 | 3300003781 | Bacteria | 4447 |
| 19 | Ga0055528_1026183 | 3300003790 | Bacteria | 1687 |
| 20 | Ga0055530_10003783 | 3300003791 | Bacteria | 8342 |
| 21 | Ga0055530_10006987 | 3300003791 | Bacteria | 4871 |
| 22 | Ga0055540_1004457 | 3300003792 | Bacteria | 6289 |
| 23 | Ga0055540_1022163 | 3300003792 | Bacteria | 1631 |
| 24 | Ga0055531_10001303 | 3300003794 | Bacteria | 18799 |
| 25 | Ga0055531_10006289 | 3300003794 | Bacteria | 6768 |
| 26 | Ga0065714_10103921 | 3300005288 | Bacteria | 1594 |
| 27 | Ga0070658_10024683 | 3300005327 | Bacteria | 4820 |
| 28 | Ga0070683_100054744 | 3300005329 | Bacteria | 3700 |
| 29 | Ga0070683_101283494 | 3300005329 | Bacteria | 704 |
| 30 | Ga0070690_100005700 | 3300005330 | Bacteria | 7015 |
| 31 | Ga0070670_100607057 | 3300005331 | Bacteria | 979 |
| 32 | Ga0070677_10067252 | 3300005333 | Bacteria | 1496 |
| 33 | Ga0070666_10010460 | 3300005335 | Bacteria | 5806 |
| 34 | Ga0070666_10085482 | 3300005335 | Bacteria | 2160 |
| 35 | Ga0070682_100366483 | 3300005337 | Bacteria | 1079 |
| 36 | Ga0070682_100715252 | 3300005337 | Bacteria | 804 |
| 37 | Ga0068868_100044505 | 3300005338 | Bacteria | 3470 |
| 38 | Ga0070660_100504617 | 3300005339 | Bacteria | 1006 |
| 39 | Ga0070689_100027094 | 3300005340 | Bacteria | 4319 |
| 40 | Ga0070689_100134541 | 3300005340 | Bacteria | 1984 |
| 41 | Ga0070687_100071796 | 3300005343 | Bacteria | 1861 |
| 42 | Ga0070661_100099997 | 3300005344 | Bacteria | 2156 |
| 43 | Ga0070668_100061617 | 3300005347 | Bacteria | 2906 |
| 44 | Ga0070668_100820052 | 3300005347 | Bacteria | 827 |
| 45 | Ga0070669_100026299 | 3300005353 | Bacteria | 4186 |
| 46 | Ga0070669_100266442 | 3300005353 | Bacteria | 1368 |
| 47 | Ga0070675_100012318 | 3300005354 | Bacteria | 6702 |
| 48 | Ga0070671_100094971 | 3300005355 | Bacteria | 2499 |
| 49 | Ga0070671_100256013 | 3300005355 | Bacteria | 1487 |
| 50 | Ga0070671_100494839 | 3300005355 | Bacteria | 1051 |
| 51 | Ga0070674_100105131 | 3300005356 | Bacteria | 2064 |
| 52 | Ga0070674_100149986 | 3300005356 | Bacteria | 1758 |
| 53 | Ga0070674_100226944 | 3300005356 | Bacteria | 1456 |
| 54 | Ga0070673_100007204 | 3300005364 | Bacteria | 7313 |
| 55 | Ga0070673_100069810 | 3300005364 | Bacteria | 2817 |
| 56 | Ga0070673_100125587 | 3300005364 | Bacteria | 2146 |
| 57 | Ga0070673_100184690 | 3300005364 | Bacteria | 1787 |
| 58 | Ga0070688_100015547 | 3300005365 | Bacteria | 4334 |
| 59 | Ga0070667_100012330 | 3300005367 | Bacteria | 7072 |
| 60 | Ga0070667_100176237 | 3300005367 | Bacteria | 1890 |
| 61 | Ga0070667_100484614 | 3300005367 | Bacteria | 1132 |
| 62 | Ga0070667_100654661 | 3300005367 | Bacteria | 970 |
| 63 | Ga0070714_100005767 | 3300005435 | Bacteria | 9495 |
| 64 | Ga0070713_100015249 | 3300005436 | Bacteria | 5734 |
| 65 | Ga0070713_100286072 | 3300005436 | Bacteria | 1514 |
| 66 | Ga0070711_100060830 | 3300005439 | Bacteria | 2627 |
| 67 | Ga0070700_100382653 | 3300005441 | Bacteria | 1053 |
| 68 | Ga0070663_100132315 | 3300005455 | Bacteria | 1895 |
| 69 | Ga0070663_100172767 | 3300005455 | Bacteria | 1671 |
| 70 | Ga0070678_100059633 | 3300005456 | Bacteria | 2805 |
| 71 | Ga0070678_100112197 | 3300005456 | Bacteria | 2135 |
| 72 | Ga0070678_100373039 | 3300005456 | Bacteria | 1232 |
| 73 | Ga0070678_100463233 | 3300005456 | Bacteria | 1112 |
| 74 | Ga0070662_100112117 | 3300005457 | Bacteria | 2079 |
| 75 | Ga0070662_100645707 | 3300005457 | Bacteria | 892 |
| 76 | Ga0070681_10038217 | 3300005458 | Bacteria | 4813 |
| 77 | Ga0070681_10258443 | 3300005458 | Bacteria | 1654 |
| 78 | Ga0070681_10907202 | 3300005458 | Bacteria | 800 |
| 79 | Ga0068867_100124832 | 3300005459 | Bacteria | 1993 |
| 80 | Ga0068867_100830297 | 3300005459 | Bacteria | 826 |
| 81 | Ga0070685_10314186 | 3300005466 | Bacteria | 1060 |
| 82 | Ga0070706_100207786 | 3300005467 | Bacteria | 1828 |
| 83 | Ga0070707_100067458 | 3300005468 | Bacteria | 3441 |
| 84 | Ga0070707_100231147 | 3300005468 | Bacteria | 1800 |
| 85 | Ga0070699_100420962 | 3300005518 | Bacteria | 1209 |
| 86 | Ga0070679_100036685 | 3300005530 | Bacteria | 4865 |
| 87 | Ga0070684_100057619 | 3300005535 | Bacteria | 3392 |
| 88 | Ga0068853_100101829 | 3300005539 | Bacteria | 2541 |
| 89 | Ga0068853_100178016 | 3300005539 | Bacteria | 1928 |
| 90 | Ga0070672_100047045 | 3300005543 | Bacteria | 3346 |
| 91 | Ga0070672_100059871 | 3300005543 | Bacteria | 2997 |
| 92 | Ga0070672_100337573 | 3300005543 | Bacteria | 1283 |
| 93 | Ga0070672_100613100 | 3300005543 | Bacteria | 949 |
| 94 | Ga0070665_100781913 | 3300005548 | Bacteria | 967 |
| 95 | Ga0070665_100988455 | 3300005548 | Bacteria | 854 |
| 96 | Ga0070704_100282329 | 3300005549 | Bacteria | 1376 |
| 97 | Ga0068855_100003441 | 3300005563 | Bacteria | 19369 |
| 98 | Ga0068855_100005041 | 3300005563 | Bacteria | 16117 |
| 99 | Ga0070664_100010652 | 3300005564 | Bacteria | 7451 |
| 100 | Ga0070664_100397752 | 3300005564 | Bacteria | 1259 |
| 101 | Ga0070664_100438789 | 3300005564 | Bacteria | 1197 |
| 102 | Ga0068857_100088615 | 3300005577 | Bacteria | 2768 |
| 103 | Ga0068856_100445296 | 3300005614 | Bacteria | 1316 |
| 104 | Ga0070702_100645125 | 3300005615 | Bacteria | 800 |
| 105 | Ga0068852_100073013 | 3300005616 | Bacteria | 3017 |
| 106 | Ga0068852_100112526 | 3300005616 | Bacteria | 2477 |
| 107 | Ga0068852_100782175 | 3300005616 | Bacteria | 968 |
| 108 | Ga0068859_100005136 | 3300005617 | Bacteria | 13293 |
| 109 | Ga0068864_100009415 | 3300005618 | Bacteria | 8059 |
| 110 | Ga0068864_100234055 | 3300005618 | Bacteria | 1700 |
| 111 | Ga0068864_100286653 | 3300005618 | Bacteria | 1538 |
| 112 | Ga0068864_100354337 | 3300005618 | Bacteria | 1385 |
| 113 | Ga0068851_10080163 | 3300005834 | Bacteria | 1704 |
| 114 | Ga0068851_10083261 | 3300005834 | Bacteria | 1673 |
| 115 | Ga0068863_100045854 | 3300005841 | Bacteria | 4149 |
| 116 | Ga0068863_100330639 | 3300005841 | Bacteria | 1481 |
| 117 | Ga0068858_100008304 | 3300005842 | Bacteria | 9984 |
| 118 | Ga0068862_100201122 | 3300005844 | Bacteria | 1796 |
| 119 | Ga0068862_100273199 | 3300005844 | Bacteria | 1546 |
| 120 | Ga0070717_10068762 | 3300006028 | Bacteria | 2948 |
| 121 | Ga0075365_10398935 | 3300006038 | Bacteria | 971 |
| 122 | Ga0075362_10125114 | 3300006177 | Bacteria | 1219 |
| 123 | Ga0075367_10033449 | 3300006178 | Bacteria | 2963 |
| 124 | Ga0075369_10079480 | 3300006186 | Bacteria | 1453 |
| 125 | Ga0097621_100054643 | 3300006237 | Bacteria | 3258 |
| 126 | Ga0097621_100150903 | 3300006237 | Bacteria | 1993 |
| 127 | Ga0097621_100312785 | 3300006237 | Bacteria | 1390 |
| 128 | Ga0097621_100331671 | 3300006237 | Bacteria | 1349 |
| 129 | Ga0075370_10011450 | 3300006353 | Bacteria | 4660 |
| 130 | Ga0075370_10060241 | 3300006353 | Bacteria | 2162 |
| 131 | Ga0075370_10062376 | 3300006353 | Bacteria | 2124 |
| 132 | Ga0075370_10086706 | 3300006353 | Bacteria | 1803 |
| 133 | Ga0075430_100738553 | 3300006846 | Bacteria | 811 |
| 134 | Ga0075429_100012958 | 3300006880 | Bacteria | 7233 |
| 135 | Ga0097620_100005136 | 3300006931 | Bacteria | 13293 |
| 136 | Ga0105244_10024726 | 3300009036 | Bacteria | 3274 |
| 137 | Ga0105240_10002337 | 3300009093 | Bacteria | 30662 |
| 138 | Ga0105240_10020056 | 3300009093 | Bacteria | 8924 |
| 139 | Ga0111539_10848431 | 3300009094 | Bacteria | 1063 |
| 140 | Ga0105245_10301228 | 3300009098 | Bacteria | 1573 |
| 141 | Ga0114129_10604104 | 3300009147 | Bacteria | 1421 |
| 142 | Ga0105243_10024314 | 3300009148 | Bacteria | 4620 |
| 143 | Ga0105243_10189350 | 3300009148 | Bacteria | 1796 |
| 144 | Ga0105243_10271575 | 3300009148 | Bacteria | 1523 |
| 145 | Ga0105243_10326992 | 3300009148 | Bacteria | 1399 |
| 146 | Ga0105241_10031759 | 3300009174 | Bacteria | 3955 |
| 147 | Ga0105242_10001654 | 3300009176 | Bacteria | 17608 |
| 148 | Ga0105242_10193224 | 3300009176 | Bacteria | 1803 |
| 149 | Ga0105242_10406649 | 3300009176 | Bacteria | 1272 |
| 150 | Ga0105248_10038088 | 3300009177 | Bacteria | 5381 |
| 151 | Ga0105237_10000407 | 3300009545 | Bacteria | 61234 |
| 152 | Ga0105237_10336513 | 3300009545 | Bacteria | 1514 |
| 153 | Ga0105238_10013664 | 3300009551 | Bacteria | 8199 |
| 154 | Ga0105238_10032068 | 3300009551 | Bacteria | 5347 |
| 155 | Ga0105238_10124680 | 3300009551 | Bacteria | 2555 |
| 156 | Ga0105238_10253569 | 3300009551 | Bacteria | 1738 |
| 157 | Ga0105238_10483859 | 3300009551 | Bacteria | 1237 |
| 158 | Ga0105249_10269535 | 3300009553 | Bacteria | 1696 |
| 159 | Ga0105239_10000335 | 3300010375 | Bacteria | 68810 |
| 160 | Ga0105246_10024778 | 3300011119 | Bacteria | 3903 |
| 161 | Ga0105246_10178035 | 3300011119 | Bacteria | 1635 |
| 162 | Ga0105246_10582822 | 3300011119 | Bacteria | 964 |
| 163 | Ga0157347_1001530 | 3300012502 | Bacteria | 1832 |
| 164 | Ga0157316_1009859 | 3300012510 | Bacteria | 866 |
| 165 | Ga0157371_10115087 | 3300013102 | Bacteria | 1910 |
| 166 | Ga0157370_10001435 | 3300013104 | Bacteria | 29541 |
| 167 | Ga0157370_10152790 | 3300013104 | Bacteria | 2148 |
| 168 | Ga0157378_10215544 | 3300013297 | Bacteria | 1823 |
| 169 | Ga0157378_10323325 | 3300013297 | Bacteria | 1499 |
| 170 | Ga0157378_11425416 | 3300013297 | Bacteria | 736 |
| 171 | Ga0163162_10035213 | 3300013306 | Bacteria | 4984 |
| 172 | Ga0163162_10112217 | 3300013306 | Bacteria | 2825 |
| 173 | Ga0163162_10253862 | 3300013306 | Bacteria | 1890 |
| 174 | Ga0157372_10145921 | 3300013307 | Bacteria | 2729 |
| 175 | Ga0157372_10156403 | 3300013307 | Bacteria | 2633 |
| 176 | Ga0157372_10216447 | 3300013307 | Bacteria | 2220 |
| 177 | Ga0157375_10001395 | 3300013308 | Bacteria | 20856 |
| 178 | Ga0157375_10210762 | 3300013308 | Bacteria | 2100 |
| 179 | Ga0163163_10007322 | 3300014325 | Bacteria | 9733 |
| 180 | Ga0163163_10146101 | 3300014325 | Bacteria | 2408 |
| 181 | Ga0163163_10582623 | 3300014325 | Bacteria | 1182 |
| 182 | Ga0157380_10100761 | 3300014326 | Bacteria | 2405 |
| 183 | Ga0157380_10149293 | 3300014326 | Bacteria | 2018 |
| 184 | Ga0157380_10625048 | 3300014326 | Bacteria | 1070 |
| 185 | Ga0157380_11023268 | 3300014326 | Bacteria | 861 |
| 186 | Ga0182008_10009207 | 3300014497 | Bacteria | 5339 |
| 187 | Ga0182008_10036405 | 3300014497 | Bacteria | 2463 |
| 188 | Ga0157377_10108816 | 3300014745 | Bacteria | 1663 |
| 189 | Ga0157376_10294903 | 3300014969 | Bacteria | 1533 |
| 190 | Ga0182006_1013696 | 3300015261 | Bacteria | 3510 |
| 191 | Ga0182007_10001904 | 3300015262 | Bacteria | 10866 |
| 192 | Ga0163161_10000201 | 3300017792 | Bacteria | 54704 |
| 193 | Ga0163161_10180073 | 3300017792 | Bacteria | 1620 |
| 194 | Ga0163161_10239386 | 3300017792 | Bacteria | 1411 |
| 195 | Ga0163161_10248548 | 3300017792 | Bacteria | 1386 |
| 196 | Ga0209672_101176 | 3300025228 | Bacteria | 10682 |
| 197 | Ga0209147_100472 | 3300025229 | Bacteria | 24613 |
| 198 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 199 | Ga0207425_1000190 | 3300025245 | Bacteria | 49963 |
| 200 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 201 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 202 | Ga0209129_1001758 | 3300025258 | Bacteria | 11609 |
| 203 | Ga0209129_1007810 | 3300025258 | Bacteria | 3094 |
| 204 | Ga0209565_1000335 | 3300025263 | Bacteria | 41834 |
| 205 | Ga0209565_1001489 | 3300025263 | Bacteria | 10233 |
| 206 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 207 | Ga0209673_1003688 | 3300025273 | Bacteria | 8814 |
| 208 | Ga0209673_1038127 | 3300025273 | Bacteria | 1403 |
| 209 | Ga0209673_1041298 | 3300025273 | Bacteria | 1310 |
| 210 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 211 | Ga0209130_1000782 | 3300025284 | Bacteria | 27407 |
| 212 | Ga0209130_1001760 | 3300025284 | Bacteria | 12841 |
| 213 | Ga0209675_1001002 | 3300025291 | Bacteria | 17764 |
| 214 | Ga0209675_1001248 | 3300025291 | Bacteria | 15267 |
| 215 | Ga0209675_1005234 | 3300025291 | Bacteria | 5497 |
| 216 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 217 | Ga0209676_1001621 | 3300025292 | Bacteria | 19914 |
| 218 | Ga0209676_1017331 | 3300025292 | Bacteria | 2555 |
| 219 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 220 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 221 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 222 | Ga0209025_1007807 | 3300025294 | Bacteria | 7865 |
| 223 | Ga0209025_1016840 | 3300025294 | Bacteria | 4271 |
| 224 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 225 | Ga0209564_1000597 | 3300025295 | Bacteria | 56580 |
| 226 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 227 | Ga0209758_1000262 | 3300025297 | Bacteria | 104339 |
| 228 | Ga0209758_1032569 | 3300025297 | Bacteria | 2112 |
| 229 | Ga0209758_1044133 | 3300025297 | Bacteria | 1634 |
| 230 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 231 | Ga0209050_1000511 | 3300025298 | Bacteria | 65746 |
| 232 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 233 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 234 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 235 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 236 | Ga0209051_1000273 | 3300025303 | Bacteria | 84847 |
| 237 | Ga0209051_1000326 | 3300025303 | Bacteria | 71572 |
| 238 | Ga0209051_1000644 | 3300025303 | Bacteria | 39711 |
| 239 | Ga0209051_1014092 | 3300025303 | Bacteria | 3751 |
| 240 | Ga0209051_1020750 | 3300025303 | Bacteria | 2817 |
| 241 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 242 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 243 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 244 | Ga0209257_1001999 | 3300025304 | Bacteria | 21868 |
| 245 | Ga0209257_1007808 | 3300025304 | Bacteria | 6340 |
| 246 | Ga0207697_10030636 | 3300025315 | Bacteria | 2201 |
| 247 | Ga0207656_10050387 | 3300025321 | Bacteria | 1798 |
| 248 | Ga0207656_10056644 | 3300025321 | Bacteria | 1709 |
| 249 | Ga0207656_10126632 | 3300025321 | Bacteria | 1194 |
| 250 | Ga0207655_1003575 | 3300025728 | Bacteria | 11504 |
| 251 | Ga0207682_10020913 | 3300025893 | Bacteria | 2572 |
| 252 | Ga0207682_10132731 | 3300025893 | Bacteria | 1112 |
| 253 | Ga0207682_10141708 | 3300025893 | Bacteria | 1079 |
| 254 | Ga0207680_10006674 | 3300025903 | Bacteria | 5598 |
| 255 | Ga0207680_10067605 | 3300025903 | Bacteria | 2202 |
| 256 | Ga0207699_10025169 | 3300025906 | Bacteria | 3265 |
| 257 | Ga0207643_10076497 | 3300025908 | Bacteria | 1933 |
| 258 | Ga0207643_10315539 | 3300025908 | Bacteria | 975 |
| 259 | Ga0207705_10111137 | 3300025909 | Bacteria | 2025 |
| 260 | Ga0207654_10174656 | 3300025911 | Bacteria | 1398 |
| 261 | Ga0207707_10246144 | 3300025912 | Bacteria | 1553 |
| 262 | Ga0207695_10059818 | 3300025913 | Bacteria | 3948 |
| 263 | Ga0207695_10344407 | 3300025913 | Bacteria | 1378 |
| 264 | Ga0207695_10556436 | 3300025913 | Bacteria | 1029 |
| 265 | Ga0207671_10001396 | 3300025914 | Bacteria | 28078 |
| 266 | Ga0207671_10298476 | 3300025914 | Bacteria | 1272 |
| 267 | Ga0207657_10257226 | 3300025919 | Bacteria | 1390 |
| 268 | Ga0207657_10333612 | 3300025919 | Bacteria | 1197 |
| 269 | Ga0207657_10773737 | 3300025919 | Bacteria | 743 |
| 270 | Ga0207649_10094148 | 3300025920 | Bacteria | 1968 |
| 271 | Ga0207652_10041183 | 3300025921 | Bacteria | 3925 |
| 272 | Ga0207646_10236684 | 3300025922 | Bacteria | 1650 |
| 273 | Ga0207681_10077489 | 3300025923 | Bacteria | 2337 |
| 274 | Ga0207694_10015293 | 3300025924 | Bacteria | 5790 |
| 275 | Ga0207694_10187489 | 3300025924 | Bacteria | 1679 |
| 276 | Ga0207694_10375547 | 3300025924 | Bacteria | 1179 |
| 277 | Ga0207650_10424797 | 3300025925 | Bacteria | 1103 |
| 278 | Ga0207659_10003908 | 3300025926 | Bacteria | 8987 |
| 279 | Ga0207659_10106261 | 3300025926 | Bacteria | 2125 |
| 280 | Ga0207687_10361930 | 3300025927 | Bacteria | 1184 |
| 281 | Ga0207700_10173905 | 3300025928 | Bacteria | 1798 |
| 282 | Ga0207664_10032555 | 3300025929 | Bacteria | 3998 |
| 283 | Ga0207644_10009027 | 3300025931 | Bacteria | 6534 |
| 284 | Ga0207706_10101365 | 3300025933 | Bacteria | 2533 |
| 285 | Ga0207706_10490393 | 3300025933 | Bacteria | 1061 |
| 286 | Ga0207686_10006099 | 3300025934 | Bacteria | 6475 |
| 287 | Ga0207686_10139875 | 3300025934 | Bacteria | 1671 |
| 288 | Ga0207709_10001312 | 3300025935 | Bacteria | 17674 |
| 289 | Ga0207709_10521937 | 3300025935 | Bacteria | 930 |
| 290 | Ga0207670_10021741 | 3300025936 | Bacteria | 3963 |
| 291 | Ga0207669_10118963 | 3300025937 | Bacteria | 1789 |
| 292 | Ga0207704_10121287 | 3300025938 | Bacteria | 1790 |
| 293 | Ga0207704_10156688 | 3300025938 | Bacteria | 1615 |
| 294 | Ga0207691_10047657 | 3300025940 | Bacteria | 3932 |
| 295 | Ga0207691_10093501 | 3300025940 | Bacteria | 2692 |
| 296 | Ga0207691_10230084 | 3300025940 | Bacteria | 1605 |
| 297 | Ga0207711_10029564 | 3300025941 | Bacteria | 4624 |
| 298 | Ga0207711_10126914 | 3300025941 | Bacteria | 2283 |
| 299 | Ga0207711_10315101 | 3300025941 | Bacteria | 1445 |
| 300 | Ga0207711_10402275 | 3300025941 | Bacteria | 1272 |
| 301 | Ga0207711_10512895 | 3300025941 | Bacteria | 1118 |
| 302 | Ga0207661_10118452 | 3300025944 | Bacteria | 2251 |
| 303 | Ga0207679_10142882 | 3300025945 | Bacteria | 1937 |
| 304 | Ga0207667_10012604 | 3300025949 | Bacteria | 9719 |
| 305 | Ga0207667_10022683 | 3300025949 | Bacteria | 6925 |
| 306 | Ga0207667_10084330 | 3300025949 | Bacteria | 3289 |
| 307 | Ga0207651_10001572 | 3300025960 | Bacteria | 10454 |
| 308 | Ga0207651_10038100 | 3300025960 | Bacteria | 3156 |
| 309 | Ga0207712_10082355 | 3300025961 | Bacteria | 2346 |
| 310 | Ga0207640_10410606 | 3300025981 | Bacteria | 1105 |
| 311 | Ga0207640_11076773 | 3300025981 | Bacteria | 710 |
| 312 | Ga0207658_10028843 | 3300025986 | Bacteria | 3912 |
| 313 | Ga0207658_10106749 | 3300025986 | Bacteria | 2205 |
| 314 | Ga0207658_10168406 | 3300025986 | Bacteria | 1802 |
| 315 | Ga0207677_10001764 | 3300026023 | Bacteria | 11437 |
| 316 | Ga0207703_10013263 | 3300026035 | Bacteria | 6419 |
| 317 | Ga0207678_10168650 | 3300026067 | Bacteria | 1869 |
| 318 | Ga0207678_10258203 | 3300026067 | Bacteria | 1493 |
| 319 | Ga0207678_10270203 | 3300026067 | Bacteria | 1458 |
| 320 | Ga0207708_10241634 | 3300026075 | Bacteria | 1452 |
| 321 | Ga0207702_10374981 | 3300026078 | Bacteria | 1367 |
| 322 | Ga0207641_10104443 | 3300026088 | Bacteria | 2501 |
| 323 | Ga0207676_10000860 | 3300026095 | Bacteria | 23595 |
| 324 | Ga0207674_10043572 | 3300026116 | Bacteria | 4626 |
| 325 | Ga0207675_100071167 | 3300026118 | Bacteria | 3251 |
| 326 | Ga0207683_10111828 | 3300026121 | Bacteria | 2446 |
| 327 | Ga0207683_10130831 | 3300026121 | Bacteria | 2257 |
| 328 | Ga0207683_10227369 | 3300026121 | Bacteria | 1701 |
| 329 | Ga0207698_10017771 | 3300026142 | Bacteria | 4834 |
| 330 | Ga0207698_10090604 | 3300026142 | Bacteria | 2501 |
| 331 | Ga0207698_10240379 | 3300026142 | Bacteria | 1650 |
| 332 | Ga0268266_10508095 | 3300028379 | Bacteria | 1151 |
| 333 | Ga0268265_10320490 | 3300028380 | Bacteria | 1403 |
| 334 | Ga0268264_10009846 | 3300028381 | Bacteria | 7912 |
| 335 | Ga0268264_10053300 | 3300028381 | Bacteria | 3374 |
| 336 | Ga0307517_10239552 | 3300028786 | Bacteria | 1078 |
| 337 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 338 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 339 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 340 | Ga0307515_10005841 | 3300028794 | Bacteria | 24838 |
| 341 | Ga0307515_10076382 | 3300028794 | Bacteria | 4445 |
| 342 | Ga0307515_10139879 | 3300028794 | Bacteria | 2604 |
| 343 | Ga0307512_10094956 | 3300030522 | Bacteria | 2054 |
| 344 | Ga0307512_10106244 | 3300030522 | Bacteria | 1874 |
| 345 | Ga0307512_10309400 | 3300030522 | Bacteria | 728 |
| 346 | Ga0265330_10182455 | 3300031235 | Bacteria | 889 |
| 347 | Ga0307513_10000285 | 3300031456 | Bacteria | 73356 |
| 348 | Ga0307513_10008606 | 3300031456 | Bacteria | 13021 |
| 349 | Ga0307513_10063034 | 3300031456 | Bacteria | 3914 |
| 350 | Ga0307513_10196324 | 3300031456 | Bacteria | 1864 |
| 351 | Ga0307513_10414554 | 3300031456 | Bacteria | 1078 |
| 352 | Ga0307509_10003393 | 3300031507 | Bacteria | 24259 |
| 353 | Ga0307509_10008236 | 3300031507 | Bacteria | 13333 |
| 354 | Ga0307509_10105334 | 3300031507 | Bacteria | 2842 |
| 355 | Ga0307508_10000649 | 3300031616 | Bacteria | 41802 |
| 356 | Ga0307514_10004105 | 3300031649 | Bacteria | 13508 |
| 357 | Ga0265314_10122614 | 3300031711 | Bacteria | 1634 |
| 358 | Ga0307516_10000839 | 3300031730 | Bacteria | 42125 |
| 359 | Ga0307516_10001570 | 3300031730 | Bacteria | 31465 |
| 360 | Ga0307516_10030714 | 3300031730 | Bacteria | 5420 |
| 361 | Ga0307406_10534714 | 3300031901 | Bacteria | 956 |
| 362 | Ga0307412_10027901 | 3300031911 | Bacteria | 3526 |
| 363 | Ga0307412_10188006 | 3300031911 | Bacteria | 1559 |
| 364 | Ga0307412_10756877 | 3300031911 | Bacteria | 839 |
| 365 | Ga0307411_10318457 | 3300032005 | Bacteria | 1255 |
| 366 | Ga0307411_10477163 | 3300032005 | Bacteria | 1049 |
| 367 | Ga0307507_10062762 | 3300033179 | Bacteria | 3447 |
| 368 | Ga0307510_10006302 | 3300033180 | Bacteria | 14153 |
| 369 | Ga0307510_10016329 | 3300033180 | Bacteria | 8764 |
| 370 | Ga0307510_10174022 | 3300033180 | Bacteria | 1726 |
| 371 | Ga0373944_0094673 | 3300035089 | Bacteria | 1002 |
| 372 | Ga0373946_0322521 | 3300035171 | Bacteria | 768 |
| 373 | Ga0373924_0105601 | 3300035410 | Bacteria | 1214 |
| 374 | Ga0373935_0207694 | 3300035692 | Bacteria | 1356 |
| 375 | Ga0373927_0095438 | 3300035695 | Bacteria | 1933 |
| 376 | Ga0373927_0302962 | 3300035695 | Bacteria | 1052 |
| 377 | Ga0373937_0414157 | 3300036401 | Bacteria | 1279 |
| 378 | Ga0373925_0287906 | 3300037068 | Bacteria | 1324 |
| 379 | Ga0395899_0002908 | 3300037312 | Bacteria | 13761 |
| 380 | Ga0395900_0070739 | 3300037418 | Bacteria | 3586 |
| 381 | Ga0395898_0005675 | 3300037466 | Bacteria | 13453 |
| 382 | Ga0395905_0000235 | 3300037471 | Bacteria | 83772 |
| 383 | Ga0395905_0081796 | 3300037471 | Bacteria | 3026 |
| 384 | Ga0395905_0487319 | 3300037471 | Bacteria | 1132 |
| 385 | Ga0395901_0090756 | 3300038443 | Bacteria | 3198 |
| 386 | Ga0395901_0484732 | 3300038443 | Bacteria | 1261 |
| 387 | Ga0436365_1383684 | 3300039437 | Bacteria | 1219 |
| 388 | Ga0439436_0002169 | 3300041404 | Bacteria | 5872 |
| 389 | Ga0439436_0115208 | 3300041404 | Bacteria | 751 |
| 390 | Ga0439447_005090 | 3300041407 | Bacteria | 4417 |
| 391 | Ga0439466_0017929 | 3300041411 | Bacteria | 2545 |
| 392 | Ga0439465_0000906 | 3300041413 | Bacteria | 9383 |
| 393 | Ga0451793_0890613 | 3300041452 | Bacteria | 1546 |
| 394 | Ga0451800_0270333 | 3300041459 | Bacteria | 1001 |
| 395 | Ga0451800_1206011 | 3300041459 | Bacteria | 1233 |
| 396 | Ga0451802_1353732 | 3300041460 | Bacteria | 2169 |
| 397 | Ga0451807_0257418 | 3300041486 | Bacteria | 2447 |
| 398 | Ga0451839_0670304 | 3300041496 | Bacteria | 1076 |
| 399 | Ga0451851_1239324 | 3300041507 | Bacteria | 1140 |
| 400 | Ga0451843_1371007 | 3300041509 | Bacteria | 1531 |
| 401 | Ga0451855_0272045 | 3300041511 | Bacteria | 1439 |
| 402 | Ga0451853_0418287 | 3300041512 | Bacteria | 4040 |
| 403 | Ga0439431_0006328 | 3300041997 | Bacteria | 2616 |
| 404 | Ga0439433_0009672 | 3300041999 | Bacteria | 2103 |
| 405 | Ga0439445_0004467 | 3300042004 | Bacteria | 3170 |
| 406 | Ga0439432_005173 | 3300042006 | Bacteria | 4713 |
| 407 | Ga0439449_0009320 | 3300042007 | Bacteria | 3719 |
| 408 | Ga0439452_015169 | 3300042010 | Bacteria | 2120 |
| 409 | Ga0439462_0008844 | 3300042015 | Bacteria | 2544 |
| 410 | Ga0451577_0049885 | 3300042876 | Bacteria | 3736 |
| 411 | Ga0466969_0011806 | 3300044656 | Bacteria | 4620 |
| 412 | Ga0466972_0027448 | 3300044658 | Bacteria | 2816 |
| 413 | Ga0466965_0008961 | 3300044683 | Bacteria | 4638 |
| 414 | Ga0466966_0018209 | 3300044684 | Bacteria | 4634 |
| 415 | Ga0466961_0122698 | 3300044693 | Bacteria | 1630 |
| 416 | Ga0466964_0134817 | 3300044706 | Bacteria | 1129 |
| 417 | Ga0453684_0200783 | 3300044712 | Bacteria | 2324 |
| 418 | Ga0466970_0096814 | 3300044765 | Bacteria | 1605 |
| 419 | Ga0466957_0293428 | 3300044842 | Bacteria | 1091 |
| 420 | Ga0466960_0003291 | 3300044901 | Bacteria | 6199 |
| 421 | Ga0466959_0038422 | 3300045049 | Bacteria | 3537 |
| 422 | Ga0451576_0002187 | 3300045051 | Bacteria | 30196 |
| 423 | Ga0495638_0050605 | 3300046460 | Bacteria | 2594 |
| 424 | Ga0495596_0214867 | 3300046500 | Bacteria | 747 |
| 425 | Ga0495610_0024551 | 3300046512 | Bacteria | 3250 |
| 426 | Ga0495610_0141450 | 3300046512 | Bacteria | 1035 |
| 427 | Ga0495616_0014367 | 3300046513 | Bacteria | 4434 |
| 428 | Ga0495620_0076295 | 3300046515 | Bacteria | 1362 |
| 429 | Ga0495631_0000901 | 3300046518 | Bacteria | 18559 |
| 430 | Ga0495637_0008435 | 3300046520 | Bacteria | 5061 |
| 431 | Ga0495643_0018867 | 3300046522 | Bacteria | 3996 |
| 432 | Ga0495648_0061025 | 3300046524 | Bacteria | 2241 |
| 433 | Ga0495648_0107782 | 3300046524 | Bacteria | 1523 |
| 434 | Ga0495663_0049349 | 3300046525 | Bacteria | 1300 |
| 435 | Ga0495642_0060565 | 3300046528 | Bacteria | 1570 |
| 436 | Ga0495654_0008561 | 3300046530 | Bacteria | 5642 |
| 437 | Ga0495654_0171223 | 3300046530 | Bacteria | 946 |
| 438 | Ga0495654_0188355 | 3300046530 | Bacteria | 890 |
| 439 | Ga0495598_0011021 | 3300046537 | Bacteria | 2181 |
| 440 | Ga0495598_0020011 | 3300046537 | Bacteria | 1762 |
| 441 | Ga0495621_0001043 | 3300046539 | Bacteria | 7103 |
| 442 | Ga0495621_0038648 | 3300046539 | Bacteria | 1666 |
| 443 | Ga0495621_0056020 | 3300046539 | Bacteria | 1420 |
| 444 | Ga0495622_0131016 | 3300046557 | Bacteria | 1142 |
| 445 | Ga0495633_0087490 | 3300046558 | Bacteria | 1449 |
| 446 | Ga0495656_0000270 | 3300046615 | Bacteria | 18372 |
| 447 | Ga0495625_0001836 | 3300046660 | Bacteria | 24291 |
| 448 | Ga0495625_0065474 | 3300046660 | Bacteria | 2561 |
| 449 | Ga0495588_0119051 | 3300046674 | Bacteria | 1392 |
| 450 | Ga0495588_0123935 | 3300046674 | Bacteria | 1362 |
| 451 | Ga0495658_0012766 | 3300046683 | Bacteria | 4265 |
| 452 | Ga0495613_0515961 | 3300046689 | Bacteria | 803 |
| 453 | Ga0495670_0125644 | 3300046691 | Bacteria | 1335 |
| 454 | Ga0495671_0001980 | 3300046692 | Bacteria | 13161 |
| 455 | Ga0495676_0125626 | 3300047321 | Bacteria | 1859 |
| 456 | Ga0495687_016741 | 3300047443 | Bacteria | 3678 |
| 457 | Ga0495684_0110503 | 3300047471 | Bacteria | 2074 |
| 458 | Ga0495686_0001547 | 3300047472 | Bacteria | 24575 |
| 459 | Ga0495615_0001036 | 3300048090 | Bacteria | 3959 |
| 460 | Ga0496100_0079972 | 3300048903 | Bacteria | 2204 |
| 461 | Ga0496102_0028401 | 3300048905 | Bacteria | 4996 |
| 462 | Ga0496102_0070707 | 3300048905 | Bacteria | 3204 |
| 463 | Ga0496102_0415157 | 3300048905 | Bacteria | 1264 |
| 464 | Ga0496103_0026318 | 3300048906 | Bacteria | 3522 |
| 465 | Ga0496104_0027579 | 3300048907 | Bacteria | 5257 |
| 466 | Ga0496105_0366479 | 3300048908 | Bacteria | 1148 |
| 467 | Ga0496106_0117354 | 3300048909 | Bacteria | 2077 |
| 468 | Ga0496106_0288833 | 3300048909 | Bacteria | 1315 |
| 469 | Ga0496106_0309759 | 3300048909 | Bacteria | 1267 |
| 470 | Ga0496107_0017711 | 3300048910 | Bacteria | 5013 |
| 471 | Ga0496108_0015466 | 3300048911 | Bacteria | 6224 |
| 472 | Ga0496110_1024184 | 3300048913 | Bacteria | 733 |
| 473 | Ga0496113_0229364 | 3300048916 | Bacteria | 1481 |
| 474 | Ga0496113_0328510 | 3300048916 | Bacteria | 1226 |
| 475 | Ga0496114_0106743 | 3300048917 | Bacteria | 2396 |
| 476 | Ga0496114_0627112 | 3300048917 | Bacteria | 947 |
| 477 | Ga0496116_0011687 | 3300048919 | Bacteria | 7235 |
| 478 | Ga0496117_0075576 | 3300048920 | Bacteria | 2237 |
| 479 | Ga0496118_0035486 | 3300048921 | Bacteria | 4047 |
| 480 | Ga0496118_0234296 | 3300048921 | Bacteria | 1056 |
| 481 | Ga0496119_0048469 | 3300048922 | Bacteria | 2634 |
| 482 | Ga0496119_0197157 | 3300048922 | Bacteria | 1045 |
| 483 | Ga0496122_0359744 | 3300048925 | Bacteria | 756 |
| 484 | Ga0496124_0121416 | 3300048927 | Bacteria | 2087 |
| 485 | Ga0496125_0060933 | 3300048928 | Bacteria | 3029 |
| 486 | Ga0496125_0144386 | 3300048928 | Bacteria | 1648 |
| 487 | Ga0496126_0381431 | 3300048929 | Bacteria | 1147 |
| 488 | Ga0501032_0235166 | 3300049569 | Bacteria | 1191 |
| 489 | Ga0501033_0036647 | 3300049570 | Bacteria | 3674 |
| 490 | Ga0501034_0171821 | 3300049571 | Bacteria | 2134 |
| 491 | Ga0501036_0084645 | 3300049572 | Bacteria | 2681 |
| 492 | Ga0501037_0288251 | 3300049573 | Bacteria | 1143 |
| 493 | Ga0501047_0002291 | 3300049581 | Bacteria | 18316 |
| 494 | Ga0501047_0052645 | 3300049581 | Bacteria | 3935 |
| 495 | Ga0501069_0000781 | 3300049585 | Bacteria | 14959 |
| 496 | Ga0501070_0000645 | 3300049586 | Bacteria | 32122 |
| 497 | Ga0501073_0000370 | 3300049589 | Bacteria | 30322 |
| 498 | Ga0501073_0064188 | 3300049589 | Bacteria | 2561 |
| 499 | Ga0501074_0000213 | 3300049590 | Bacteria | 31865 |
| 500 | Ga0501076_0520650 | 3300049592 | Bacteria | 980 |
| 501 | Ga0501206_032265 | 3300049653 | Bacteria | 783 |
| 502 | Ga0501217_048164 | 3300049661 | Bacteria | 1106 |
| 503 | Ga0501239_012621 | 3300049672 | Bacteria | 958 |
| 504 | Ga0501253_005411 | 3300049683 | Bacteria | 1674 |
| 505 | Ga0501225_0066790 | 3300049705 | Bacteria | 1017 |
| 506 | Ga0501079_0002160 | 3300049741 | Bacteria | 14166 |
| 507 | Ga0501080_0001759 | 3300049742 | Bacteria | 18574 |
| 508 | Ga0501080_0021746 | 3300049742 | Bacteria | 5942 |
| 509 | Ga0501262_000465 | 3300049759 | Bacteria | 4826 |
| 510 | Ga0501265_000251 | 3300049762 | Bacteria | 5366 |
| 511 | Ga0501035_0542388 | 3300049822 | Bacteria | 953 |
| 512 | Ga0501044_0044663 | 3300049823 | Bacteria | 4597 |
| 513 | Ga0501044_0172309 | 3300049823 | Bacteria | 2134 |
| 514 | Ga0501044_0399064 | 3300049823 | Bacteria | 1288 |
| 515 | nmdc:mga03n38_41568_c1 | 3300050490 | Bacteria | 2004 |
| 516 | nmdc:mga0k408_168015_c1 | 3300050493 | Bacteria | 1307 |
| 517 | nmdc:mga0k408_172140_c1 | 3300050493 | Bacteria | 1291 |
| 518 | nmdc:mga0k408_9944_c1 | 3300050493 | Bacteria | 5136 |
| 519 | nmdc:mga06z11_50928_c1 | 3300050494 | Bacteria | 2118 |
| 520 | nmdc:mga07m45_103524_c1 | 3300050496 | Bacteria | 1636 |
| 521 | nmdc:mga07m45_19542_c1 | 3300050496 | Bacteria | 3672 |
| 522 | nmdc:mga07m45_199272_c1 | 3300050496 | Bacteria | 1164 |
| 523 | nmdc:mga07m45_205776_c1 | 3300050496 | Bacteria | 1145 |
| 524 | nmdc:mga05p37_485668_c1 | 3300050507 | Bacteria | 1421 |
| 525 | nmdc:mga09592_187549_c1 | 3300050508 | Bacteria | 1790 |
| 526 | nmdc:mga0qj67_613237_c1 | 3300050509 | Bacteria | 870 |
| 527 | nmdc:mga0n895_159993_c1 | 3300050512 | Bacteria | 2283 |
| 528 | nmdc:mga08x19_2660_c1 | 3300050514 | Bacteria | 10809 |
| 529 | Ga0500610_0005030 | 3300053079 | Bacteria | 5362 |
| 530 | Ga0500610_0105157 | 3300053079 | Bacteria | 1456 |
| 531 | Ga0495619_0065047 | 3300053085 | Bacteria | 2432 |
| 532 | Ga0500643_005905 | 3300053087 | Bacteria | 5194 |
| 533 | Ga0500643_060048 | 3300053087 | Bacteria | 1069 |
| 534 | Ga0500644_0023398 | 3300053088 | Bacteria | 1876 |
| 535 | Ga0500644_0055632 | 3300053088 | Bacteria | 1374 |
| 536 | Ga0500647_0090296 | 3300053091 | Bacteria | 1467 |
| 537 | Ga0500651_0000082 | 3300053093 | Bacteria | 60329 |
| 538 | Ga0500651_0075438 | 3300053093 | Bacteria | 2095 |
| 539 | Ga0500651_0140949 | 3300053093 | Bacteria | 1453 |
| 540 | Ga0500651_0200741 | 3300053093 | Bacteria | 1177 |
| 541 | Ga0500562_021120 | 3300053108 | Bacteria | 1692 |
| 542 | Ga0500562_128221 | 3300053108 | Bacteria | 691 |
| 543 | Ga0500571_000152 | 3300053110 | Bacteria | 23934 |
| 544 | Ga0500592_010925 | 3300053116 | Bacteria | 1450 |
| 545 | Ga0500593_000664 | 3300053117 | Bacteria | 13093 |
| 546 | Ga0500594_0004880 | 3300053118 | Bacteria | 2965 |
| 547 | Ga0500597_093856 | 3300053120 | Bacteria | 1304 |
| 548 | Ga0500607_000049 | 3300053121 | Bacteria | 80941 |
| 549 | Ga0500618_035638 | 3300053125 | Bacteria | 1155 |
| 550 | Ga0500626_031951 | 3300053128 | Bacteria | 2379 |
| 551 | Ga0500655_000668 | 3300053133 | Bacteria | 6814 |
| 552 | Ga0500655_020210 | 3300053133 | Bacteria | 1243 |
| 553 | Ga0500658_0018781 | 3300053134 | Bacteria | 2597 |
| 554 | Ga0500559_0000021 | 3300053136 | Bacteria | 129980 |
| 555 | Ga0500559_0006291 | 3300053136 | Bacteria | 5367 |
| 556 | Ga0500561_0012355 | 3300053137 | Bacteria | 1820 |
| 557 | Ga0500564_002728 | 3300053138 | Bacteria | 6631 |
| 558 | Ga0500568_0003226 | 3300053139 | Bacteria | 9229 |
| 559 | Ga0500604_0017693 | 3300053151 | Bacteria | 1977 |
| 560 | Ga0500616_0011758 | 3300053153 | Bacteria | 5150 |
| 561 | Ga0500622_0001453 | 3300053156 | Bacteria | 18934 |
| 562 | Ga0500634_0041585 | 3300053161 | Bacteria | 2495 |
| 563 | Ga0500634_0067724 | 3300053161 | Bacteria | 1876 |
| 564 | Ga0500638_039409 | 3300053162 | Bacteria | 2293 |
| 565 | Ga0500636_0019501 | 3300053177 | Bacteria | 4014 |
| 566 | Ga0500636_0156302 | 3300053177 | Bacteria | 1248 |
| 567 | Ga0500570_133490 | 3300053724 | Bacteria | 935 |
| 568 | Ga0500645_001446 | 3300053730 | Bacteria | 12024 |
| 569 | Ga0500565_016503 | 3300053734 | Bacteria | 839 |
| 570 | Ga0500587_001719 | 3300053739 | Bacteria | 3107 |
| 571 | Ga0501082_0016781 | 3300060353 | Bacteria | 6306 |
| 572 | Ga0466962_0332047 | 3300061719 | Bacteria | 755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035089 | Ga0373944_0094673 | Ga0373944_0094673_218_820 | 200 |
| 2 | 3300035171 | Ga0373946_0322521 | Ga0373946_0322521_31_633 | 200 |
| 3 | 3300048907 | Ga0496104_0027579 | Ga0496104_0027579_4042_4644 | 200 |
| 4 | iso_pu_bacteria | 2928084124 | 2928088404 | 200 |
| 5 | 3300028786 | Ga0307517_10239552 | Ga0307517_102395522 | 201 |
| 6 | 3300031730 | Ga0307516_10000839 | Ga0307516_100008395 | 201 |
| 7 | 3300001979 | JGI24740J21852_10010267 | JGI24740J21852_100102672 | 202 |
| 8 | 3300001989 | JGI24739J22299_10012366 | JGI24739J22299_100123663 | 202 |
| 9 | 3300002773 | JGI25152J39213_1004480 | JGI25152J39213_10044802 | 202 |
| 10 | 3300002774 | JGI25150J39212_1003617 | JGI25150J39212_10036173 | 202 |
| 11 | 3300002987 | JGI25159J45721_1019792 | JGI25159J45721_10197921 | 202 |
| 12 | 3300003187 | JGI25151J46595_10011657 | JGI25151J46595_100116573 | 202 |
| 13 | 3300003215 | JGI25153J46596_10001867 | JGI25153J46596_100018673 | 202 |
| 14 | 3300003316 | rootH1_10021104 | rootH1_100211042 | 202 |
| 15 | 3300003320 | rootH2_10013705 | rootH2_100137052 | 202 |
| 16 | 3300003320 | rootH2_10067880 | rootH2_100678801 | 202 |
| 17 | 3300003374 | JGI25161J50226_1007551 | JGI25161J50226_10075512 | 202 |
| 18 | 3300003761 | Ga0055535_1000378 | Ga0055535_10003787 | 202 |
| 19 | 3300003762 | Ga0055542_1000036 | Ga0055542_1000036180 | 202 |
| 20 | 3300003771 | Ga0055526_1029483 | Ga0055526_10294832 | 202 |
| 21 | 3300003773 | Ga0055537_1007928 | Ga0055537_10079283 | 202 |
| 22 | 3300003775 | Ga0055524_1025578 | Ga0055524_10255782 | 202 |
| 23 | 3300003781 | Ga0055536_1005507 | Ga0055536_10055073 | 202 |
| 24 | 3300003781 | Ga0055536_1008391 | Ga0055536_10083913 | 202 |
| 25 | 3300003790 | Ga0055528_1026183 | Ga0055528_10261832 | 202 |
| 26 | 3300003791 | Ga0055530_10003783 | Ga0055530_100037833 | 202 |
| 27 | 3300003791 | Ga0055530_10006987 | Ga0055530_100069873 | 202 |
| 28 | 3300003792 | Ga0055540_1004457 | Ga0055540_10044573 | 202 |
| 29 | 3300003792 | Ga0055540_1022163 | Ga0055540_10221632 | 202 |
| 30 | 3300003794 | Ga0055531_10001303 | Ga0055531_1000130320 | 202 |
| 31 | 3300003794 | Ga0055531_10006289 | Ga0055531_100062894 | 202 |
| 32 | 3300005288 | Ga0065714_10103921 | Ga0065714_101039212 | 202 |
| 33 | 3300005327 | Ga0070658_10024683 | Ga0070658_100246831 | 202 |
| 34 | 3300005329 | Ga0070683_100054744 | Ga0070683_1000547444 | 202 |
| 35 | 3300005329 | Ga0070683_101283494 | Ga0070683_1012834941 | 202 |
| 36 | 3300005330 | Ga0070690_100005700 | Ga0070690_1000057002 | 202 |
| 37 | 3300005331 | Ga0070670_100607057 | Ga0070670_1006070572 | 202 |
| 38 | 3300005333 | Ga0070677_10067252 | Ga0070677_100672522 | 202 |
| 39 | 3300005335 | Ga0070666_10010460 | Ga0070666_100104602 | 202 |
| 40 | 3300005335 | Ga0070666_10085482 | Ga0070666_100854822 | 202 |
| 41 | 3300005337 | Ga0070682_100366483 | Ga0070682_1003664832 | 202 |
| 42 | 3300005337 | Ga0070682_100715252 | Ga0070682_1007152521 | 202 |
| 43 | 3300005338 | Ga0068868_100044505 | Ga0068868_1000445052 | 202 |
| 44 | 3300005339 | Ga0070660_100504617 | Ga0070660_1005046172 | 202 |
| 45 | 3300005340 | Ga0070689_100027094 | Ga0070689_1000270944 | 202 |
| 46 | 3300005340 | Ga0070689_100134541 | Ga0070689_1001345411 | 202 |
| 47 | 3300005343 | Ga0070687_100071796 | Ga0070687_1000717963 | 202 |
| 48 | 3300005344 | Ga0070661_100099997 | Ga0070661_1000999972 | 202 |
| 49 | 3300005347 | Ga0070668_100061617 | Ga0070668_1000616173 | 202 |
| 50 | 3300005347 | Ga0070668_100820052 | Ga0070668_1008200521 | 202 |
| 51 | 3300005353 | Ga0070669_100026299 | Ga0070669_1000262992 | 202 |
| 52 | 3300005353 | Ga0070669_100266442 | Ga0070669_1002664422 | 202 |
| 53 | 3300005354 | Ga0070675_100012318 | Ga0070675_1000123182 | 202 |
| 54 | 3300005355 | Ga0070671_100094971 | Ga0070671_1000949712 | 202 |
| 55 | 3300005355 | Ga0070671_100256013 | Ga0070671_1002560131 | 202 |
| 56 | 3300005355 | Ga0070671_100494839 | Ga0070671_1004948392 | 202 |
| 57 | 3300005356 | Ga0070674_100105131 | Ga0070674_1001051312 | 202 |
| 58 | 3300005356 | Ga0070674_100149986 | Ga0070674_1001499862 | 202 |
| 59 | 3300005356 | Ga0070674_100226944 | Ga0070674_1002269441 | 202 |
| 60 | 3300005364 | Ga0070673_100007204 | Ga0070673_1000072042 | 202 |
| 61 | 3300005364 | Ga0070673_100069810 | Ga0070673_1000698104 | 202 |
| 62 | 3300005364 | Ga0070673_100125587 | Ga0070673_1001255872 | 202 |
| 63 | 3300005364 | Ga0070673_100184690 | Ga0070673_1001846902 | 202 |
| 64 | 3300005365 | Ga0070688_100015547 | Ga0070688_1000155472 | 202 |
| 65 | 3300005367 | Ga0070667_100012330 | Ga0070667_1000123307 | 202 |
| 66 | 3300005367 | Ga0070667_100176237 | Ga0070667_1001762372 | 202 |
| 67 | 3300005367 | Ga0070667_100484614 | Ga0070667_1004846142 | 202 |
| 68 | 3300005367 | Ga0070667_100654661 | Ga0070667_1006546611 | 202 |
| 69 | 3300005435 | Ga0070714_100005767 | Ga0070714_1000057679 | 202 |
| 70 | 3300005436 | Ga0070713_100015249 | Ga0070713_1000152492 | 202 |
| 71 | 3300005436 | Ga0070713_100286072 | Ga0070713_1002860722 | 202 |
| 72 | 3300005439 | Ga0070711_100060830 | Ga0070711_1000608302 | 202 |
| 73 | 3300005441 | Ga0070700_100382653 | Ga0070700_1003826531 | 202 |
| 74 | 3300005455 | Ga0070663_100132315 | Ga0070663_1001323152 | 202 |
| 75 | 3300005455 | Ga0070663_100172767 | Ga0070663_1001727672 | 202 |
| 76 | 3300005456 | Ga0070678_100059633 | Ga0070678_1000596332 | 202 |
| 77 | 3300005456 | Ga0070678_100112197 | Ga0070678_1001121972 | 202 |
| 78 | 3300005456 | Ga0070678_100373039 | Ga0070678_1003730392 | 202 |
| 79 | 3300005456 | Ga0070678_100463233 | Ga0070678_1004632331 | 202 |
| 80 | 3300005457 | Ga0070662_100112117 | Ga0070662_1001121172 | 202 |
| 81 | 3300005457 | Ga0070662_100645707 | Ga0070662_1006457071 | 202 |
| 82 | 3300005458 | Ga0070681_10038217 | Ga0070681_100382174 | 202 |
| 83 | 3300005458 | Ga0070681_10258443 | Ga0070681_102584432 | 202 |
| 84 | 3300005458 | Ga0070681_10907202 | Ga0070681_109072021 | 202 |
| 85 | 3300005459 | Ga0068867_100124832 | Ga0068867_1001248322 | 202 |
| 86 | 3300005459 | Ga0068867_100830297 | Ga0068867_1008302971 | 202 |
| 87 | 3300005466 | Ga0070685_10314186 | Ga0070685_103141862 | 202 |
| 88 | 3300005467 | Ga0070706_100207786 | Ga0070706_1002077862 | 202 |
| 89 | 3300005468 | Ga0070707_100067458 | Ga0070707_1000674581 | 202 |
| 90 | 3300005468 | Ga0070707_100231147 | Ga0070707_1002311471 | 202 |
| 91 | 3300005518 | Ga0070699_100420962 | Ga0070699_1004209621 | 202 |
| 92 | 3300005530 | Ga0070679_100036685 | Ga0070679_1000366853 | 202 |
| 93 | 3300005535 | Ga0070684_100057619 | Ga0070684_1000576192 | 202 |
| 94 | 3300005539 | Ga0068853_100101829 | Ga0068853_1001018293 | 202 |
| 95 | 3300005539 | Ga0068853_100178016 | Ga0068853_1001780163 | 202 |
| 96 | 3300005543 | Ga0070672_100047045 | Ga0070672_1000470452 | 202 |
| 97 | 3300005543 | Ga0070672_100059871 | Ga0070672_1000598712 | 202 |
| 98 | 3300005543 | Ga0070672_100337573 | Ga0070672_1003375732 | 202 |
| 99 | 3300005543 | Ga0070672_100613100 | Ga0070672_1006131001 | 202 |
| 100 | 3300005548 | Ga0070665_100781913 | Ga0070665_1007819131 | 202 |
| 101 | 3300005548 | Ga0070665_100988455 | Ga0070665_1009884551 | 202 |
| 102 | 3300005549 | Ga0070704_100282329 | Ga0070704_1002823292 | 202 |
| 103 | 3300005563 | Ga0068855_100003441 | Ga0068855_10000344116 | 202 |
| 104 | 3300005563 | Ga0068855_100005041 | Ga0068855_1000050418 | 202 |
| 105 | 3300005564 | Ga0070664_100010652 | Ga0070664_10001065210 | 202 |
| 106 | 3300005564 | Ga0070664_100397752 | Ga0070664_1003977522 | 202 |
| 107 | 3300005564 | Ga0070664_100438789 | Ga0070664_1004387891 | 202 |
| 108 | 3300005577 | Ga0068857_100088615 | Ga0068857_1000886152 | 202 |
| 109 | 3300005614 | Ga0068856_100445296 | Ga0068856_1004452962 | 202 |
| 110 | 3300005615 | Ga0070702_100645125 | Ga0070702_1006451251 | 202 |
| 111 | 3300005616 | Ga0068852_100073013 | Ga0068852_1000730132 | 202 |
| 112 | 3300005616 | Ga0068852_100112526 | Ga0068852_1001125263 | 202 |
| 113 | 3300005616 | Ga0068852_100782175 | Ga0068852_1007821751 | 202 |
| 114 | 3300005617 | Ga0068859_100005136 | Ga0068859_10000513610 | 202 |
| 115 | 3300005618 | Ga0068864_100009415 | Ga0068864_1000094153 | 202 |
| 116 | 3300005618 | Ga0068864_100234055 | Ga0068864_1002340552 | 202 |
| 117 | 3300005618 | Ga0068864_100286653 | Ga0068864_1002866532 | 202 |
| 118 | 3300005618 | Ga0068864_100354337 | Ga0068864_1003543372 | 202 |
| 119 | 3300005834 | Ga0068851_10080163 | Ga0068851_100801631 | 202 |
| 120 | 3300005834 | Ga0068851_10083261 | Ga0068851_100832612 | 202 |
| 121 | 3300005841 | Ga0068863_100045854 | Ga0068863_1000458541 | 202 |
| 122 | 3300005841 | Ga0068863_100330639 | Ga0068863_1003306391 | 202 |
| 123 | 3300005842 | Ga0068858_100008304 | Ga0068858_1000083046 | 202 |
| 124 | 3300005844 | Ga0068862_100201122 | Ga0068862_1002011222 | 202 |
| 125 | 3300005844 | Ga0068862_100273199 | Ga0068862_1002731991 | 202 |
| 126 | 3300006028 | Ga0070717_10068762 | Ga0070717_100687623 | 202 |
| 127 | 3300006038 | Ga0075365_10398935 | Ga0075365_103989351 | 202 |
| 128 | 3300006177 | Ga0075362_10125114 | Ga0075362_101251141 | 202 |
| 129 | 3300006178 | Ga0075367_10033449 | Ga0075367_100334492 | 202 |
| 130 | 3300006186 | Ga0075369_10079480 | Ga0075369_100794802 | 202 |
| 131 | 3300006237 | Ga0097621_100054643 | Ga0097621_1000546432 | 202 |
| 132 | 3300006237 | Ga0097621_100150903 | Ga0097621_1001509032 | 202 |
| 133 | 3300006237 | Ga0097621_100312785 | Ga0097621_1003127853 | 202 |
| 134 | 3300006237 | Ga0097621_100331671 | Ga0097621_1003316712 | 202 |
| 135 | 3300006353 | Ga0075370_10011450 | Ga0075370_100114502 | 202 |
| 136 | 3300006353 | Ga0075370_10060241 | Ga0075370_100602412 | 202 |
| 137 | 3300006353 | Ga0075370_10062376 | Ga0075370_100623762 | 202 |
| 138 | 3300006353 | Ga0075370_10086706 | Ga0075370_100867062 | 202 |
| 139 | 3300006846 | Ga0075430_100738553 | Ga0075430_1007385531 | 202 |
| 140 | 3300006880 | Ga0075429_100012958 | Ga0075429_1000129585 | 202 |
| 141 | 3300006931 | Ga0097620_100005136 | Ga0097620_1000051364 | 202 |
| 142 | 3300009036 | Ga0105244_10024726 | Ga0105244_100247262 | 202 |
| 143 | 3300009093 | Ga0105240_10002337 | Ga0105240_100023373 | 202 |
| 144 | 3300009093 | Ga0105240_10020056 | Ga0105240_100200562 | 202 |
| 145 | 3300009094 | Ga0111539_10848431 | Ga0111539_108484312 | 202 |
| 146 | 3300009098 | Ga0105245_10301228 | Ga0105245_103012282 | 202 |
| 147 | 3300009147 | Ga0114129_10604104 | Ga0114129_106041042 | 202 |
| 148 | 3300009148 | Ga0105243_10024314 | Ga0105243_100243143 | 202 |
| 149 | 3300009148 | Ga0105243_10189350 | Ga0105243_101893501 | 202 |
| 150 | 3300009148 | Ga0105243_10271575 | Ga0105243_102715752 | 202 |
| 151 | 3300009148 | Ga0105243_10326992 | Ga0105243_103269922 | 202 |
| 152 | 3300009174 | Ga0105241_10031759 | Ga0105241_100317592 | 202 |
| 153 | 3300009176 | Ga0105242_10001654 | Ga0105242_100016544 | 202 |
| 154 | 3300009176 | Ga0105242_10193224 | Ga0105242_101932242 | 202 |
| 155 | 3300009176 | Ga0105242_10406649 | Ga0105242_104066492 | 202 |
| 156 | 3300009177 | Ga0105248_10038088 | Ga0105248_100380885 | 202 |
| 157 | 3300009545 | Ga0105237_10000407 | Ga0105237_1000040744 | 202 |
| 158 | 3300009545 | Ga0105237_10336513 | Ga0105237_103365132 | 202 |
| 159 | 3300009551 | Ga0105238_10013664 | Ga0105238_100136647 | 202 |
| 160 | 3300009551 | Ga0105238_10032068 | Ga0105238_100320682 | 202 |
| 161 | 3300009551 | Ga0105238_10124680 | Ga0105238_101246802 | 202 |
| 162 | 3300009551 | Ga0105238_10253569 | Ga0105238_102535693 | 202 |
| 163 | 3300009551 | Ga0105238_10483859 | Ga0105238_104838591 | 202 |
| 164 | 3300009553 | Ga0105249_10269535 | Ga0105249_102695352 | 202 |
| 165 | 3300010375 | Ga0105239_10000335 | Ga0105239_1000033553 | 202 |
| 166 | 3300011119 | Ga0105246_10024778 | Ga0105246_100247783 | 202 |
| 167 | 3300011119 | Ga0105246_10178035 | Ga0105246_101780352 | 202 |
| 168 | 3300011119 | Ga0105246_10582822 | Ga0105246_105828222 | 202 |
| 169 | 3300012502 | Ga0157347_1001530 | Ga0157347_10015302 | 202 |
| 170 | 3300012510 | Ga0157316_1009859 | Ga0157316_10098591 | 202 |
| 171 | 3300013102 | Ga0157371_10115087 | Ga0157371_101150872 | 202 |
| 172 | 3300013104 | Ga0157370_10001435 | Ga0157370_1000143516 | 202 |
| 173 | 3300013104 | Ga0157370_10152790 | Ga0157370_101527902 | 202 |
| 174 | 3300013297 | Ga0157378_10215544 | Ga0157378_102155442 | 202 |
| 175 | 3300013297 | Ga0157378_10323325 | Ga0157378_103233252 | 202 |
| 176 | 3300013297 | Ga0157378_11425416 | Ga0157378_114254162 | 202 |
| 177 | 3300013306 | Ga0163162_10035213 | Ga0163162_100352135 | 202 |
| 178 | 3300013306 | Ga0163162_10112217 | Ga0163162_101122171 | 202 |
| 179 | 3300013306 | Ga0163162_10253862 | Ga0163162_102538621 | 202 |
| 180 | 3300013307 | Ga0157372_10145921 | Ga0157372_101459212 | 202 |
| 181 | 3300013307 | Ga0157372_10156403 | Ga0157372_101564032 | 202 |
| 182 | 3300013307 | Ga0157372_10216447 | Ga0157372_102164472 | 202 |
| 183 | 3300013308 | Ga0157375_10001395 | Ga0157375_100013952 | 202 |
| 184 | 3300013308 | Ga0157375_10210762 | Ga0157375_102107622 | 202 |
| 185 | 3300014325 | Ga0163163_10007322 | Ga0163163_100073222 | 202 |
| 186 | 3300014325 | Ga0163163_10146101 | Ga0163163_101461013 | 202 |
| 187 | 3300014325 | Ga0163163_10582623 | Ga0163163_105826231 | 202 |
| 188 | 3300014326 | Ga0157380_10100761 | Ga0157380_101007611 | 202 |
| 189 | 3300014326 | Ga0157380_10149293 | Ga0157380_101492931 | 202 |
| 190 | 3300014326 | Ga0157380_10625048 | Ga0157380_106250482 | 202 |
| 191 | 3300014326 | Ga0157380_11023268 | Ga0157380_110232681 | 202 |
| 192 | 3300014497 | Ga0182008_10009207 | Ga0182008_100092073 | 202 |
| 193 | 3300014497 | Ga0182008_10036405 | Ga0182008_100364052 | 202 |
| 194 | 3300014745 | Ga0157377_10108816 | Ga0157377_101088162 | 202 |
| 195 | 3300014969 | Ga0157376_10294903 | Ga0157376_102949031 | 202 |
| 196 | 3300015261 | Ga0182006_1013696 | Ga0182006_10136963 | 202 |
| 197 | 3300015262 | Ga0182007_10001904 | Ga0182007_100019049 | 202 |
| 198 | 3300017792 | Ga0163161_10000201 | Ga0163161_100002012 | 202 |
| 199 | 3300017792 | Ga0163161_10180073 | Ga0163161_101800732 | 202 |
| 200 | 3300017792 | Ga0163161_10239386 | Ga0163161_102393862 | 202 |
| 201 | 3300017792 | Ga0163161_10248548 | Ga0163161_102485482 | 202 |
| 202 | 3300025228 | Ga0209672_101176 | Ga0209672_1011767 | 202 |
| 203 | 3300025229 | Ga0209147_100472 | Ga0209147_10047219 | 202 |
| 204 | 3300025242 | Ga0209258_100091 | Ga0209258_100091181 | 202 |
| 205 | 3300025245 | Ga0207425_1000190 | Ga0207425_100019019 | 202 |
| 206 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033303 | 202 |
| 207 | 3300025258 | Ga0209129_1000091 | Ga0209129_100009124 | 202 |
| 208 | 3300025258 | Ga0209129_1001758 | Ga0209129_100175817 | 202 |
| 209 | 3300025258 | Ga0209129_1007810 | Ga0209129_10078102 | 202 |
| 210 | 3300025263 | Ga0209565_1000335 | Ga0209565_100033514 | 202 |
| 211 | 3300025263 | Ga0209565_1001489 | Ga0209565_10014893 | 202 |
| 212 | 3300025273 | Ga0209673_1000154 | Ga0209673_100015427 | 202 |
| 213 | 3300025273 | Ga0209673_1003688 | Ga0209673_10036882 | 202 |
| 214 | 3300025273 | Ga0209673_1038127 | Ga0209673_10381272 | 202 |
| 215 | 3300025273 | Ga0209673_1041298 | Ga0209673_10412982 | 202 |
| 216 | 3300025284 | Ga0209130_1000140 | Ga0209130_100014094 | 202 |
| 217 | 3300025284 | Ga0209130_1000782 | Ga0209130_10007828 | 202 |
| 218 | 3300025284 | Ga0209130_1001760 | Ga0209130_10017603 | 202 |
| 219 | 3300025291 | Ga0209675_1001002 | Ga0209675_100100212 | 202 |
| 220 | 3300025291 | Ga0209675_1001248 | Ga0209675_100124814 | 202 |
| 221 | 3300025291 | Ga0209675_1005234 | Ga0209675_10052343 | 202 |
| 222 | 3300025292 | Ga0209676_1000048 | Ga0209676_100004820 | 202 |
| 223 | 3300025292 | Ga0209676_1001621 | Ga0209676_100162121 | 202 |
| 224 | 3300025292 | Ga0209676_1017331 | Ga0209676_10173312 | 202 |
| 225 | 3300025294 | Ga0209025_1000207 | Ga0209025_1000207110 | 202 |
| 226 | 3300025294 | Ga0209025_1000286 | Ga0209025_100028669 | 202 |
| 227 | 3300025294 | Ga0209025_1000356 | Ga0209025_100035669 | 202 |
| 228 | 3300025294 | Ga0209025_1007807 | Ga0209025_10078073 | 202 |
| 229 | 3300025294 | Ga0209025_1016840 | Ga0209025_10168404 | 202 |
| 230 | 3300025295 | Ga0209564_1000103 | Ga0209564_100010333 | 202 |
| 231 | 3300025295 | Ga0209564_1000597 | Ga0209564_100059714 | 202 |
| 232 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092124 | 202 |
| 233 | 3300025297 | Ga0209758_1000262 | Ga0209758_100026232 | 202 |
| 234 | 3300025297 | Ga0209758_1032569 | Ga0209758_10325692 | 202 |
| 235 | 3300025297 | Ga0209758_1044133 | Ga0209758_10441332 | 202 |
| 236 | 3300025298 | Ga0209050_1000012 | Ga0209050_100001220 | 202 |
| 237 | 3300025298 | Ga0209050_1000511 | Ga0209050_100051125 | 202 |
| 238 | 3300025299 | Ga0209256_1000065 | Ga0209256_10000653 | 202 |
| 239 | 3300025299 | Ga0209256_1000094 | Ga0209256_100009494 | 202 |
| 240 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084109 | 202 |
| 241 | 3300025302 | Ga0207426_1000161 | Ga0207426_1000161153 | 202 |
| 242 | 3300025303 | Ga0209051_1000273 | Ga0209051_100027354 | 202 |
| 243 | 3300025303 | Ga0209051_1000326 | Ga0209051_100032640 | 202 |
| 244 | 3300025303 | Ga0209051_1000644 | Ga0209051_100064440 | 202 |
| 245 | 3300025303 | Ga0209051_1014092 | Ga0209051_10140923 | 202 |
| 246 | 3300025303 | Ga0209051_1020750 | Ga0209051_10207502 | 202 |
| 247 | 3300025304 | Ga0209257_1000012 | Ga0209257_10000121022 | 202 |
| 248 | 3300025304 | Ga0209257_1000045 | Ga0209257_1000045428 | 202 |
| 249 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024935 | 202 |
| 250 | 3300025304 | Ga0209257_1001999 | Ga0209257_10019993 | 202 |
| 251 | 3300025304 | Ga0209257_1007808 | Ga0209257_10078082 | 202 |
| 252 | 3300025315 | Ga0207697_10030636 | Ga0207697_100306362 | 202 |
| 253 | 3300025321 | Ga0207656_10050387 | Ga0207656_100503871 | 202 |
| 254 | 3300025321 | Ga0207656_10056644 | Ga0207656_100566442 | 202 |
| 255 | 3300025321 | Ga0207656_10126632 | Ga0207656_101266322 | 202 |
| 256 | 3300025728 | Ga0207655_1003575 | Ga0207655_10035758 | 202 |
| 257 | 3300025893 | Ga0207682_10020913 | Ga0207682_100209133 | 202 |
| 258 | 3300025893 | Ga0207682_10132731 | Ga0207682_101327311 | 202 |
| 259 | 3300025893 | Ga0207682_10141708 | Ga0207682_101417082 | 202 |
| 260 | 3300025903 | Ga0207680_10006674 | Ga0207680_100066742 | 202 |
| 261 | 3300025903 | Ga0207680_10067605 | Ga0207680_100676052 | 202 |
| 262 | 3300025906 | Ga0207699_10025169 | Ga0207699_100251694 | 202 |
| 263 | 3300025908 | Ga0207643_10076497 | Ga0207643_100764971 | 202 |
| 264 | 3300025908 | Ga0207643_10315539 | Ga0207643_103155391 | 202 |
| 265 | 3300025909 | Ga0207705_10111137 | Ga0207705_101111372 | 202 |
| 266 | 3300025911 | Ga0207654_10174656 | Ga0207654_101746562 | 202 |
| 267 | 3300025912 | Ga0207707_10246144 | Ga0207707_102461442 | 202 |
| 268 | 3300025913 | Ga0207695_10059818 | Ga0207695_100598182 | 202 |
| 269 | 3300025913 | Ga0207695_10344407 | Ga0207695_103444072 | 202 |
| 270 | 3300025913 | Ga0207695_10556436 | Ga0207695_105564361 | 202 |
| 271 | 3300025914 | Ga0207671_10001396 | Ga0207671_1000139615 | 202 |
| 272 | 3300025914 | Ga0207671_10298476 | Ga0207671_102984762 | 202 |
| 273 | 3300025919 | Ga0207657_10257226 | Ga0207657_102572262 | 202 |
| 274 | 3300025919 | Ga0207657_10333612 | Ga0207657_103336121 | 202 |
| 275 | 3300025919 | Ga0207657_10773737 | Ga0207657_107737371 | 202 |
| 276 | 3300025920 | Ga0207649_10094148 | Ga0207649_100941482 | 202 |
| 277 | 3300025921 | Ga0207652_10041183 | Ga0207652_100411833 | 202 |
| 278 | 3300025922 | Ga0207646_10236684 | Ga0207646_102366841 | 202 |
| 279 | 3300025923 | Ga0207681_10077489 | Ga0207681_100774892 | 202 |
| 280 | 3300025924 | Ga0207694_10015293 | Ga0207694_100152933 | 202 |
| 281 | 3300025924 | Ga0207694_10187489 | Ga0207694_101874891 | 202 |
| 282 | 3300025924 | Ga0207694_10375547 | Ga0207694_103755472 | 202 |
| 283 | 3300025925 | Ga0207650_10424797 | Ga0207650_104247971 | 202 |
| 284 | 3300025926 | Ga0207659_10003908 | Ga0207659_100039084 | 202 |
| 285 | 3300025926 | Ga0207659_10106261 | Ga0207659_101062612 | 202 |
| 286 | 3300025927 | Ga0207687_10361930 | Ga0207687_103619302 | 202 |
| 287 | 3300025928 | Ga0207700_10173905 | Ga0207700_101739052 | 202 |
| 288 | 3300025929 | Ga0207664_10032555 | Ga0207664_100325551 | 202 |
| 289 | 3300025931 | Ga0207644_10009027 | Ga0207644_100090276 | 202 |
| 290 | 3300025933 | Ga0207706_10101365 | Ga0207706_101013652 | 202 |
| 291 | 3300025933 | Ga0207706_10490393 | Ga0207706_104903931 | 202 |
| 292 | 3300025934 | Ga0207686_10006099 | Ga0207686_100060994 | 202 |
| 293 | 3300025934 | Ga0207686_10139875 | Ga0207686_101398752 | 202 |
| 294 | 3300025935 | Ga0207709_10001312 | Ga0207709_1000131214 | 202 |
| 295 | 3300025935 | Ga0207709_10521937 | Ga0207709_105219371 | 202 |
| 296 | 3300025936 | Ga0207670_10021741 | Ga0207670_100217412 | 202 |
| 297 | 3300025937 | Ga0207669_10118963 | Ga0207669_101189632 | 202 |
| 298 | 3300025938 | Ga0207704_10121287 | Ga0207704_101212872 | 202 |
| 299 | 3300025938 | Ga0207704_10156688 | Ga0207704_101566882 | 202 |
| 300 | 3300025940 | Ga0207691_10047657 | Ga0207691_100476574 | 202 |
| 301 | 3300025940 | Ga0207691_10093501 | Ga0207691_100935013 | 202 |
| 302 | 3300025940 | Ga0207691_10230084 | Ga0207691_102300842 | 202 |
| 303 | 3300025941 | Ga0207711_10029564 | Ga0207711_100295642 | 202 |
| 304 | 3300025941 | Ga0207711_10126914 | Ga0207711_101269142 | 202 |
| 305 | 3300025941 | Ga0207711_10315101 | Ga0207711_103151012 | 202 |
| 306 | 3300025941 | Ga0207711_10402275 | Ga0207711_104022752 | 202 |
| 307 | 3300025941 | Ga0207711_10512895 | Ga0207711_105128952 | 202 |
| 308 | 3300025944 | Ga0207661_10118452 | Ga0207661_101184521 | 202 |
| 309 | 3300025945 | Ga0207679_10142882 | Ga0207679_101428822 | 202 |
| 310 | 3300025949 | Ga0207667_10012604 | Ga0207667_100126043 | 202 |
| 311 | 3300025949 | Ga0207667_10022683 | Ga0207667_100226834 | 202 |
| 312 | 3300025949 | Ga0207667_10084330 | Ga0207667_100843303 | 202 |
| 313 | 3300025960 | Ga0207651_10001572 | Ga0207651_100015727 | 202 |
| 314 | 3300025960 | Ga0207651_10038100 | Ga0207651_100381003 | 202 |
| 315 | 3300025961 | Ga0207712_10082355 | Ga0207712_100823552 | 202 |
| 316 | 3300025981 | Ga0207640_10410606 | Ga0207640_104106061 | 202 |
| 317 | 3300025981 | Ga0207640_11076773 | Ga0207640_110767731 | 202 |
| 318 | 3300025986 | Ga0207658_10028843 | Ga0207658_100288433 | 202 |
| 319 | 3300025986 | Ga0207658_10106749 | Ga0207658_101067493 | 202 |
| 320 | 3300025986 | Ga0207658_10168406 | Ga0207658_101684062 | 202 |
| 321 | 3300026023 | Ga0207677_10001764 | Ga0207677_1000176411 | 202 |
| 322 | 3300026035 | Ga0207703_10013263 | Ga0207703_100132633 | 202 |
| 323 | 3300026067 | Ga0207678_10168650 | Ga0207678_101686503 | 202 |
| 324 | 3300026067 | Ga0207678_10258203 | Ga0207678_102582032 | 202 |
| 325 | 3300026067 | Ga0207678_10270203 | Ga0207678_102702032 | 202 |
| 326 | 3300026075 | Ga0207708_10241634 | Ga0207708_102416341 | 202 |
| 327 | 3300026078 | Ga0207702_10374981 | Ga0207702_103749812 | 202 |
| 328 | 3300026088 | Ga0207641_10104443 | Ga0207641_101044431 | 202 |
| 329 | 3300026095 | Ga0207676_10000860 | Ga0207676_1000086015 | 202 |
| 330 | 3300026116 | Ga0207674_10043572 | Ga0207674_100435722 | 202 |
| 331 | 3300026118 | Ga0207675_100071167 | Ga0207675_1000711673 | 202 |
| 332 | 3300026121 | Ga0207683_10111828 | Ga0207683_101118283 | 202 |
| 333 | 3300026121 | Ga0207683_10130831 | Ga0207683_101308312 | 202 |
| 334 | 3300026121 | Ga0207683_10227369 | Ga0207683_102273692 | 202 |
| 335 | 3300026142 | Ga0207698_10017771 | Ga0207698_100177712 | 202 |
| 336 | 3300026142 | Ga0207698_10090604 | Ga0207698_100906043 | 202 |
| 337 | 3300026142 | Ga0207698_10240379 | Ga0207698_102403792 | 202 |
| 338 | 3300028379 | Ga0268266_10508095 | Ga0268266_105080951 | 202 |
| 339 | 3300028380 | Ga0268265_10320490 | Ga0268265_103204902 | 202 |
| 340 | 3300028381 | Ga0268264_10009846 | Ga0268264_100098467 | 202 |
| 341 | 3300028381 | Ga0268264_10053300 | Ga0268264_100533002 | 202 |
| 342 | 3300028794 | Ga0307515_10000030 | Ga0307515_10000030167 | 202 |
| 343 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034238 | 202 |
| 344 | 3300028794 | Ga0307515_10000586 | Ga0307515_1000058618 | 202 |
| 345 | 3300028794 | Ga0307515_10005841 | Ga0307515_100058413 | 202 |
| 346 | 3300028794 | Ga0307515_10076382 | Ga0307515_100763824 | 202 |
| 347 | 3300028794 | Ga0307515_10139879 | Ga0307515_101398793 | 202 |
| 348 | 3300030522 | Ga0307512_10094956 | Ga0307512_100949562 | 202 |
| 349 | 3300030522 | Ga0307512_10106244 | Ga0307512_101062442 | 202 |
| 350 | 3300030522 | Ga0307512_10309400 | Ga0307512_103094001 | 202 |
| 351 | 3300031235 | Ga0265330_10182455 | Ga0265330_101824551 | 202 |
| 352 | 3300031456 | Ga0307513_10000285 | Ga0307513_1000028569 | 202 |
| 353 | 3300031456 | Ga0307513_10008606 | Ga0307513_1000860611 | 202 |
| 354 | 3300031456 | Ga0307513_10063034 | Ga0307513_100630344 | 202 |
| 355 | 3300031456 | Ga0307513_10196324 | Ga0307513_101963243 | 202 |
| 356 | 3300031456 | Ga0307513_10414554 | Ga0307513_104145542 | 202 |
| 357 | 3300031507 | Ga0307509_10003393 | Ga0307509_100033933 | 202 |
| 358 | 3300031507 | Ga0307509_10008236 | Ga0307509_1000823611 | 202 |
| 359 | 3300031507 | Ga0307509_10105334 | Ga0307509_101053343 | 202 |
| 360 | 3300031616 | Ga0307508_10000649 | Ga0307508_1000064931 | 202 |
| 361 | 3300031649 | Ga0307514_10004105 | Ga0307514_100041051 | 202 |
| 362 | 3300031711 | Ga0265314_10122614 | Ga0265314_101226142 | 202 |
| 363 | 3300031730 | Ga0307516_10001570 | Ga0307516_1000157015 | 202 |
| 364 | 3300031730 | Ga0307516_10030714 | Ga0307516_100307144 | 202 |
| 365 | 3300031901 | Ga0307406_10534714 | Ga0307406_105347142 | 202 |
| 366 | 3300031911 | Ga0307412_10027901 | Ga0307412_100279011 | 202 |
| 367 | 3300031911 | Ga0307412_10188006 | Ga0307412_101880062 | 202 |
| 368 | 3300031911 | Ga0307412_10756877 | Ga0307412_107568771 | 202 |
| 369 | 3300032005 | Ga0307411_10318457 | Ga0307411_103184572 | 202 |
| 370 | 3300032005 | Ga0307411_10477163 | Ga0307411_104771631 | 202 |
| 371 | 3300033179 | Ga0307507_10062762 | Ga0307507_100627622 | 202 |
| 372 | 3300033180 | Ga0307510_10006302 | Ga0307510_1000630215 | 202 |
| 373 | 3300033180 | Ga0307510_10016329 | Ga0307510_100163292 | 202 |
| 374 | 3300033180 | Ga0307510_10174022 | Ga0307510_101740222 | 202 |
| 375 | 3300035410 | Ga0373924_0105601 | Ga0373924_0105601_225_839 | 202 |
| 376 | 3300035692 | Ga0373935_0207694 | Ga0373935_0207694_281_895 | 202 |
| 377 | 3300035695 | Ga0373927_0095438 | Ga0373927_0095438_664_1278 | 202 |
| 378 | 3300035695 | Ga0373927_0302962 | Ga0373927_0302962_399_1007 | 202 |
| 379 | 3300036401 | Ga0373937_0414157 | Ga0373937_0414157_492_1106 | 202 |
| 380 | 3300037068 | Ga0373925_0287906 | Ga0373925_0287906_368_982 | 202 |
| 381 | 3300037312 | Ga0395899_0002908 | Ga0395899_0002908_6131_6739 | 202 |
| 382 | 3300037418 | Ga0395900_0070739 | Ga0395900_0070739_2404_3012 | 202 |
| 383 | 3300037466 | Ga0395898_0005675 | Ga0395898_0005675_11147_11755 | 202 |
| 384 | 3300037471 | Ga0395905_0000235 | Ga0395905_0000235_66181_66789 | 202 |
| 385 | 3300037471 | Ga0395905_0081796 | Ga0395905_0081796_1051_1659 | 202 |
| 386 | 3300037471 | Ga0395905_0487319 | Ga0395905_0487319_504_1112 | 202 |
| 387 | 3300038443 | Ga0395901_0090756 | Ga0395901_0090756_1916_2524 | 202 |
| 388 | 3300038443 | Ga0395901_0484732 | Ga0395901_0484732_600_1208 | 202 |
| 389 | 3300039437 | Ga0436365_1383684 | Ga0436365_1383684_525_1139 | 202 |
| 390 | 3300041404 | Ga0439436_0002169 | Ga0439436_0002169_3874_4563 | 202 |
| 391 | 3300041404 | Ga0439436_0115208 | Ga0439436_0115208_49_657 | 202 |
| 392 | 3300041407 | Ga0439447_005090 | Ga0439447_005090_2356_3045 | 202 |
| 393 | 3300041411 | Ga0439466_0017929 | Ga0439466_0017929_746_1435 | 202 |
| 394 | 3300041413 | Ga0439465_0000906 | Ga0439465_0000906_2017_2706 | 202 |
| 395 | 3300041452 | Ga0451793_0890613 | Ga0451793_0890613_408_1016 | 202 |
| 396 | 3300041459 | Ga0451800_0270333 | Ga0451800_0270333_331_939 | 202 |
| 397 | 3300041459 | Ga0451800_1206011 | Ga0451800_1206011_305_1006 | 202 |
| 398 | 3300041460 | Ga0451802_1353732 | Ga0451802_1353732_934_1542 | 202 |
| 399 | 3300041486 | Ga0451807_0257418 | Ga0451807_0257418_479_1087 | 202 |
| 400 | 3300041496 | Ga0451839_0670304 | Ga0451839_0670304_83_691 | 202 |
| 401 | 3300041507 | Ga0451851_1239324 | Ga0451851_1239324_483_1091 | 202 |
| 402 | 3300041509 | Ga0451843_1371007 | Ga0451843_1371007_503_1111 | 202 |
| 403 | 3300041511 | Ga0451855_0272045 | Ga0451855_0272045_162_770 | 202 |
| 404 | 3300041512 | Ga0451853_0418287 | Ga0451853_0418287_1476_2084 | 202 |
| 405 | 3300041997 | Ga0439431_0006328 | Ga0439431_0006328_1364_2053 | 202 |
| 406 | 3300041999 | Ga0439433_0009672 | Ga0439433_0009672_204_893 | 202 |
| 407 | 3300042004 | Ga0439445_0004467 | Ga0439445_0004467_1310_1999 | 202 |
| 408 | 3300042006 | Ga0439432_005173 | Ga0439432_005173_580_1269 | 202 |
| 409 | 3300042007 | Ga0439449_0009320 | Ga0439449_0009320_2387_3076 | 202 |
| 410 | 3300042010 | Ga0439452_015169 | Ga0439452_015169_121_810 | 202 |
| 411 | 3300042015 | Ga0439462_0008844 | Ga0439462_0008844_1311_2000 | 202 |
| 412 | 3300042876 | Ga0451577_0049885 | Ga0451577_0049885_465_1094 | 202 |
| 413 | 3300044656 | Ga0466969_0011806 | Ga0466969_0011806_1373_1981 | 202 |
| 414 | 3300044658 | Ga0466972_0027448 | Ga0466972_0027448_519_1127 | 202 |
| 415 | 3300044683 | Ga0466965_0008961 | Ga0466965_0008961_3565_4173 | 202 |
| 416 | 3300044684 | Ga0466966_0018209 | Ga0466966_0018209_495_1103 | 202 |
| 417 | 3300044693 | Ga0466961_0122698 | Ga0466961_0122698_939_1547 | 202 |
| 418 | 3300044706 | Ga0466964_0134817 | Ga0466964_0134817_399_1007 | 202 |
| 419 | 3300044712 | Ga0453684_0200783 | Ga0453684_0200783_839_1447 | 202 |
| 420 | 3300044765 | Ga0466970_0096814 | Ga0466970_0096814_21_629 | 202 |
| 421 | 3300044842 | Ga0466957_0293428 | Ga0466957_0293428_88_696 | 202 |
| 422 | 3300044901 | Ga0466960_0003291 | Ga0466960_0003291_825_1433 | 202 |
| 423 | 3300045049 | Ga0466959_0038422 | Ga0466959_0038422_1495_2103 | 202 |
| 424 | 3300045051 | Ga0451576_0002187 | Ga0451576_0002187_29135_29743 | 202 |
| 425 | 3300046460 | Ga0495638_0050605 | Ga0495638_0050605_154_801 | 202 |
| 426 | 3300046500 | Ga0495596_0214867 | Ga0495596_0214867_67_675 | 202 |
| 427 | 3300046512 | Ga0495610_0024551 | Ga0495610_0024551_1255_1902 | 202 |
| 428 | 3300046512 | Ga0495610_0141450 | Ga0495610_0141450_82_690 | 202 |
| 429 | 3300046513 | Ga0495616_0014367 | Ga0495616_0014367_162_809 | 202 |
| 430 | 3300046515 | Ga0495620_0076295 | Ga0495620_0076295_506_1219 | 202 |
| 431 | 3300046518 | Ga0495631_0000901 | Ga0495631_0000901_115_762 | 202 |
| 432 | 3300046520 | Ga0495637_0008435 | Ga0495637_0008435_2982_3695 | 202 |
| 433 | 3300046522 | Ga0495643_0018867 | Ga0495643_0018867_3360_3968 | 202 |
| 434 | 3300046524 | Ga0495648_0061025 | Ga0495648_0061025_1378_1986 | 202 |
| 435 | 3300046524 | Ga0495648_0107782 | Ga0495648_0107782_305_1057 | 202 |
| 436 | 3300046525 | Ga0495663_0049349 | Ga0495663_0049349_460_1068 | 202 |
| 437 | 3300046528 | Ga0495642_0060565 | Ga0495642_0060565_254_862 | 202 |
| 438 | 3300046530 | Ga0495654_0008561 | Ga0495654_0008561_3676_4323 | 202 |
| 439 | 3300046530 | Ga0495654_0171223 | Ga0495654_0171223_86_694 | 202 |
| 440 | 3300046530 | Ga0495654_0188355 | Ga0495654_0188355_10_624 | 202 |
| 441 | 3300046537 | Ga0495598_0011021 | Ga0495598_0011021_477_1085 | 202 |
| 442 | 3300046537 | Ga0495598_0020011 | Ga0495598_0020011_536_1144 | 202 |
| 443 | 3300046539 | Ga0495621_0001043 | Ga0495621_0001043_1244_1891 | 202 |
| 444 | 3300046539 | Ga0495621_0038648 | Ga0495621_0038648_684_1292 | 202 |
| 445 | 3300046539 | Ga0495621_0056020 | Ga0495621_0056020_25_633 | 202 |
| 446 | 3300046557 | Ga0495622_0131016 | Ga0495622_0131016_225_872 | 202 |
| 447 | 3300046558 | Ga0495633_0087490 | Ga0495633_0087490_398_1063 | 202 |
| 448 | 3300046615 | Ga0495656_0000270 | Ga0495656_0000270_14026_14691 | 202 |
| 449 | 3300046660 | Ga0495625_0001836 | Ga0495625_0001836_15512_16120 | 202 |
| 450 | 3300046660 | Ga0495625_0065474 | Ga0495625_0065474_1656_2303 | 202 |
| 451 | 3300046674 | Ga0495588_0119051 | Ga0495588_0119051_731_1339 | 202 |
| 452 | 3300046674 | Ga0495588_0123935 | Ga0495588_0123935_160_807 | 202 |
| 453 | 3300046683 | Ga0495658_0012766 | Ga0495658_0012766_549_1163 | 202 |
| 454 | 3300046689 | Ga0495613_0515961 | Ga0495613_0515961_72_686 | 202 |
| 455 | 3300046691 | Ga0495670_0125644 | Ga0495670_0125644_574_1221 | 202 |
| 456 | 3300046692 | Ga0495671_0001980 | Ga0495671_0001980_55_768 | 202 |
| 457 | 3300047321 | Ga0495676_0125626 | Ga0495676_0125626_587_1234 | 202 |
| 458 | 3300047443 | Ga0495687_016741 | Ga0495687_016741_2928_3536 | 202 |
| 459 | 3300047471 | Ga0495684_0110503 | Ga0495684_0110503_1194_1808 | 202 |
| 460 | 3300047472 | Ga0495686_0001547 | Ga0495686_0001547_16691_17302 | 202 |
| 461 | 3300048090 | Ga0495615_0001036 | Ga0495615_0001036_390_1055 | 202 |
| 462 | 3300048903 | Ga0496100_0079972 | Ga0496100_0079972_1571_2179 | 202 |
| 463 | 3300048905 | Ga0496102_0028401 | Ga0496102_0028401_921_1529 | 202 |
| 464 | 3300048905 | Ga0496102_0070707 | Ga0496102_0070707_2336_3040 | 202 |
| 465 | 3300048905 | Ga0496102_0415157 | Ga0496102_0415157_548_1156 | 202 |
| 466 | 3300048906 | Ga0496103_0026318 | Ga0496103_0026318_208_915 | 202 |
| 467 | 3300048908 | Ga0496105_0366479 | Ga0496105_0366479_63_671 | 202 |
| 468 | 3300048909 | Ga0496106_0117354 | Ga0496106_0117354_1446_2054 | 202 |
| 469 | 3300048909 | Ga0496106_0288833 | Ga0496106_0288833_442_1050 | 202 |
| 470 | 3300048909 | Ga0496106_0309759 | Ga0496106_0309759_592_1206 | 202 |
| 471 | 3300048910 | Ga0496107_0017711 | Ga0496107_0017711_1057_1764 | 202 |
| 472 | 3300048911 | Ga0496108_0015466 | Ga0496108_0015466_1460_2068 | 202 |
| 473 | 3300048913 | Ga0496110_1024184 | Ga0496110_1024184_26_634 | 202 |
| 474 | 3300048916 | Ga0496113_0229364 | Ga0496113_0229364_261_875 | 202 |
| 475 | 3300048916 | Ga0496113_0328510 | Ga0496113_0328510_425_1033 | 202 |
| 476 | 3300048917 | Ga0496114_0106743 | Ga0496114_0106743_1250_1858 | 202 |
| 477 | 3300048917 | Ga0496114_0627112 | Ga0496114_0627112_12_677 | 202 |
| 478 | 3300048919 | Ga0496116_0011687 | Ga0496116_0011687_4282_4890 | 202 |
| 479 | 3300048920 | Ga0496117_0075576 | Ga0496117_0075576_854_1462 | 202 |
| 480 | 3300048921 | Ga0496118_0035486 | Ga0496118_0035486_1315_1923 | 202 |
| 481 | 3300048921 | Ga0496118_0234296 | Ga0496118_0234296_438_1046 | 202 |
| 482 | 3300048922 | Ga0496119_0048469 | Ga0496119_0048469_151_798 | 202 |
| 483 | 3300048922 | Ga0496119_0197157 | Ga0496119_0197157_422_1030 | 202 |
| 484 | 3300048925 | Ga0496122_0359744 | Ga0496122_0359744_131_739 | 202 |
| 485 | 3300048927 | Ga0496124_0121416 | Ga0496124_0121416_570_1178 | 202 |
| 486 | 3300048928 | Ga0496125_0060933 | Ga0496125_0060933_1070_1678 | 202 |
| 487 | 3300048928 | Ga0496125_0144386 | Ga0496125_0144386_412_1020 | 202 |
| 488 | 3300048929 | Ga0496126_0381431 | Ga0496126_0381431_86_733 | 202 |
| 489 | 3300049569 | Ga0501032_0235166 | Ga0501032_0235166_400_1008 | 202 |
| 490 | 3300049570 | Ga0501033_0036647 | Ga0501033_0036647_2590_3198 | 202 |
| 491 | 3300049571 | Ga0501034_0171821 | Ga0501034_0171821_501_1109 | 202 |
| 492 | 3300049572 | Ga0501036_0084645 | Ga0501036_0084645_1232_1840 | 202 |
| 493 | 3300049573 | Ga0501037_0288251 | Ga0501037_0288251_373_981 | 202 |
| 494 | 3300049581 | Ga0501047_0002291 | Ga0501047_0002291_4904_5512 | 202 |
| 495 | 3300049581 | Ga0501047_0052645 | Ga0501047_0052645_1716_2324 | 202 |
| 496 | 3300049585 | Ga0501069_0000781 | Ga0501069_0000781_4977_5585 | 202 |
| 497 | 3300049586 | Ga0501070_0000645 | Ga0501070_0000645_860_1468 | 202 |
| 498 | 3300049589 | Ga0501073_0000370 | Ga0501073_0000370_22887_23495 | 202 |
| 499 | 3300049589 | Ga0501073_0064188 | Ga0501073_0064188_723_1331 | 202 |
| 500 | 3300049590 | Ga0501074_0000213 | Ga0501074_0000213_3490_4098 | 202 |
| 501 | 3300049592 | Ga0501076_0520650 | Ga0501076_0520650_20_628 | 202 |
| 502 | 3300049653 | Ga0501206_032265 | Ga0501206_032265_89_769 | 202 |
| 503 | 3300049661 | Ga0501217_048164 | Ga0501217_048164_243_851 | 202 |
| 504 | 3300049672 | Ga0501239_012621 | Ga0501239_012621_52_732 | 202 |
| 505 | 3300049683 | Ga0501253_005411 | Ga0501253_005411_900_1580 | 202 |
| 506 | 3300049705 | Ga0501225_0066790 | Ga0501225_0066790_363_971 | 202 |
| 507 | 3300049741 | Ga0501079_0002160 | Ga0501079_0002160_3645_4253 | 202 |
| 508 | 3300049742 | Ga0501080_0001759 | Ga0501080_0001759_5637_6245 | 202 |
| 509 | 3300049742 | Ga0501080_0021746 | Ga0501080_0021746_2053_2661 | 202 |
| 510 | 3300049759 | Ga0501262_000465 | Ga0501262_000465_3826_4506 | 202 |
| 511 | 3300049762 | Ga0501265_000251 | Ga0501265_000251_1607_2287 | 202 |
| 512 | 3300049822 | Ga0501035_0542388 | Ga0501035_0542388_326_934 | 202 |
| 513 | 3300049823 | Ga0501044_0044663 | Ga0501044_0044663_16_624 | 202 |
| 514 | 3300049823 | Ga0501044_0172309 | Ga0501044_0172309_1249_1857 | 202 |
| 515 | 3300049823 | Ga0501044_0399064 | Ga0501044_0399064_387_995 | 202 |
| 516 | 3300050490 | nmdc:mga03n38_41568_c1 | nmdc:mga03n38_41568_c1_446_1054 | 202 |
| 517 | 3300050493 | nmdc:mga0k408_168015_c1 | nmdc:mga0k408_168015_c1_106_714 | 202 |
| 518 | 3300050493 | nmdc:mga0k408_172140_c1 | nmdc:mga0k408_172140_c1_49_657 | 202 |
| 519 | 3300050493 | nmdc:mga0k408_9944_c1 | nmdc:mga0k408_9944_c1_3286_3894 | 202 |
| 520 | 3300050494 | nmdc:mga06z11_50928_c1 | nmdc:mga06z11_50928_c1_164_772 | 202 |
| 521 | 3300050496 | nmdc:mga07m45_103524_c1 | nmdc:mga07m45_103524_c1_707_1315 | 202 |
| 522 | 3300050496 | nmdc:mga07m45_19542_c1 | nmdc:mga07m45_19542_c1_1859_2467 | 202 |
| 523 | 3300050496 | nmdc:mga07m45_199272_c1 | nmdc:mga07m45_199272_c1_144_752 | 202 |
| 524 | 3300050496 | nmdc:mga07m45_205776_c1 | nmdc:mga07m45_205776_c1_55_663 | 202 |
| 525 | 3300050507 | nmdc:mga05p37_485668_c1 | nmdc:mga05p37_485668_c1_437_1045 | 202 |
| 526 | 3300050508 | nmdc:mga09592_187549_c1 | nmdc:mga09592_187549_c1_1081_1689 | 202 |
| 527 | 3300050509 | nmdc:mga0qj67_613237_c1 | nmdc:mga0qj67_613237_c1_130_738 | 202 |
| 528 | 3300050512 | nmdc:mga0n895_159993_c1 | nmdc:mga0n895_159993_c1_1227_1835 | 202 |
| 529 | 3300050514 | nmdc:mga08x19_2660_c1 | nmdc:mga08x19_2660_c1_2072_2686 | 202 |
| 530 | 3300053079 | Ga0500610_0005030 | Ga0500610_0005030_2602_3315 | 202 |
| 531 | 3300053079 | Ga0500610_0105157 | Ga0500610_0105157_39_647 | 202 |
| 532 | 3300053085 | Ga0495619_0065047 | Ga0495619_0065047_1804_2418 | 202 |
| 533 | 3300053087 | Ga0500643_005905 | Ga0500643_005905_4424_5071 | 202 |
| 534 | 3300053087 | Ga0500643_060048 | Ga0500643_060048_106_714 | 202 |
| 535 | 3300053088 | Ga0500644_0023398 | Ga0500644_0023398_270_878 | 202 |
| 536 | 3300053088 | Ga0500644_0055632 | Ga0500644_0055632_251_859 | 202 |
| 537 | 3300053091 | Ga0500647_0090296 | Ga0500647_0090296_234_842 | 202 |
| 538 | 3300053093 | Ga0500651_0000082 | Ga0500651_0000082_25550_26197 | 202 |
| 539 | 3300053093 | Ga0500651_0075438 | Ga0500651_0075438_1314_1922 | 202 |
| 540 | 3300053093 | Ga0500651_0140949 | Ga0500651_0140949_389_997 | 202 |
| 541 | 3300053093 | Ga0500651_0200741 | Ga0500651_0200741_41_691 | 202 |
| 542 | 3300053108 | Ga0500562_021120 | Ga0500562_021120_958_1605 | 202 |
| 543 | 3300053108 | Ga0500562_128221 | Ga0500562_128221_60_668 | 202 |
| 544 | 3300053110 | Ga0500571_000152 | Ga0500571_000152_17467_18114 | 202 |
| 545 | 3300053116 | Ga0500592_010925 | Ga0500592_010925_195_842 | 202 |
| 546 | 3300053117 | Ga0500593_000664 | Ga0500593_000664_54_767 | 202 |
| 547 | 3300053118 | Ga0500594_0004880 | Ga0500594_0004880_1920_2528 | 202 |
| 548 | 3300053120 | Ga0500597_093856 | Ga0500597_093856_136_783 | 202 |
| 549 | 3300053121 | Ga0500607_000049 | Ga0500607_000049_62459_63172 | 202 |
| 550 | 3300053125 | Ga0500618_035638 | Ga0500618_035638_485_1132 | 202 |
| 551 | 3300053128 | Ga0500626_031951 | Ga0500626_031951_1424_2071 | 202 |
| 552 | 3300053133 | Ga0500655_000668 | Ga0500655_000668_5990_6637 | 202 |
| 553 | 3300053133 | Ga0500655_020210 | Ga0500655_020210_111_719 | 202 |
| 554 | 3300053134 | Ga0500658_0018781 | Ga0500658_0018781_739_1347 | 202 |
| 555 | 3300053136 | Ga0500559_0000021 | Ga0500559_0000021_98770_99378 | 202 |
| 556 | 3300053136 | Ga0500559_0006291 | Ga0500559_0006291_1475_2122 | 202 |
| 557 | 3300053137 | Ga0500561_0012355 | Ga0500561_0012355_363_1010 | 202 |
| 558 | 3300053138 | Ga0500564_002728 | Ga0500564_002728_57_704 | 202 |
| 559 | 3300053139 | Ga0500568_0003226 | Ga0500568_0003226_2090_2737 | 202 |
| 560 | 3300053151 | Ga0500604_0017693 | Ga0500604_0017693_36_683 | 202 |
| 561 | 3300053153 | Ga0500616_0011758 | Ga0500616_0011758_3477_4124 | 202 |
| 562 | 3300053156 | Ga0500622_0001453 | Ga0500622_0001453_4462_5070 | 202 |
| 563 | 3300053161 | Ga0500634_0041585 | Ga0500634_0041585_1656_2369 | 202 |
| 564 | 3300053161 | Ga0500634_0067724 | Ga0500634_0067724_592_1239 | 202 |
| 565 | 3300053162 | Ga0500638_039409 | Ga0500638_039409_116_763 | 202 |
| 566 | 3300053177 | Ga0500636_0019501 | Ga0500636_0019501_1066_1713 | 202 |
| 567 | 3300053177 | Ga0500636_0156302 | Ga0500636_0156302_253_861 | 202 |
| 568 | 3300053724 | Ga0500570_133490 | Ga0500570_133490_132_740 | 202 |
| 569 | 3300053730 | Ga0500645_001446 | Ga0500645_001446_1724_2332 | 202 |
| 570 | 3300053734 | Ga0500565_016503 | Ga0500565_016503_114_761 | 202 |
| 571 | 3300053739 | Ga0500587_001719 | Ga0500587_001719_1290_1898 | 202 |
| 572 | 3300060353 | Ga0501082_0016781 | Ga0501082_0016781_1729_2337 | 202 |
| 573 | 3300061719 | Ga0466962_0332047 | Ga0466962_0332047_125_733 | 202 |
| 574 | iso_pu_bacteria | 2599185214 | 2599626466 | 202 |
| 575 | iso_pu_bacteria | 2599185226 | 2599677081 | 202 |
| 576 | iso_pu_bacteria | 2599185227 | 2599682167 | 202 |
| 577 | iso_pu_bacteria | 2599185229 | 2599695818 | 202 |
| 578 | iso_pu_bacteria | 2885192300 | 2885194408 | 202 |
| 579 | iso_pu_bacteria | 2928070936 | 2928075437 | 202 |
| 580 | iso_pu_bacteria | 2945909444 | 2945909702 | 202 |
| 581 | iso_pu_bacteria | 2945984333 | 2945988329 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8qto-assembly1.cif.gz_A-2 | crystal structure of holo-l28h-fnr of a. fischeri | 0.8694 | 16 | 199 |
| 5j48-assembly1.cif.gz_A | pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp | 0.8663 | 11 | 127 |
| 5j48-assembly2.cif.gz_B | pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp | 0.8633 | 11 | 126 |
| 5cvr-assembly1.cif.gz_A-2 | crystal structure of fnr of a. fischeri in a partially degraded form | 0.8603 | 39 | 199 |
| 4cyd-assembly2.cif.gz_C | glxr bound to camp | 0.8563 | 13 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i54C01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8911 | 31 | 157 | 2.60.120.10 |
| 2gauA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8893 | 16 | 154 | 2.60.120.10 |
| 4i2oB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8846 | 38 | 154 | 2.60.120.10 |
| af_P9WIY7_12_147_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8832 | 13 | 146 | 2.60.120.10 |
| 5cvrA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8803 | 39 | 154 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A109CEU4-F1-model_v4 | deleted | 0.9993 | 1 | 202 |
|
| AF-A0A127PBF5-F1-model_v4 | Cyclic nucleotide-binding domain protein | 0.9984 | 39 | 190 |
|
| AF-A0A127QZ33-F1-model_v4 | Cyclic nucleotide-binding domain protein | 0.9966 | 1 | 202 |
|
| AF-A0A1F4GZX6-F1-model_v4 | Cyclic nucleotide-binding protein | 0.9954 | 18 | 199 |
|
| AF-A0A109CEU4-F1-model_v4 | deleted | 0.9944 | 1 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar