F465997
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 580 | 285 | 572 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0055188|Ga0495686_0055188_1296_2222 |
| Length | 308 |
| Sequence | LVLADTAPDADYGPSVRTDSAPCGSIFQNISLARRSNGALDPPVRQRKCQPMKISIEAWLDYEFDHPTDVLLQVEAAMIPEQIVNGYIDITQGEHFARVPAHDSIGDRLWVRIQGRLVVDYRATVIVDRVLADVRTLPAVPPHQLPGETVQYLMPSRYCPSDQFQTFVDAEFGSLQGGARVAALRDWVEQSFAYVPGSSSGDTTALDTFVKRQGVCRDYAHVIITLVRASGIPARIASVYALGVEPQDFHAVAEVFLHGAWHLVDATGMATQGGMAKIGVGRDAADVAFLTAYGAARMNAQAVSVWPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 5 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 6 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 7 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 8 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 189 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 238 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 250 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 252 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 258 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 259 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 260 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 262 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 264 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 265 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 268 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 271 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 272 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 280 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 281 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 282 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 283 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 284 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 285 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 0 |
| Isolates | 1.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.38 |
| Nodule | 0.52 |
| Rhizoplane | 1.9 |
| Rhizosphere | 63.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3948926 | 2162886007 | Bacteria | 15742 |
| 2 | JGI24740J21852_10054649 | 3300001979 | Bacteria | 1126 |
| 3 | JGI24737J22298_10029377 | 3300001990 | Bacteria | 1724 |
| 4 | JGI24743J22301_10008524 | 3300001991 | Bacteria | 1799 |
| 5 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 6 | rootL2_10085789 | 3300003322 | Bacteria | 4954 |
| 7 | rootL2_10156435 | 3300003322 | Bacteria | 2712 |
| 8 | rootL2_10275880 | 3300003322 | Bacteria | 1029 |
| 9 | Ga0055525_1000037 | 3300003759 | Bacteria | 297990 |
| 10 | Ga0055542_1000293 | 3300003762 | Bacteria | 55815 |
| 11 | Ga0055529_1000034 | 3300003763 | Bacteria | 244657 |
| 12 | Ga0055526_1007131 | 3300003771 | Bacteria | 5892 |
| 13 | Ga0055537_1000848 | 3300003773 | Bacteria | 14862 |
| 14 | Ga0055530_10008155 | 3300003791 | Bacteria | 4248 |
| 15 | Ga0055540_1000185 | 3300003792 | Bacteria | 60356 |
| 16 | Ga0055531_10000088 | 3300003794 | Bacteria | 100973 |
| 17 | Ga0065704_10003847 | 3300005289 | Bacteria | 5648 |
| 18 | Ga0065704_10070184 | 3300005289 | Bacteria | 119655 |
| 19 | Ga0065704_10073345 | 3300005289 | Bacteria | 7273 |
| 20 | Ga0065707_10094490 | 3300005295 | Bacteria | 3491 |
| 21 | Ga0065707_10106588 | 3300005295 | Bacteria | 2590 |
| 22 | Ga0070658_10001641 | 3300005327 | Bacteria | 18905 |
| 23 | Ga0070658_10007930 | 3300005327 | Bacteria | 8550 |
| 24 | Ga0070658_10125667 | 3300005327 | Bacteria | 2134 |
| 25 | Ga0070676_10000161 | 3300005328 | Bacteria | 27014 |
| 26 | Ga0070676_10253407 | 3300005328 | Bacteria | 1175 |
| 27 | Ga0070670_100066087 | 3300005331 | Bacteria | 3102 |
| 28 | Ga0070670_100291266 | 3300005331 | Unclassified | 1427 |
| 29 | Ga0068869_100001393 | 3300005334 | Bacteria | 14279 |
| 30 | Ga0068869_100428710 | 3300005334 | Bacteria | 1092 |
| 31 | Ga0070666_10025030 | 3300005335 | Bacteria | 3890 |
| 32 | Ga0070666_10037896 | 3300005335 | Unclassified | 3207 |
| 33 | Ga0070682_100109043 | 3300005337 | Bacteria | 1842 |
| 34 | Ga0068868_100000057 | 3300005338 | Bacteria | 62946 |
| 35 | Ga0070660_100036682 | 3300005339 | Bacteria | 3714 |
| 36 | Ga0070660_100493562 | 3300005339 | Unclassified | 1018 |
| 37 | Ga0070661_100073444 | 3300005344 | Bacteria | 2518 |
| 38 | Ga0070668_100000045 | 3300005347 | Bacteria | 77362 |
| 39 | Ga0070668_100000058 | 3300005347 | Bacteria | 69744 |
| 40 | Ga0070668_100000249 | 3300005347 | Bacteria | 35701 |
| 41 | Ga0070668_100010521 | 3300005347 | Bacteria | 6878 |
| 42 | Ga0070668_100012728 | 3300005347 | Bacteria | 6261 |
| 43 | Ga0070669_100002467 | 3300005353 | Bacteria | 13394 |
| 44 | Ga0070669_100060051 | 3300005353 | Bacteria | 2792 |
| 45 | Ga0070669_100110160 | 3300005353 | Unclassified | 2088 |
| 46 | Ga0070675_100006637 | 3300005354 | Bacteria | 8896 |
| 47 | Ga0070671_100002659 | 3300005355 | Bacteria | 13844 |
| 48 | Ga0070671_100002701 | 3300005355 | Bacteria | 13763 |
| 49 | Ga0070671_100004503 | 3300005355 | Bacteria | 11032 |
| 50 | Ga0070671_100043304 | 3300005355 | Bacteria | 3741 |
| 51 | Ga0070671_100059782 | 3300005355 | Bacteria | 3172 |
| 52 | Ga0070671_100140177 | 3300005355 | Bacteria | 2040 |
| 53 | Ga0070671_100166863 | 3300005355 | Bacteria | 1862 |
| 54 | Ga0070673_100000005 | 3300005364 | Bacteria | 193513 |
| 55 | Ga0070659_100071834 | 3300005366 | Bacteria | 2753 |
| 56 | Ga0070667_100000045 | 3300005367 | Bacteria | 164821 |
| 57 | Ga0070667_100000104 | 3300005367 | Bacteria | 106938 |
| 58 | Ga0070667_100000193 | 3300005367 | Bacteria | 72859 |
| 59 | Ga0070667_100008960 | 3300005367 | Bacteria | 8284 |
| 60 | Ga0070667_100026707 | 3300005367 | Bacteria | 4803 |
| 61 | Ga0070667_100094786 | 3300005367 | Bacteria | 2572 |
| 62 | Ga0070705_100075444 | 3300005440 | Bacteria | 2053 |
| 63 | Ga0070663_100624669 | 3300005455 | Bacteria | 908 |
| 64 | Ga0070678_100094904 | 3300005456 | Bacteria | 2297 |
| 65 | Ga0070662_100037104 | 3300005457 | Bacteria | 3453 |
| 66 | Ga0070662_100072728 | 3300005457 | Bacteria | 2539 |
| 67 | Ga0070662_100151415 | 3300005457 | Bacteria | 1806 |
| 68 | Ga0068867_100000071 | 3300005459 | Bacteria | 61808 |
| 69 | Ga0070685_10001123 | 3300005466 | Bacteria | 14320 |
| 70 | Ga0068853_100001233 | 3300005539 | Bacteria | 18261 |
| 71 | Ga0068853_100032792 | 3300005539 | Bacteria | 4403 |
| 72 | Ga0068853_100161259 | 3300005539 | Bacteria | 2024 |
| 73 | Ga0070672_100065513 | 3300005543 | Bacteria | 2874 |
| 74 | Ga0070686_100066195 | 3300005544 | Bacteria | 2349 |
| 75 | Ga0070665_100000541 | 3300005548 | Bacteria | 53057 |
| 76 | Ga0070665_100003938 | 3300005548 | Bacteria | 15667 |
| 77 | Ga0070665_100549426 | 3300005548 | Bacteria | 1167 |
| 78 | Ga0068855_100000921 | 3300005563 | Bacteria | 36597 |
| 79 | Ga0068855_100138187 | 3300005563 | Bacteria | 2779 |
| 80 | Ga0068855_100394070 | 3300005563 | Bacteria | 1518 |
| 81 | Ga0068855_100437857 | 3300005563 | Bacteria | 1428 |
| 82 | Ga0070664_100402209 | 3300005564 | Bacteria | 1252 |
| 83 | Ga0068857_100013403 | 3300005577 | Bacteria | 7141 |
| 84 | Ga0068854_100022638 | 3300005578 | Bacteria | 4286 |
| 85 | Ga0068856_100305906 | 3300005614 | Bacteria | 1608 |
| 86 | Ga0068852_100303535 | 3300005616 | Bacteria | 1546 |
| 87 | Ga0068852_100532285 | 3300005616 | Bacteria | 1173 |
| 88 | Ga0068859_100022780 | 3300005617 | Bacteria | 6280 |
| 89 | Ga0068859_100112991 | 3300005617 | Plasmid | 2780 |
| 90 | Ga0068864_100035448 | 3300005618 | Plasmid | 4248 |
| 91 | Ga0068861_100000074 | 3300005719 | Bacteria | 48480 |
| 92 | Ga0068851_10061951 | 3300005834 | Bacteria | 1918 |
| 93 | Ga0068870_10245592 | 3300005840 | Bacteria | 1107 |
| 94 | Ga0068863_100000012 | 3300005841 | Bacteria | 229774 |
| 95 | Ga0068863_100000625 | 3300005841 | Bacteria | 35818 |
| 96 | Ga0068863_100001079 | 3300005841 | Bacteria | 27286 |
| 97 | Ga0068863_100022543 | 3300005841 | Bacteria | 6013 |
| 98 | Ga0068863_100038067 | 3300005841 | Bacteria | 4577 |
| 99 | Ga0068863_100056547 | 3300005841 | Bacteria | 3714 |
| 100 | Ga0068858_100013007 | 3300005842 | Bacteria | 7848 |
| 101 | Ga0068858_100016988 | 3300005842 | Bacteria | 6832 |
| 102 | Ga0068860_100000073 | 3300005843 | Bacteria | 173235 |
| 103 | Ga0068860_100000197 | 3300005843 | Bacteria | 96240 |
| 104 | Ga0068860_100003204 | 3300005843 | Bacteria | 16891 |
| 105 | Ga0068860_100006651 | 3300005843 | Bacteria | 11609 |
| 106 | Ga0068860_100007022 | 3300005843 | Bacteria | 11276 |
| 107 | Ga0068860_100024116 | 3300005843 | Bacteria | 5881 |
| 108 | Ga0068860_100030305 | 3300005843 | Bacteria | 5204 |
| 109 | Ga0068860_100107503 | 3300005843 | Bacteria | 2666 |
| 110 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 111 | Ga0068862_100000201 | 3300005844 | Bacteria | 66112 |
| 112 | Ga0068862_100002137 | 3300005844 | Bacteria | 17805 |
| 113 | Ga0068862_100006298 | 3300005844 | Bacteria | 9872 |
| 114 | Ga0068862_100020190 | 3300005844 | Bacteria | 5564 |
| 115 | Ga0068862_100031066 | 3300005844 | Bacteria | 4505 |
| 116 | Ga0068862_100160283 | 3300005844 | Bacteria | 2007 |
| 117 | Ga0081539_10007629 | 3300005985 | Bacteria | 9762 |
| 118 | Ga0075365_10045743 | 3300006038 | Bacteria | 2872 |
| 119 | Ga0075368_10000038 | 3300006042 | Bacteria | 30456 |
| 120 | Ga0075363_100000828 | 3300006048 | Bacteria | 10734 |
| 121 | Ga0075363_100018683 | 3300006048 | Bacteria | 3458 |
| 122 | Ga0075364_10010542 | 3300006051 | Bacteria | 5587 |
| 123 | Ga0075364_10010580 | 3300006051 | Bacteria | 5580 |
| 124 | Ga0075364_10125446 | 3300006051 | Bacteria | 1721 |
| 125 | Ga0075364_10215639 | 3300006051 | Bacteria | 1302 |
| 126 | Ga0075432_10026257 | 3300006058 | Bacteria | 2000 |
| 127 | Ga0075362_10000001 | 3300006177 | Bacteria | 215983 |
| 128 | Ga0075362_10002493 | 3300006177 | Bacteria | 6195 |
| 129 | Ga0075362_10010974 | 3300006177 | Bacteria | 3557 |
| 130 | Ga0075367_10022284 | 3300006178 | Bacteria | 3551 |
| 131 | Ga0075367_10162715 | 3300006178 | Unclassified | 1388 |
| 132 | Ga0075369_10001326 | 3300006186 | Bacteria | 8417 |
| 133 | Ga0075369_10002761 | 3300006186 | Bacteria | 6303 |
| 134 | Ga0075366_10000093 | 3300006195 | Bacteria | 35940 |
| 135 | Ga0075366_10001944 | 3300006195 | Bacteria | 10448 |
| 136 | Ga0075366_10016071 | 3300006195 | Bacteria | 4297 |
| 137 | Ga0075366_10023184 | 3300006195 | Bacteria | 3616 |
| 138 | Ga0075366_10095731 | 3300006195 | Bacteria | 1780 |
| 139 | Ga0075366_10159815 | 3300006195 | Bacteria | 1365 |
| 140 | Ga0075366_10198712 | 3300006195 | Bacteria | 1219 |
| 141 | Ga0097621_100055655 | 3300006237 | Bacteria | 3231 |
| 142 | Ga0075370_10000028 | 3300006353 | Bacteria | 50628 |
| 143 | Ga0075370_10021194 | 3300006353 | Bacteria | 3561 |
| 144 | Ga0075370_10089537 | 3300006353 | Bacteria | 1774 |
| 145 | Ga0075370_10122614 | 3300006353 | Bacteria | 1514 |
| 146 | Ga0075370_10169533 | 3300006353 | Bacteria | 1283 |
| 147 | Ga0068865_100000032 | 3300006881 | Bacteria | 88205 |
| 148 | Ga0097620_100002108 | 3300006931 | Bacteria | 20252 |
| 149 | Ga0097620_100022780 | 3300006931 | Bacteria | 6280 |
| 150 | Ga0097620_100112995 | 3300006931 | Plasmid | 2780 |
| 151 | Ga0079104_1018747 | 3300006946 | Bacteria | 1952 |
| 152 | Ga0079104_1034512 | 3300006946 | Bacteria | 1228 |
| 153 | Ga0105251_10000276 | 3300009011 | Bacteria | 51560 |
| 154 | Ga0105240_10000352 | 3300009093 | Bacteria | 86113 |
| 155 | Ga0105240_10003234 | 3300009093 | Bacteria | 25501 |
| 156 | Ga0105240_10075423 | 3300009093 | Bacteria | 4160 |
| 157 | Ga0105245_10005496 | 3300009098 | Bacteria | 11132 |
| 158 | Ga0105247_10008163 | 3300009101 | Bacteria | 6393 |
| 159 | Ga0105247_10042730 | 3300009101 | Bacteria | 2776 |
| 160 | Ga0105243_10000030 | 3300009148 | Bacteria | 190342 |
| 161 | Ga0105243_10002022 | 3300009148 | Bacteria | 17230 |
| 162 | Ga0105243_10490852 | 3300009148 | Bacteria | 1161 |
| 163 | Ga0105241_10004167 | 3300009174 | Bacteria | 10674 |
| 164 | Ga0105242_10002453 | 3300009176 | Bacteria | 14548 |
| 165 | Ga0105242_10202299 | 3300009176 | Bacteria | 1765 |
| 166 | Ga0105248_10026581 | 3300009177 | Bacteria | 6437 |
| 167 | Ga0105248_10045340 | 3300009177 | Bacteria | 4931 |
| 168 | Ga0105248_10049647 | 3300009177 | Bacteria | 4706 |
| 169 | Ga0105248_10209029 | 3300009177 | Bacteria | 2199 |
| 170 | Ga0105248_10289435 | 3300009177 | Bacteria | 1845 |
| 171 | Ga0105248_10477183 | 3300009177 | Bacteria | 1406 |
| 172 | Ga0105248_11005998 | 3300009177 | Bacteria | 942 |
| 173 | Ga0105237_10019944 | 3300009545 | Bacteria | 6921 |
| 174 | Ga0105237_10322615 | 3300009545 | Unclassified | 1548 |
| 175 | Ga0105238_10145546 | 3300009551 | Unclassified | 2346 |
| 176 | Ga0105249_10000043 | 3300009553 | Bacteria | 192155 |
| 177 | Ga0105249_10000350 | 3300009553 | Bacteria | 46331 |
| 178 | Ga0105249_10019121 | 3300009553 | Bacteria | 6109 |
| 179 | Ga0105239_10000207 | 3300010375 | Bacteria | 86761 |
| 180 | Ga0105239_10069640 | 3300010375 | Bacteria | 3865 |
| 181 | Ga0105239_10389935 | 3300010375 | Unclassified | 1575 |
| 182 | Ga0105246_10001784 | 3300011119 | Bacteria | 12867 |
| 183 | Ga0157371_10000043 | 3300013102 | Bacteria | 197887 |
| 184 | Ga0157374_10001126 | 3300013296 | Bacteria | 22949 |
| 185 | Ga0157378_10002231 | 3300013297 | Bacteria | 17188 |
| 186 | Ga0163162_10229848 | 3300013306 | Bacteria | 1985 |
| 187 | Ga0157372_10279731 | 3300013307 | Bacteria | 1940 |
| 188 | Ga0157375_10003871 | 3300013308 | Bacteria | 12989 |
| 189 | Ga0157380_10419457 | 3300014326 | Bacteria | 1276 |
| 190 | Ga0157376_10000450 | 3300014969 | Bacteria | 26578 |
| 191 | Ga0163161_10106800 | 3300017792 | Bacteria | 2089 |
| 192 | Ga0213875_10000597 | 3300021388 | Bacteria | 29183 |
| 193 | Ga0209147_100631 | 3300025229 | Bacteria | 18914 |
| 194 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 195 | Ga0209677_106945 | 3300025253 | Bacteria | 2543 |
| 196 | Ga0209148_1000093 | 3300025254 | Bacteria | 245339 |
| 197 | Ga0209565_1000264 | 3300025263 | Bacteria | 54985 |
| 198 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 199 | Ga0209673_1025307 | 3300025273 | Bacteria | 1976 |
| 200 | Ga0209676_1000288 | 3300025292 | Bacteria | 103217 |
| 201 | Ga0209564_1000378 | 3300025295 | Bacteria | 81676 |
| 202 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 203 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 204 | Ga0209050_1000685 | 3300025298 | Bacteria | 50959 |
| 205 | Ga0209051_1000209 | 3300025303 | Bacteria | 102832 |
| 206 | Ga0209257_1000111 | 3300025304 | Bacteria | 234809 |
| 207 | Ga0207713_1002506 | 3300025735 | Bacteria | 13305 |
| 208 | Ga0207710_10008636 | 3300025900 | Bacteria | 4295 |
| 209 | Ga0207710_10088541 | 3300025900 | Bacteria | 1446 |
| 210 | Ga0207688_10290873 | 3300025901 | Bacteria | 997 |
| 211 | Ga0207680_10002301 | 3300025903 | Bacteria | 8902 |
| 212 | Ga0207680_10069791 | 3300025903 | Unclassified | 2172 |
| 213 | Ga0207647_10053387 | 3300025904 | Bacteria | 2491 |
| 214 | Ga0207645_10000752 | 3300025907 | Bacteria | 26968 |
| 215 | Ga0207645_10036051 | 3300025907 | Bacteria | 3175 |
| 216 | Ga0207645_10362905 | 3300025907 | Bacteria | 970 |
| 217 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 218 | Ga0207705_10000325 | 3300025909 | Bacteria | 43398 |
| 219 | Ga0207654_10001035 | 3300025911 | Bacteria | 15216 |
| 220 | Ga0207695_10000434 | 3300025913 | Bacteria | 91902 |
| 221 | Ga0207695_10012304 | 3300025913 | Bacteria | 10280 |
| 222 | Ga0207695_10093847 | 3300025913 | Bacteria | 3009 |
| 223 | Ga0207695_10139251 | 3300025913 | Bacteria | 2377 |
| 224 | Ga0207671_10000955 | 3300025914 | Bacteria | 35890 |
| 225 | Ga0207660_10211446 | 3300025917 | Unclassified | 1519 |
| 226 | Ga0207657_10050512 | 3300025919 | Bacteria | 3619 |
| 227 | Ga0207657_10304910 | 3300025919 | Bacteria | 1261 |
| 228 | Ga0207649_10000441 | 3300025920 | Bacteria | 30004 |
| 229 | Ga0207681_10003059 | 3300025923 | Bacteria | 10513 |
| 230 | Ga0207681_10007162 | 3300025923 | Bacteria | 6842 |
| 231 | Ga0207681_10083914 | 3300025923 | Unclassified | 2256 |
| 232 | Ga0207681_10247204 | 3300025923 | Bacteria | 1391 |
| 233 | Ga0207694_10024498 | 3300025924 | Unclassified | 4584 |
| 234 | Ga0207650_10122177 | 3300025925 | Bacteria | 2029 |
| 235 | Ga0207650_10353055 | 3300025925 | Unclassified | 1210 |
| 236 | Ga0207687_10002234 | 3300025927 | Bacteria | 13189 |
| 237 | Ga0207644_10000070 | 3300025931 | Bacteria | 74994 |
| 238 | Ga0207644_10000367 | 3300025931 | Bacteria | 29435 |
| 239 | Ga0207644_10003667 | 3300025931 | Bacteria | 9957 |
| 240 | Ga0207644_10032521 | 3300025931 | Bacteria | 3640 |
| 241 | Ga0207644_10109353 | 3300025931 | Bacteria | 2088 |
| 242 | Ga0207644_10116967 | 3300025931 | Bacteria | 2024 |
| 243 | Ga0207690_10076194 | 3300025932 | Bacteria | 2328 |
| 244 | Ga0207706_10061908 | 3300025933 | Unclassified | 3296 |
| 245 | Ga0207686_10000786 | 3300025934 | Bacteria | 19463 |
| 246 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 247 | Ga0207709_10000276 | 3300025935 | Bacteria | 59937 |
| 248 | Ga0207709_10289951 | 3300025935 | Bacteria | 1212 |
| 249 | Ga0207669_10000051 | 3300025937 | Bacteria | 58489 |
| 250 | Ga0207704_10000034 | 3300025938 | Bacteria | 98810 |
| 251 | Ga0207691_10126982 | 3300025940 | Bacteria | 2256 |
| 252 | Ga0207711_10021765 | 3300025941 | Bacteria | 5354 |
| 253 | Ga0207711_10025856 | 3300025941 | Bacteria | 4923 |
| 254 | Ga0207711_10105106 | 3300025941 | Bacteria | 2503 |
| 255 | Ga0207711_10213331 | 3300025941 | Bacteria | 1764 |
| 256 | Ga0207689_10005357 | 3300025942 | Bacteria | 11487 |
| 257 | Ga0207679_10490815 | 3300025945 | Bacteria | 1095 |
| 258 | Ga0207667_10000069 | 3300025949 | Bacteria | 180683 |
| 259 | Ga0207667_10000762 | 3300025949 | Bacteria | 41863 |
| 260 | Ga0207667_10295899 | 3300025949 | Bacteria | 1654 |
| 261 | Ga0207651_10000010 | 3300025960 | Bacteria | 193754 |
| 262 | Ga0207651_10012864 | 3300025960 | Bacteria | 4758 |
| 263 | Ga0207712_10000095 | 3300025961 | Bacteria | 102251 |
| 264 | Ga0207712_10000299 | 3300025961 | Bacteria | 46419 |
| 265 | Ga0207712_10237546 | 3300025961 | Bacteria | 1466 |
| 266 | Ga0207668_10000061 | 3300025972 | Bacteria | 89620 |
| 267 | Ga0207668_10000103 | 3300025972 | Bacteria | 60096 |
| 268 | Ga0207668_10000224 | 3300025972 | Bacteria | 38508 |
| 269 | Ga0207668_10043335 | 3300025972 | Bacteria | 3053 |
| 270 | Ga0207640_10001299 | 3300025981 | Bacteria | 13555 |
| 271 | Ga0207658_10000025 | 3300025986 | Bacteria | 182470 |
| 272 | Ga0207658_10000042 | 3300025986 | Bacteria | 134223 |
| 273 | Ga0207658_10001305 | 3300025986 | Bacteria | 19652 |
| 274 | Ga0207658_10002737 | 3300025986 | Bacteria | 12730 |
| 275 | Ga0207658_10019407 | 3300025986 | Bacteria | 4702 |
| 276 | Ga0207677_10000296 | 3300026023 | Bacteria | 37224 |
| 277 | Ga0207703_10088800 | 3300026035 | Bacteria | 2595 |
| 278 | Ga0207639_10000879 | 3300026041 | Bacteria | 20389 |
| 279 | Ga0207639_10114152 | 3300026041 | Bacteria | 2207 |
| 280 | Ga0207639_10182313 | 3300026041 | Bacteria | 1787 |
| 281 | Ga0207678_10104819 | 3300026067 | Bacteria | 2413 |
| 282 | Ga0207702_10061014 | 3300026078 | Bacteria | 3215 |
| 283 | Ga0207641_10000024 | 3300026088 | Bacteria | 250751 |
| 284 | Ga0207641_10000046 | 3300026088 | Bacteria | 180836 |
| 285 | Ga0207641_10002412 | 3300026088 | Bacteria | 17264 |
| 286 | Ga0207641_10002537 | 3300026088 | Bacteria | 16800 |
| 287 | Ga0207641_10002760 | 3300026088 | Bacteria | 16013 |
| 288 | Ga0207641_10004669 | 3300026088 | Bacteria | 11816 |
| 289 | Ga0207641_10019262 | 3300026088 | Bacteria | 5600 |
| 290 | Ga0207641_10557979 | 3300026088 | Bacteria | 1117 |
| 291 | Ga0207648_10000219 | 3300026089 | Bacteria | 61792 |
| 292 | Ga0207648_10094248 | 3300026089 | Bacteria | 2618 |
| 293 | Ga0207676_10013562 | 3300026095 | Bacteria | 5850 |
| 294 | Ga0207674_10000811 | 3300026116 | Bacteria | 40585 |
| 295 | Ga0207675_100000244 | 3300026118 | Bacteria | 51844 |
| 296 | Ga0207683_10004084 | 3300026121 | Bacteria | 12604 |
| 297 | Ga0207698_10148081 | 3300026142 | Bacteria | 2033 |
| 298 | Ga0209281_1012494 | 3300027111 | Bacteria | 1863 |
| 299 | Ga0209813_10000097 | 3300027866 | Bacteria | 32642 |
| 300 | Ga0268266_10001691 | 3300028379 | Bacteria | 25327 |
| 301 | Ga0268266_10018808 | 3300028379 | Bacteria | 5887 |
| 302 | Ga0268265_10000189 | 3300028380 | Bacteria | 73017 |
| 303 | Ga0268265_10000219 | 3300028380 | Bacteria | 66148 |
| 304 | Ga0268265_10001219 | 3300028380 | Bacteria | 22338 |
| 305 | Ga0268265_10028451 | 3300028380 | Bacteria | 4001 |
| 306 | Ga0268265_10083120 | 3300028380 | Bacteria | 2534 |
| 307 | Ga0268265_10151490 | 3300028380 | Bacteria | 1956 |
| 308 | Ga0268264_10000120 | 3300028381 | Bacteria | 191138 |
| 309 | Ga0268264_10000190 | 3300028381 | Bacteria | 127747 |
| 310 | Ga0268264_10000906 | 3300028381 | Bacteria | 31144 |
| 311 | Ga0268264_10001482 | 3300028381 | Bacteria | 21904 |
| 312 | Ga0268264_10002998 | 3300028381 | Bacteria | 14650 |
| 313 | Ga0268264_10013675 | 3300028381 | Bacteria | 6681 |
| 314 | Ga0268264_10017221 | 3300028381 | Bacteria | 5919 |
| 315 | Ga0268264_10081902 | 3300028381 | Bacteria | 2760 |
| 316 | Ga0307517_10024263 | 3300028786 | Bacteria | 7487 |
| 317 | Ga0307517_10086720 | 3300028786 | Bacteria | 2609 |
| 318 | Ga0307513_10055632 | 3300031456 | Bacteria | 4232 |
| 319 | Ga0307513_10158317 | 3300031456 | Bacteria | 2161 |
| 320 | Ga0307508_10012591 | 3300031616 | Bacteria | 7737 |
| 321 | Ga0307516_10260692 | 3300031730 | Bacteria | 1424 |
| 322 | Ga0307405_10065008 | 3300031731 | Bacteria | 2320 |
| 323 | Ga0307405_10073789 | 3300031731 | Bacteria | 2204 |
| 324 | Ga0307405_10126652 | 3300031731 | Bacteria | 1757 |
| 325 | Ga0307413_10076268 | 3300031824 | Bacteria | 2130 |
| 326 | Ga0307413_10236219 | 3300031824 | Bacteria | 1346 |
| 327 | Ga0307410_10043240 | 3300031852 | Bacteria | 2984 |
| 328 | Ga0307410_10076071 | 3300031852 | Bacteria | 2342 |
| 329 | Ga0307410_10134113 | 3300031852 | Bacteria | 1823 |
| 330 | Ga0307410_10297182 | 3300031852 | Bacteria | 1273 |
| 331 | Ga0307407_10168405 | 3300031903 | Bacteria | 1440 |
| 332 | Ga0307412_10000269 | 3300031911 | Bacteria | 33304 |
| 333 | Ga0307412_10019146 | 3300031911 | Bacteria | 4137 |
| 334 | Ga0307412_10053673 | 3300031911 | Bacteria | 2672 |
| 335 | Ga0307412_10225870 | 3300031911 | Bacteria | 1438 |
| 336 | Ga0307409_100006293 | 3300031995 | Bacteria | 6957 |
| 337 | Ga0307409_100239418 | 3300031995 | Bacteria | 1651 |
| 338 | Ga0307416_100135793 | 3300032002 | Bacteria | 2224 |
| 339 | Ga0307416_100533100 | 3300032002 | Bacteria | 1244 |
| 340 | Ga0307414_10001099 | 3300032004 | Bacteria | 13830 |
| 341 | Ga0307414_10019084 | 3300032004 | Bacteria | 4242 |
| 342 | Ga0307414_10431461 | 3300032004 | Bacteria | 1151 |
| 343 | Ga0307411_10006123 | 3300032005 | Bacteria | 5984 |
| 344 | Ga0307411_10405463 | 3300032005 | Bacteria | 1128 |
| 345 | Ga0307415_100039053 | 3300032126 | Bacteria | 3133 |
| 346 | Ga0307415_100436402 | 3300032126 | Bacteria | 1128 |
| 347 | Ga0373960_0038895 | 3300035121 | Bacteria | 1366 |
| 348 | Ga0316584_0146641 | 3300036712 | Bacteria | 1758 |
| 349 | Ga0237819_00887 | 3300038705 | Bacteria | 9342 |
| 350 | Ga0451793_0281662 | 3300041452 | Bacteria | 1582 |
| 351 | Ga0451802_0164837 | 3300041460 | Bacteria | 4076 |
| 352 | Ga0451806_084591 | 3300041462 | Bacteria | 1317 |
| 353 | Ga0451807_1856970 | 3300041486 | Bacteria | 1282 |
| 354 | Ga0451841_0113193 | 3300041498 | Bacteria | 1021 |
| 355 | Ga0451841_0820137 | 3300041498 | Bacteria | 1190 |
| 356 | Ga0451845_0938299 | 3300041501 | Bacteria | 929 |
| 357 | Ga0451853_3609454 | 3300041512 | Bacteria | 984 |
| 358 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 359 | Ga0495617_051980 | 3300046452 | Bacteria | 1362 |
| 360 | Ga0495627_000632 | 3300046453 | Bacteria | 27766 |
| 361 | Ga0495627_001091 | 3300046453 | Bacteria | 17754 |
| 362 | Ga0495638_0030364 | 3300046460 | Bacteria | 3480 |
| 363 | Ga0495650_0001028 | 3300046471 | Bacteria | 31367 |
| 364 | Ga0495650_0001055 | 3300046471 | Bacteria | 30638 |
| 365 | Ga0495650_0001337 | 3300046471 | Bacteria | 24602 |
| 366 | Ga0495585_0002664 | 3300046492 | Bacteria | 12507 |
| 367 | Ga0495596_0000267 | 3300046500 | Bacteria | 34545 |
| 368 | Ga0495596_0000437 | 3300046500 | Bacteria | 26720 |
| 369 | Ga0495607_0006033 | 3300046501 | Bacteria | 8583 |
| 370 | Ga0495583_0000175 | 3300046506 | Bacteria | 108912 |
| 371 | Ga0495583_0001301 | 3300046506 | Bacteria | 25981 |
| 372 | Ga0495583_0037970 | 3300046506 | Bacteria | 2279 |
| 373 | Ga0495606_0000372 | 3300046507 | Bacteria | 76478 |
| 374 | Ga0495606_0007211 | 3300046507 | Bacteria | 10022 |
| 375 | Ga0495606_0049115 | 3300046507 | Bacteria | 2770 |
| 376 | Ga0495606_0065335 | 3300046507 | Bacteria | 2312 |
| 377 | Ga0495606_0092317 | 3300046507 | Bacteria | 1859 |
| 378 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 379 | Ga0495610_0000136 | 3300046512 | Bacteria | 82060 |
| 380 | Ga0495620_0035031 | 3300046515 | Bacteria | 2262 |
| 381 | Ga0495631_0090143 | 3300046518 | Bacteria | 1320 |
| 382 | Ga0495632_0000096 | 3300046519 | Bacteria | 89284 |
| 383 | Ga0495632_0000351 | 3300046519 | Bacteria | 43708 |
| 384 | Ga0495632_0032070 | 3300046519 | Bacteria | 2710 |
| 385 | Ga0495637_0000516 | 3300046520 | Bacteria | 28045 |
| 386 | Ga0495643_0000048 | 3300046522 | Bacteria | 212788 |
| 387 | Ga0495643_0000068 | 3300046522 | Bacteria | 172115 |
| 388 | Ga0495643_0010634 | 3300046522 | Bacteria | 5653 |
| 389 | Ga0495643_0061031 | 3300046522 | Bacteria | 2000 |
| 390 | Ga0495643_0067257 | 3300046522 | Bacteria | 1888 |
| 391 | Ga0495648_0000024 | 3300046524 | Bacteria | 235605 |
| 392 | Ga0495648_0015439 | 3300046524 | Bacteria | 5546 |
| 393 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 394 | Ga0495663_0000088 | 3300046525 | Bacteria | 40383 |
| 395 | Ga0495654_0026433 | 3300046530 | Bacteria | 2983 |
| 396 | Ga0495654_0053625 | 3300046530 | Bacteria | 1959 |
| 397 | Ga0495609_0004502 | 3300046538 | Bacteria | 7601 |
| 398 | Ga0495622_0067448 | 3300046557 | Bacteria | 1653 |
| 399 | Ga0495633_0000179 | 3300046558 | Bacteria | 82201 |
| 400 | Ga0495633_0000420 | 3300046558 | Bacteria | 44087 |
| 401 | Ga0495633_0000816 | 3300046558 | Bacteria | 27602 |
| 402 | Ga0495633_0002928 | 3300046558 | Bacteria | 11698 |
| 403 | Ga0495633_0070823 | 3300046558 | Bacteria | 1627 |
| 404 | Ga0495668_0000084 | 3300046616 | Bacteria | 153179 |
| 405 | Ga0495625_0000632 | 3300046660 | Bacteria | 50727 |
| 406 | Ga0495625_0096909 | 3300046660 | Bacteria | 2031 |
| 407 | Ga0495625_0115019 | 3300046660 | Bacteria | 1836 |
| 408 | Ga0495669_0000186 | 3300046684 | Bacteria | 38626 |
| 409 | Ga0495670_0006398 | 3300046691 | Bacteria | 5786 |
| 410 | Ga0495671_0000040 | 3300046692 | Bacteria | 167933 |
| 411 | Ga0495671_0036360 | 3300046692 | Bacteria | 2495 |
| 412 | Ga0495649_0043693 | 3300046694 | Bacteria | 2446 |
| 413 | Ga0495600_0174973 | 3300046809 | Bacteria | 1384 |
| 414 | Ga0495683_0013138 | 3300047323 | Bacteria | 4335 |
| 415 | Ga0495687_000971 | 3300047443 | Bacteria | 29198 |
| 416 | Ga0495687_001338 | 3300047443 | Bacteria | 22958 |
| 417 | Ga0495687_137966 | 3300047443 | Bacteria | 853 |
| 418 | Ga0495681_0000445 | 3300047470 | Bacteria | 31682 |
| 419 | Ga0495681_0013978 | 3300047470 | Bacteria | 4629 |
| 420 | Ga0495686_0000293 | 3300047472 | Bacteria | 87130 |
| 421 | Ga0495686_0000361 | 3300047472 | Bacteria | 73548 |
| 422 | Ga0495686_0001049 | 3300047472 | Bacteria | 33132 |
| 423 | Ga0495686_0001471 | 3300047472 | Bacteria | 25626 |
| 424 | Ga0495686_0007055 | 3300047472 | Bacteria | 8473 |
| 425 | Ga0495686_0013971 | 3300047472 | Bacteria | 5551 |
| 426 | Ga0495686_0022857 | 3300047472 | Bacteria | 4132 |
| 427 | Ga0495686_0029441 | 3300047472 | Bacteria | 3572 |
| 428 | Ga0495686_0047500 | 3300047472 | Bacteria | 2710 |
| 429 | Ga0495686_0055188 | 3300047472 | Bacteria | 2486 |
| 430 | Ga0495686_0116259 | 3300047472 | Bacteria | 1599 |
| 431 | Ga0495686_0145387 | 3300047472 | Bacteria | 1396 |
| 432 | Ga0495615_0000110 | 3300048090 | Bacteria | 22096 |
| 433 | Ga0495626_0000808 | 3300048091 | Bacteria | 28273 |
| 434 | Ga0496102_0000355 | 3300048905 | Bacteria | 55552 |
| 435 | Ga0496102_0487663 | 3300048905 | Bacteria | 1154 |
| 436 | Ga0496103_0000600 | 3300048906 | Bacteria | 28303 |
| 437 | Ga0496103_0001474 | 3300048906 | Bacteria | 15742 |
| 438 | Ga0496105_0003182 | 3300048908 | Bacteria | 12095 |
| 439 | Ga0496114_0011207 | 3300048917 | Bacteria | 7159 |
| 440 | Ga0496115_0000220 | 3300048918 | Bacteria | 52439 |
| 441 | Ga0496116_0000153 | 3300048919 | Bacteria | 141137 |
| 442 | Ga0496116_0003279 | 3300048919 | Bacteria | 16096 |
| 443 | Ga0496116_0021122 | 3300048919 | Bacteria | 4918 |
| 444 | Ga0496117_0000715 | 3300048920 | Bacteria | 52465 |
| 445 | Ga0496117_0009149 | 3300048920 | Bacteria | 9285 |
| 446 | Ga0496117_0034667 | 3300048920 | Bacteria | 3800 |
| 447 | Ga0496117_0098213 | 3300048920 | Bacteria | 1862 |
| 448 | Ga0496118_0000130 | 3300048921 | Bacteria | 133250 |
| 449 | Ga0496118_0005916 | 3300048921 | Bacteria | 13682 |
| 450 | Ga0496118_0008931 | 3300048921 | Bacteria | 10231 |
| 451 | Ga0496118_0177961 | 3300048921 | Bacteria | 1289 |
| 452 | Ga0496118_0188933 | 3300048921 | Unclassified | 1234 |
| 453 | Ga0496118_0248400 | 3300048921 | Bacteria | 1012 |
| 454 | Ga0496119_0011789 | 3300048922 | Bacteria | 7181 |
| 455 | Ga0496119_0018757 | 3300048922 | Bacteria | 5131 |
| 456 | Ga0496119_0025914 | 3300048922 | Bacteria | 4081 |
| 457 | Ga0496119_0049394 | 3300048922 | Bacteria | 2601 |
| 458 | Ga0496120_0019923 | 3300048923 | Bacteria | 4278 |
| 459 | Ga0496120_0099949 | 3300048923 | Bacteria | 1535 |
| 460 | Ga0496120_0188536 | 3300048923 | Bacteria | 1007 |
| 461 | Ga0496121_0000163 | 3300048924 | Bacteria | 145648 |
| 462 | Ga0496121_0000375 | 3300048924 | Bacteria | 91802 |
| 463 | Ga0496121_0001411 | 3300048924 | Bacteria | 40702 |
| 464 | Ga0496121_0001839 | 3300048924 | Bacteria | 34202 |
| 465 | Ga0496121_0004929 | 3300048924 | Bacteria | 17507 |
| 466 | Ga0496121_0014109 | 3300048924 | Bacteria | 8516 |
| 467 | Ga0496121_0043784 | 3300048924 | Bacteria | 3871 |
| 468 | Ga0496122_0000083 | 3300048925 | Bacteria | 208744 |
| 469 | Ga0496122_0000094 | 3300048925 | Bacteria | 202047 |
| 470 | Ga0496122_0002618 | 3300048925 | Bacteria | 25206 |
| 471 | Ga0496122_0011330 | 3300048925 | Bacteria | 9048 |
| 472 | Ga0496123_0000356 | 3300048926 | Bacteria | 85832 |
| 473 | Ga0496123_0001077 | 3300048926 | Bacteria | 41258 |
| 474 | Ga0496123_0001954 | 3300048926 | Bacteria | 26794 |
| 475 | Ga0496123_0033133 | 3300048926 | Bacteria | 3724 |
| 476 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 477 | Ga0496124_0000163 | 3300048927 | Bacteria | 135337 |
| 478 | Ga0496124_0000316 | 3300048927 | Bacteria | 89321 |
| 479 | Ga0496124_0000579 | 3300048927 | Bacteria | 61788 |
| 480 | Ga0496124_0001695 | 3300048927 | Bacteria | 31188 |
| 481 | Ga0496124_0276592 | 3300048927 | Bacteria | 1226 |
| 482 | Ga0496125_0000587 | 3300048928 | Bacteria | 62037 |
| 483 | Ga0496125_0001699 | 3300048928 | Bacteria | 30720 |
| 484 | Ga0496125_0012186 | 3300048928 | Bacteria | 8555 |
| 485 | Ga0496125_0018631 | 3300048928 | Bacteria | 6588 |
| 486 | Ga0496125_0225314 | 3300048928 | Unclassified | 1204 |
| 487 | Ga0496126_0000361 | 3300048929 | Bacteria | 94834 |
| 488 | Ga0496126_0000517 | 3300048929 | Bacteria | 75042 |
| 489 | Ga0496126_0005027 | 3300048929 | Bacteria | 15387 |
| 490 | Ga0496126_0009537 | 3300048929 | Bacteria | 10297 |
| 491 | Ga0496126_0089546 | 3300048929 | Bacteria | 2708 |
| 492 | Ga0496126_0183536 | 3300048929 | Bacteria | 1776 |
| 493 | Ga0496126_0266045 | 3300048929 | Bacteria | 1424 |
| 494 | Ga0495682_0089140 | 3300049460 | Bacteria | 1108 |
| 495 | Ga0501033_0152463 | 3300049570 | Bacteria | 1667 |
| 496 | Ga0501223_001198 | 3300049663 | Bacteria | 6077 |
| 497 | Ga0501225_0000600 | 3300049705 | Bacteria | 11214 |
| 498 | Ga0501269_020829 | 3300049766 | Bacteria | 818 |
| 499 | nmdc:mga03683_6392_c1 | 3300050489 | Bacteria | 4030 |
| 500 | nmdc:mga03683_6_c1 | 3300050489 | Bacteria | 141493 |
| 501 | nmdc:mga03n38_18436_c1 | 3300050490 | Bacteria | 2756 |
| 502 | nmdc:mga03n38_648_c1 | 3300050490 | Bacteria | 8935 |
| 503 | nmdc:mga00v17_10848_c1 | 3300050491 | Bacteria | 4992 |
| 504 | nmdc:mga00v17_180716_c1 | 3300050491 | Bacteria | 1361 |
| 505 | nmdc:mga00v17_8099_c1 | 3300050491 | Bacteria | 5642 |
| 506 | nmdc:mga0yw44_68141_c1 | 3300050492 | Bacteria | 2201 |
| 507 | nmdc:mga0k408_183838_c1 | 3300050493 | Bacteria | 1247 |
| 508 | nmdc:mga0k408_25027_c1 | 3300050493 | Unclassified | 3378 |
| 509 | nmdc:mga0k408_6_c1 | 3300050493 | Bacteria | 200443 |
| 510 | nmdc:mga0k408_75963_c1 | 3300050493 | Bacteria | 1964 |
| 511 | nmdc:mga0k408_7675_c1 | 3300050493 | Bacteria | 5763 |
| 512 | nmdc:mga06z11_6832_c1 | 3300050494 | Bacteria | 4665 |
| 513 | nmdc:mga04h51_657_c1 | 3300050495 | Bacteria | 8064 |
| 514 | nmdc:mga07m45_110_c1 | 3300050496 | Bacteria | 32792 |
| 515 | nmdc:mga07m45_39329_c2 | 3300050496 | Bacteria | 2129 |
| 516 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 517 | nmdc:mga07m45_9729_c1 | 3300050496 | Bacteria | 4997 |
| 518 | nmdc:mga0qj67_13182_c1 | 3300050509 | Bacteria | 6240 |
| 519 | nmdc:mga0sz30_291_c1 | 3300050516 | Bacteria | 16101 |
| 520 | nmdc:mga0sz30_33743_c1 | 3300050516 | Bacteria | 2128 |
| 521 | nmdc:mga0sz30_405_c2 | 3300050516 | Bacteria | 8662 |
| 522 | Ga0500610_0000240 | 3300053079 | Bacteria | 16589 |
| 523 | Ga0500643_000170 | 3300053087 | Bacteria | 63864 |
| 524 | Ga0500643_003016 | 3300053087 | Bacteria | 8333 |
| 525 | Ga0500643_007836 | 3300053087 | Bacteria | 4255 |
| 526 | Ga0500643_038037 | 3300053087 | Bacteria | 1429 |
| 527 | Ga0500643_043462 | 3300053087 | Bacteria | 1310 |
| 528 | Ga0500643_047001 | 3300053087 | Bacteria | 1245 |
| 529 | Ga0500647_0006216 | 3300053091 | Bacteria | 5029 |
| 530 | Ga0500566_0035948 | 3300053094 | Bacteria | 2876 |
| 531 | Ga0500641_0003365 | 3300053096 | Bacteria | 5655 |
| 532 | Ga0500555_000120 | 3300053103 | Bacteria | 37499 |
| 533 | Ga0500555_035927 | 3300053103 | Bacteria | 1390 |
| 534 | Ga0500556_0000197 | 3300053104 | Bacteria | 49633 |
| 535 | Ga0500592_040670 | 3300053116 | Bacteria | 752 |
| 536 | Ga0500594_0008205 | 3300053118 | Bacteria | 2376 |
| 537 | Ga0500595_000771 | 3300053119 | Bacteria | 18779 |
| 538 | Ga0500595_002186 | 3300053119 | Bacteria | 9933 |
| 539 | Ga0500607_000293 | 3300053121 | Bacteria | 47399 |
| 540 | Ga0500607_000691 | 3300053121 | Bacteria | 32562 |
| 541 | Ga0500608_000266 | 3300053122 | Bacteria | 20190 |
| 542 | Ga0500608_002121 | 3300053122 | Bacteria | 7122 |
| 543 | Ga0500608_102298 | 3300053122 | Unclassified | 1326 |
| 544 | Ga0500618_000430 | 3300053125 | Bacteria | 27901 |
| 545 | Ga0500618_027655 | 3300053125 | Bacteria | 1348 |
| 546 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 547 | Ga0500642_0005700 | 3300053130 | Bacteria | 4043 |
| 548 | Ga0500559_0002171 | 3300053136 | Bacteria | 10381 |
| 549 | Ga0500559_0007085 | 3300053136 | Bacteria | 5001 |
| 550 | Ga0500559_0008373 | 3300053136 | Bacteria | 4535 |
| 551 | Ga0500559_0022043 | 3300053136 | Bacteria | 2702 |
| 552 | Ga0500559_0041753 | 3300053136 | Bacteria | 1999 |
| 553 | Ga0500564_010345 | 3300053138 | Bacteria | 4089 |
| 554 | Ga0500577_0127660 | 3300053142 | Bacteria | 1063 |
| 555 | Ga0500590_012706 | 3300053148 | Bacteria | 4299 |
| 556 | Ga0500616_0004901 | 3300053153 | Bacteria | 9313 |
| 557 | Ga0500616_0005799 | 3300053153 | Bacteria | 8293 |
| 558 | Ga0500624_000008 | 3300053157 | Bacteria | 181801 |
| 559 | Ga0500636_0000688 | 3300053177 | Bacteria | 18135 |
| 560 | Ga0500636_0028084 | 3300053177 | Unclassified | 3324 |
| 561 | Ga0500637_0000037 | 3300053178 | Bacteria | 47475 |
| 562 | Ga0500637_0005337 | 3300053178 | Bacteria | 6211 |
| 563 | Ga0500567_005049 | 3300053723 | Bacteria | 6065 |
| 564 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 565 | Ga0500645_000005 | 3300053730 | Bacteria | 284466 |
| 566 | Ga0500645_000623 | 3300053730 | Bacteria | 22693 |
| 567 | Ga0500645_004752 | 3300053730 | Bacteria | 5144 |
| 568 | Ga0500645_013644 | 3300053730 | Bacteria | 2604 |
| 569 | Ga0500645_058390 | 3300053730 | Bacteria | 1118 |
| 570 | Ga0500596_001793 | 3300053735 | Bacteria | 4314 |
| 571 | Ga0500587_002217 | 3300053739 | Bacteria | 2767 |
| 572 | Ga0500661_000121 | 3300055283 | Bacteria | 12926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100493562 | Ga0070660_1004935622 | 232 |
| 2 | 3300005457 | Ga0070662_100151415 | Ga0070662_1001514154 | 232 |
| 3 | 3300053116 | Ga0500592_040670 | Ga0500592_040670_13_711 | 232 |
| 4 | 3300005355 | Ga0070671_100043304 | Ga0070671_1000433042 | 233 |
| 5 | 3300005457 | Ga0070662_100072728 | Ga0070662_1000727281 | 233 |
| 6 | 3300005539 | Ga0068853_100161259 | Ga0068853_1001612591 | 233 |
| 7 | 3300048925 | Ga0496122_0000083 | Ga0496122_0000083_69239_70015 | 237 |
| 8 | 3300048926 | Ga0496123_0000356 | Ga0496123_0000356_15809_16585 | 237 |
| 9 | 3300048929 | Ga0496126_0009537 | Ga0496126_0009537_7012_7788 | 237 |
| 10 | 3300006178 | Ga0075367_10162715 | Ga0075367_101627152 | 238 |
| 11 | 3300048924 | Ga0496121_0001411 | Ga0496121_0001411_15501_16241 | 242 |
| 12 | 3300048927 | Ga0496124_0000316 | Ga0496124_0000316_22676_23416 | 242 |
| 13 | 3300047472 | Ga0495686_0047500 | Ga0495686_0047500_1295_2092 | 244 |
| 14 | 3300048924 | Ga0496121_0043784 | Ga0496121_0043784_2610_3392 | 248 |
| 15 | 3300053739 | Ga0500587_002217 | Ga0500587_002217_1531_2316 | 248 |
| 16 | 3300048925 | Ga0496122_0002618 | Ga0496122_0002618_13851_14609 | 252 |
| 17 | 3300048926 | Ga0496123_0001077 | Ga0496123_0001077_29811_30569 | 252 |
| 18 | iso_pu_bacteria | 2739367664 | 2739649317 | 254 |
| 19 | iso_pu_bacteria | 2739367865 | 2740027790 | 254 |
| 20 | iso_pu_bacteria | 2848297114 | 2848298839 | 255 |
| 21 | iso_pu_bacteria | 2512564014 | 2512645869 | 256 |
| 22 | iso_pu_bacteria | 2830075706 | 2830075844 | 256 |
| 23 | 3300005327 | Ga0070658_10125667 | Ga0070658_101256672 | 257 |
| 24 | 3300005564 | Ga0070664_100402209 | Ga0070664_1004022092 | 257 |
| 25 | 3300005578 | Ga0068854_100022638 | Ga0068854_1000226383 | 257 |
| 26 | 3300025925 | Ga0207650_10122177 | Ga0207650_101221772 | 257 |
| 27 | 3300025945 | Ga0207679_10490815 | Ga0207679_104908152 | 257 |
| 28 | 3300031731 | Ga0307405_10126652 | Ga0307405_101266522 | 257 |
| 29 | 3300032005 | Ga0307411_10405463 | Ga0307411_104054632 | 257 |
| 30 | 3300041452 | Ga0451793_0281662 | Ga0451793_0281662_233_1006 | 257 |
| 31 | 3300041460 | Ga0451802_0164837 | Ga0451802_0164837_890_1663 | 257 |
| 32 | 3300041462 | Ga0451806_084591 | Ga0451806_084591_414_1187 | 257 |
| 33 | 3300041486 | Ga0451807_1856970 | Ga0451807_1856970_256_1029 | 257 |
| 34 | 3300041501 | Ga0451845_0938299 | Ga0451845_0938299_107_880 | 257 |
| 35 | 3300046460 | Ga0495638_0030364 | Ga0495638_0030364_1982_2755 | 257 |
| 36 | 3300046506 | Ga0495583_0000175 | Ga0495583_0000175_23593_24366 | 257 |
| 37 | 3300046507 | Ga0495606_0049115 | Ga0495606_0049115_1581_2354 | 257 |
| 38 | 3300046691 | Ga0495670_0006398 | Ga0495670_0006398_4838_5611 | 257 |
| 39 | 3300047472 | Ga0495686_0000361 | Ga0495686_0000361_3201_3974 | 257 |
| 40 | 3300047472 | Ga0495686_0001049 | Ga0495686_0001049_26003_26776 | 257 |
| 41 | 3300047472 | Ga0495686_0055188 | Ga0495686_0055188_1296_2222 | 257 |
| 42 | 3300048921 | Ga0496118_0005916 | Ga0496118_0005916_12459_13232 | 257 |
| 43 | 3300048922 | Ga0496119_0018757 | Ga0496119_0018757_498_1271 | 257 |
| 44 | 3300048923 | Ga0496120_0019923 | Ga0496120_0019923_2558_3331 | 257 |
| 45 | 3300048928 | Ga0496125_0012186 | Ga0496125_0012186_735_1508 | 257 |
| 46 | 3300049460 | Ga0495682_0089140 | Ga0495682_0089140_77_850 | 257 |
| 47 | 3300053103 | Ga0500555_000120 | Ga0500555_000120_19777_20550 | 257 |
| 48 | 3300053153 | Ga0500616_0005799 | Ga0500616_0005799_4967_5740 | 257 |
| 49 | iso_pu_bacteria | 2510917021 | 2511128134 | 257 |
| 50 | iso_pu_bacteria | 2818991438 | 2819554468 | 257 |
| 51 | iso_pu_bacteria | 8054302542 | 8054305259 | 257 |
| 52 | 3300001991 | JGI24743J22301_10008524 | JGI24743J22301_100085243 | 258 |
| 53 | 3300005289 | Ga0065704_10003847 | Ga0065704_100038473 | 258 |
| 54 | 3300005295 | Ga0065707_10094490 | Ga0065707_100944901 | 258 |
| 55 | 3300005327 | Ga0070658_10007930 | Ga0070658_100079306 | 258 |
| 56 | 3300005328 | Ga0070676_10000161 | Ga0070676_1000016119 | 258 |
| 57 | 3300005331 | Ga0070670_100291266 | Ga0070670_1002912662 | 258 |
| 58 | 3300005334 | Ga0068869_100001393 | Ga0068869_1000013932 | 258 |
| 59 | 3300005334 | Ga0068869_100428710 | Ga0068869_1004287102 | 258 |
| 60 | 3300005335 | Ga0070666_10025030 | Ga0070666_100250302 | 258 |
| 61 | 3300005335 | Ga0070666_10037896 | Ga0070666_100378964 | 258 |
| 62 | 3300005338 | Ga0068868_100000057 | Ga0068868_10000005712 | 258 |
| 63 | 3300005347 | Ga0070668_100000045 | Ga0070668_100000045101 | 258 |
| 64 | 3300005347 | Ga0070668_100000249 | Ga0070668_10000024919 | 258 |
| 65 | 3300005347 | Ga0070668_100012728 | Ga0070668_1000127286 | 258 |
| 66 | 3300005353 | Ga0070669_100060051 | Ga0070669_1000600513 | 258 |
| 67 | 3300005353 | Ga0070669_100110160 | Ga0070669_1001101603 | 258 |
| 68 | 3300005355 | Ga0070671_100002659 | Ga0070671_10000265913 | 258 |
| 69 | 3300005355 | Ga0070671_100002701 | Ga0070671_10000270114 | 258 |
| 70 | 3300005355 | Ga0070671_100140177 | Ga0070671_1001401773 | 258 |
| 71 | 3300005364 | Ga0070673_100000005 | Ga0070673_10000000512 | 258 |
| 72 | 3300005367 | Ga0070667_100000104 | Ga0070667_100000104120 | 258 |
| 73 | 3300005367 | Ga0070667_100000193 | Ga0070667_10000019356 | 258 |
| 74 | 3300005367 | Ga0070667_100094786 | Ga0070667_1000947863 | 258 |
| 75 | 3300005440 | Ga0070705_100075444 | Ga0070705_1000754441 | 258 |
| 76 | 3300005459 | Ga0068867_100000071 | Ga0068867_10000007158 | 258 |
| 77 | 3300005539 | Ga0068853_100001233 | Ga0068853_1000012332 | 258 |
| 78 | 3300005539 | Ga0068853_100032792 | Ga0068853_1000327925 | 258 |
| 79 | 3300005543 | Ga0070672_100065513 | Ga0070672_1000655133 | 258 |
| 80 | 3300005544 | Ga0070686_100066195 | Ga0070686_1000661953 | 258 |
| 81 | 3300005563 | Ga0068855_100138187 | Ga0068855_1001381872 | 258 |
| 82 | 3300005577 | Ga0068857_100013403 | Ga0068857_1000134033 | 258 |
| 83 | 3300005614 | Ga0068856_100305906 | Ga0068856_1003059062 | 258 |
| 84 | 3300005616 | Ga0068852_100303535 | Ga0068852_1003035352 | 258 |
| 85 | 3300005616 | Ga0068852_100532285 | Ga0068852_1005322851 | 258 |
| 86 | 3300005617 | Ga0068859_100022780 | Ga0068859_1000227808 | 258 |
| 87 | 3300005617 | Ga0068859_100112991 | Ga0068859_1001129914 | 258 |
| 88 | 3300005618 | Ga0068864_100035448 | Ga0068864_1000354485 | 258 |
| 89 | 3300005841 | Ga0068863_100000625 | Ga0068863_10000062518 | 258 |
| 90 | 3300005841 | Ga0068863_100022543 | Ga0068863_1000225437 | 258 |
| 91 | 3300005841 | Ga0068863_100038067 | Ga0068863_1000380673 | 258 |
| 92 | 3300005842 | Ga0068858_100013007 | Ga0068858_10001300710 | 258 |
| 93 | 3300005843 | Ga0068860_100000197 | Ga0068860_100000197111 | 258 |
| 94 | 3300005843 | Ga0068860_100003204 | Ga0068860_1000032043 | 258 |
| 95 | 3300005843 | Ga0068860_100006651 | Ga0068860_10000665111 | 258 |
| 96 | 3300005843 | Ga0068860_100007022 | Ga0068860_10000702211 | 258 |
| 97 | 3300005844 | Ga0068862_100000031 | Ga0068862_1000000316 | 258 |
| 98 | 3300005844 | Ga0068862_100000201 | Ga0068862_10000020161 | 258 |
| 99 | 3300005844 | Ga0068862_100002137 | Ga0068862_10000213718 | 258 |
| 100 | 3300005844 | Ga0068862_100020190 | Ga0068862_1000201904 | 258 |
| 101 | 3300005985 | Ga0081539_10007629 | Ga0081539_1000762913 | 258 |
| 102 | 3300006038 | Ga0075365_10045743 | Ga0075365_100457433 | 258 |
| 103 | 3300006042 | Ga0075368_10000038 | Ga0075368_100000383 | 258 |
| 104 | 3300006048 | Ga0075363_100018683 | Ga0075363_1000186834 | 258 |
| 105 | 3300006051 | Ga0075364_10010580 | Ga0075364_100105803 | 258 |
| 106 | 3300006051 | Ga0075364_10125446 | Ga0075364_101254462 | 258 |
| 107 | 3300006177 | Ga0075362_10002493 | Ga0075362_100024933 | 258 |
| 108 | 3300006177 | Ga0075362_10010974 | Ga0075362_100109745 | 258 |
| 109 | 3300006178 | Ga0075367_10022284 | Ga0075367_100222844 | 258 |
| 110 | 3300006186 | Ga0075369_10002761 | Ga0075369_100027613 | 258 |
| 111 | 3300006195 | Ga0075366_10001944 | Ga0075366_100019446 | 258 |
| 112 | 3300006195 | Ga0075366_10016071 | Ga0075366_100160715 | 258 |
| 113 | 3300006195 | Ga0075366_10023184 | Ga0075366_100231846 | 258 |
| 114 | 3300006195 | Ga0075366_10159815 | Ga0075366_101598152 | 258 |
| 115 | 3300006353 | Ga0075370_10122614 | Ga0075370_101226142 | 258 |
| 116 | 3300006353 | Ga0075370_10169533 | Ga0075370_101695332 | 258 |
| 117 | 3300006881 | Ga0068865_100000032 | Ga0068865_10000003287 | 258 |
| 118 | 3300006931 | Ga0097620_100022780 | Ga0097620_1000227808 | 258 |
| 119 | 3300006931 | Ga0097620_100112995 | Ga0097620_1001129954 | 258 |
| 120 | 3300006946 | Ga0079104_1034512 | Ga0079104_10345121 | 258 |
| 121 | 3300009098 | Ga0105245_10005496 | Ga0105245_100054968 | 258 |
| 122 | 3300009101 | Ga0105247_10008163 | Ga0105247_100081634 | 258 |
| 123 | 3300009148 | Ga0105243_10002022 | Ga0105243_100020228 | 258 |
| 124 | 3300009176 | Ga0105242_10002453 | Ga0105242_1000245313 | 258 |
| 125 | 3300009177 | Ga0105248_10049647 | Ga0105248_100496474 | 258 |
| 126 | 3300009177 | Ga0105248_10289435 | Ga0105248_102894352 | 258 |
| 127 | 3300009177 | Ga0105248_11005998 | Ga0105248_110059982 | 258 |
| 128 | 3300009553 | Ga0105249_10000043 | Ga0105249_1000004384 | 258 |
| 129 | 3300009553 | Ga0105249_10000350 | Ga0105249_1000035042 | 258 |
| 130 | 3300010375 | Ga0105239_10069640 | Ga0105239_100696402 | 258 |
| 131 | 3300011119 | Ga0105246_10001784 | Ga0105246_100017848 | 258 |
| 132 | 3300013296 | Ga0157374_10001126 | Ga0157374_1000112615 | 258 |
| 133 | 3300013297 | Ga0157378_10002231 | Ga0157378_100022318 | 258 |
| 134 | 3300013306 | Ga0163162_10229848 | Ga0163162_102298482 | 258 |
| 135 | 3300013308 | Ga0157375_10003871 | Ga0157375_1000387111 | 258 |
| 136 | 3300014326 | Ga0157380_10419457 | Ga0157380_104194572 | 258 |
| 137 | 3300014969 | Ga0157376_10000450 | Ga0157376_1000045011 | 258 |
| 138 | 3300025229 | Ga0209147_100631 | Ga0209147_10063111 | 258 |
| 139 | 3300025900 | Ga0207710_10008636 | Ga0207710_100086363 | 258 |
| 140 | 3300025903 | Ga0207680_10002301 | Ga0207680_100023018 | 258 |
| 141 | 3300025903 | Ga0207680_10069791 | Ga0207680_100697912 | 258 |
| 142 | 3300025907 | Ga0207645_10000752 | Ga0207645_1000075211 | 258 |
| 143 | 3300025909 | Ga0207705_10000022 | Ga0207705_10000022281 | 258 |
| 144 | 3300025923 | Ga0207681_10007162 | Ga0207681_100071622 | 258 |
| 145 | 3300025923 | Ga0207681_10083914 | Ga0207681_100839142 | 258 |
| 146 | 3300025923 | Ga0207681_10247204 | Ga0207681_102472042 | 258 |
| 147 | 3300025925 | Ga0207650_10353055 | Ga0207650_103530552 | 258 |
| 148 | 3300025927 | Ga0207687_10002234 | Ga0207687_100022348 | 258 |
| 149 | 3300025931 | Ga0207644_10000070 | Ga0207644_1000007012 | 258 |
| 150 | 3300025931 | Ga0207644_10003667 | Ga0207644_100036677 | 258 |
| 151 | 3300025931 | Ga0207644_10109353 | Ga0207644_101093533 | 258 |
| 152 | 3300025934 | Ga0207686_10000786 | Ga0207686_100007869 | 258 |
| 153 | 3300025935 | Ga0207709_10000276 | Ga0207709_1000027660 | 258 |
| 154 | 3300025938 | Ga0207704_10000034 | Ga0207704_1000003411 | 258 |
| 155 | 3300025940 | Ga0207691_10126982 | Ga0207691_101269823 | 258 |
| 156 | 3300025941 | Ga0207711_10105106 | Ga0207711_101051063 | 258 |
| 157 | 3300025941 | Ga0207711_10213331 | Ga0207711_102133312 | 258 |
| 158 | 3300025942 | Ga0207689_10005357 | Ga0207689_100053572 | 258 |
| 159 | 3300025949 | Ga0207667_10295899 | Ga0207667_102958992 | 258 |
| 160 | 3300025960 | Ga0207651_10000010 | Ga0207651_1000001011 | 258 |
| 161 | 3300025961 | Ga0207712_10000095 | Ga0207712_1000009583 | 258 |
| 162 | 3300025961 | Ga0207712_10000299 | Ga0207712_1000029941 | 258 |
| 163 | 3300025961 | Ga0207712_10237546 | Ga0207712_102375461 | 258 |
| 164 | 3300025972 | Ga0207668_10000103 | Ga0207668_1000010368 | 258 |
| 165 | 3300025972 | Ga0207668_10000224 | Ga0207668_1000022427 | 258 |
| 166 | 3300025972 | Ga0207668_10043335 | Ga0207668_100433353 | 258 |
| 167 | 3300025986 | Ga0207658_10000042 | Ga0207658_10000042113 | 258 |
| 168 | 3300025986 | Ga0207658_10001305 | Ga0207658_1000130529 | 258 |
| 169 | 3300026023 | Ga0207677_10000296 | Ga0207677_1000029611 | 258 |
| 170 | 3300026041 | Ga0207639_10182313 | Ga0207639_101823132 | 258 |
| 171 | 3300026088 | Ga0207641_10000046 | Ga0207641_10000046156 | 258 |
| 172 | 3300026088 | Ga0207641_10002760 | Ga0207641_1000276010 | 258 |
| 173 | 3300026088 | Ga0207641_10019262 | Ga0207641_100192625 | 258 |
| 174 | 3300026088 | Ga0207641_10557979 | Ga0207641_105579791 | 258 |
| 175 | 3300026089 | Ga0207648_10000219 | Ga0207648_1000021958 | 258 |
| 176 | 3300026095 | Ga0207676_10013562 | Ga0207676_100135625 | 258 |
| 177 | 3300026116 | Ga0207674_10000811 | Ga0207674_1000081126 | 258 |
| 178 | 3300026142 | Ga0207698_10148081 | Ga0207698_101480811 | 258 |
| 179 | 3300027866 | Ga0209813_10000097 | Ga0209813_1000009729 | 258 |
| 180 | 3300028380 | Ga0268265_10000189 | Ga0268265_1000018950 | 258 |
| 181 | 3300028380 | Ga0268265_10000219 | Ga0268265_1000021911 | 258 |
| 182 | 3300028380 | Ga0268265_10001219 | Ga0268265_1000121936 | 258 |
| 183 | 3300028380 | Ga0268265_10083120 | Ga0268265_100831203 | 258 |
| 184 | 3300028381 | Ga0268264_10000190 | Ga0268264_100001904 | 258 |
| 185 | 3300028381 | Ga0268264_10000906 | Ga0268264_1000090626 | 258 |
| 186 | 3300028381 | Ga0268264_10002998 | Ga0268264_1000299816 | 258 |
| 187 | 3300028381 | Ga0268264_10013675 | Ga0268264_100136756 | 258 |
| 188 | 3300031456 | Ga0307513_10055632 | Ga0307513_100556324 | 258 |
| 189 | 3300031731 | Ga0307405_10065008 | Ga0307405_100650082 | 258 |
| 190 | 3300031731 | Ga0307405_10073789 | Ga0307405_100737893 | 258 |
| 191 | 3300031852 | Ga0307410_10043240 | Ga0307410_100432402 | 258 |
| 192 | 3300031903 | Ga0307407_10168405 | Ga0307407_101684052 | 258 |
| 193 | 3300031911 | Ga0307412_10053673 | Ga0307412_100536732 | 258 |
| 194 | 3300031911 | Ga0307412_10225870 | Ga0307412_102258702 | 258 |
| 195 | 3300031995 | Ga0307409_100006293 | Ga0307409_1000062932 | 258 |
| 196 | 3300032002 | Ga0307416_100135793 | Ga0307416_1001357933 | 258 |
| 197 | 3300032004 | Ga0307414_10019084 | Ga0307414_100190842 | 258 |
| 198 | 3300032005 | Ga0307411_10006123 | Ga0307411_100061234 | 258 |
| 199 | 3300032126 | Ga0307415_100039053 | Ga0307415_1000390533 | 258 |
| 200 | 3300032126 | Ga0307415_100436402 | Ga0307415_1004364021 | 258 |
| 201 | 3300036712 | Ga0316584_0146641 | Ga0316584_0146641_442_1239 | 258 |
| 202 | 3300041498 | Ga0451841_0113193 | Ga0451841_0113193_96_872 | 258 |
| 203 | 3300041498 | Ga0451841_0820137 | Ga0451841_0820137_151_927 | 258 |
| 204 | 3300046453 | Ga0495627_000632 | Ga0495627_000632_23733_24509 | 258 |
| 205 | 3300046471 | Ga0495650_0001055 | Ga0495650_0001055_3160_3936 | 258 |
| 206 | 3300046519 | Ga0495632_0000096 | Ga0495632_0000096_71765_72541 | 258 |
| 207 | 3300046520 | Ga0495637_0000516 | Ga0495637_0000516_6812_7588 | 258 |
| 208 | 3300046522 | Ga0495643_0000068 | Ga0495643_0000068_66265_67041 | 258 |
| 209 | 3300046524 | Ga0495648_0015439 | Ga0495648_0015439_3340_4116 | 258 |
| 210 | 3300046525 | Ga0495663_0000088 | Ga0495663_0000088_16744_17520 | 258 |
| 211 | 3300046530 | Ga0495654_0053625 | Ga0495654_0053625_467_1258 | 258 |
| 212 | 3300046557 | Ga0495622_0067448 | Ga0495622_0067448_591_1367 | 258 |
| 213 | 3300046558 | Ga0495633_0000420 | Ga0495633_0000420_37039_37815 | 258 |
| 214 | 3300046558 | Ga0495633_0000816 | Ga0495633_0000816_16744_17520 | 258 |
| 215 | 3300046660 | Ga0495625_0096909 | Ga0495625_0096909_780_1571 | 258 |
| 216 | 3300046660 | Ga0495625_0115019 | Ga0495625_0115019_804_1595 | 258 |
| 217 | 3300046692 | Ga0495671_0000040 | Ga0495671_0000040_62083_62859 | 258 |
| 218 | 3300046692 | Ga0495671_0036360 | Ga0495671_0036360_792_1568 | 258 |
| 219 | 3300047443 | Ga0495687_137966 | Ga0495687_137966_34_810 | 258 |
| 220 | 3300047470 | Ga0495681_0013978 | Ga0495681_0013978_2414_3190 | 258 |
| 221 | 3300047472 | Ga0495686_0001471 | Ga0495686_0001471_7168_7944 | 258 |
| 222 | 3300047472 | Ga0495686_0022857 | Ga0495686_0022857_415_1191 | 258 |
| 223 | 3300047472 | Ga0495686_0029441 | Ga0495686_0029441_732_1508 | 258 |
| 224 | 3300048920 | Ga0496117_0009149 | Ga0496117_0009149_4387_5163 | 258 |
| 225 | 3300048921 | Ga0496118_0008931 | Ga0496118_0008931_397_1173 | 258 |
| 226 | 3300048927 | Ga0496124_0000579 | Ga0496124_0000579_10071_10847 | 258 |
| 227 | 3300048928 | Ga0496125_0000587 | Ga0496125_0000587_51191_51967 | 258 |
| 228 | 3300048928 | Ga0496125_0225314 | Ga0496125_0225314_344_1120 | 258 |
| 229 | 3300049663 | Ga0501223_001198 | Ga0501223_001198_5110_5886 | 258 |
| 230 | 3300049705 | Ga0501225_0000600 | Ga0501225_0000600_1569_2345 | 258 |
| 231 | 3300050489 | nmdc:mga03683_6392_c1 | nmdc:mga03683_6392_c1_534_1310 | 258 |
| 232 | 3300050490 | nmdc:mga03n38_18436_c1 | nmdc:mga03n38_18436_c1_1792_2568 | 258 |
| 233 | 3300050491 | nmdc:mga00v17_180716_c1 | nmdc:mga00v17_180716_c1_414_1190 | 258 |
| 234 | 3300050491 | nmdc:mga00v17_8099_c1 | nmdc:mga00v17_8099_c1_3100_3876 | 258 |
| 235 | 3300050492 | nmdc:mga0yw44_68141_c1 | nmdc:mga0yw44_68141_c1_1330_2106 | 258 |
| 236 | 3300050493 | nmdc:mga0k408_183838_c1 | nmdc:mga0k408_183838_c1_262_1116 | 258 |
| 237 | 3300050493 | nmdc:mga0k408_75963_c1 | nmdc:mga0k408_75963_c1_407_1183 | 258 |
| 238 | 3300050493 | nmdc:mga0k408_7675_c1 | nmdc:mga0k408_7675_c1_2306_3082 | 258 |
| 239 | 3300050494 | nmdc:mga06z11_6832_c1 | nmdc:mga06z11_6832_c1_3329_4105 | 258 |
| 240 | 3300050495 | nmdc:mga04h51_657_c1 | nmdc:mga04h51_657_c1_3226_4002 | 258 |
| 241 | 3300050496 | nmdc:mga07m45_110_c1 | nmdc:mga07m45_110_c1_28688_29464 | 258 |
| 242 | 3300050496 | nmdc:mga07m45_39329_c2 | nmdc:mga07m45_39329_c2_144_935 | 258 |
| 243 | 3300050516 | nmdc:mga0sz30_291_c1 | nmdc:mga0sz30_291_c1_8306_9082 | 258 |
| 244 | 3300050516 | nmdc:mga0sz30_33743_c1 | nmdc:mga0sz30_33743_c1_128_904 | 258 |
| 245 | 3300053087 | Ga0500643_043462 | Ga0500643_043462_485_1261 | 258 |
| 246 | 3300053087 | Ga0500643_047001 | Ga0500643_047001_400_1191 | 258 |
| 247 | 3300053091 | Ga0500647_0006216 | Ga0500647_0006216_418_1194 | 258 |
| 248 | 3300053094 | Ga0500566_0035948 | Ga0500566_0035948_1118_1894 | 258 |
| 249 | 3300053096 | Ga0500641_0003365 | Ga0500641_0003365_3295_4071 | 258 |
| 250 | 3300053103 | Ga0500555_035927 | Ga0500555_035927_233_1009 | 258 |
| 251 | 3300053118 | Ga0500594_0008205 | Ga0500594_0008205_119_934 | 258 |
| 252 | 3300053121 | Ga0500607_000293 | Ga0500607_000293_39690_40466 | 258 |
| 253 | 3300053121 | Ga0500607_000691 | Ga0500607_000691_4783_5559 | 258 |
| 254 | 3300053122 | Ga0500608_000266 | Ga0500608_000266_8980_9795 | 258 |
| 255 | 3300053125 | Ga0500618_000430 | Ga0500618_000430_6684_7460 | 258 |
| 256 | 3300053125 | Ga0500618_027655 | Ga0500618_027655_182_958 | 258 |
| 257 | 3300053136 | Ga0500559_0007085 | Ga0500559_0007085_3822_4598 | 258 |
| 258 | 3300053136 | Ga0500559_0008373 | Ga0500559_0008373_2194_2970 | 258 |
| 259 | 3300053136 | Ga0500559_0022043 | Ga0500559_0022043_329_1144 | 258 |
| 260 | 3300053136 | Ga0500559_0041753 | Ga0500559_0041753_359_1135 | 258 |
| 261 | 3300053138 | Ga0500564_010345 | Ga0500564_010345_2414_3229 | 258 |
| 262 | 3300053142 | Ga0500577_0127660 | Ga0500577_0127660_239_1015 | 258 |
| 263 | 3300053157 | Ga0500624_000008 | Ga0500624_000008_109631_110407 | 258 |
| 264 | 3300053177 | Ga0500636_0028084 | Ga0500636_0028084_1916_2692 | 258 |
| 265 | 3300053178 | Ga0500637_0000037 | Ga0500637_0000037_32794_33570 | 258 |
| 266 | 3300053178 | Ga0500637_0005337 | Ga0500637_0005337_5206_5982 | 258 |
| 267 | 3300053723 | Ga0500567_005049 | Ga0500567_005049_4937_5752 | 258 |
| 268 | 3300053729 | Ga0500625_000009 | Ga0500625_000009_100266_101081 | 258 |
| 269 | 3300053730 | Ga0500645_013644 | Ga0500645_013644_1423_2199 | 258 |
| 270 | 3300001979 | JGI24740J21852_10054649 | JGI24740J21852_100546491 | 259 |
| 271 | 3300001990 | JGI24737J22298_10029377 | JGI24737J22298_100293771 | 259 |
| 272 | 3300003215 | JGI25153J46596_10000005 | JGI25153J46596_10000005201 | 259 |
| 273 | 3300003322 | rootL2_10085789 | rootL2_100857894 | 259 |
| 274 | 3300003322 | rootL2_10156435 | rootL2_101564352 | 259 |
| 275 | 3300003322 | rootL2_10275880 | rootL2_102758801 | 259 |
| 276 | 3300003759 | Ga0055525_1000037 | Ga0055525_1000037180 | 259 |
| 277 | 3300003762 | Ga0055542_1000293 | Ga0055542_100029324 | 259 |
| 278 | 3300003763 | Ga0055529_1000034 | Ga0055529_1000034121 | 259 |
| 279 | 3300003771 | Ga0055526_1007131 | Ga0055526_10071316 | 259 |
| 280 | 3300003773 | Ga0055537_1000848 | Ga0055537_10008488 | 259 |
| 281 | 3300003791 | Ga0055530_10008155 | Ga0055530_100081552 | 259 |
| 282 | 3300003792 | Ga0055540_1000185 | Ga0055540_100018552 | 259 |
| 283 | 3300003794 | Ga0055531_10000088 | Ga0055531_1000008853 | 259 |
| 284 | 3300005327 | Ga0070658_10001641 | Ga0070658_100016418 | 259 |
| 285 | 3300005337 | Ga0070682_100109043 | Ga0070682_1001090432 | 259 |
| 286 | 3300005344 | Ga0070661_100073444 | Ga0070661_1000734443 | 259 |
| 287 | 3300005347 | Ga0070668_100000058 | Ga0070668_10000005837 | 259 |
| 288 | 3300005367 | Ga0070667_100000045 | Ga0070667_10000004513 | 259 |
| 289 | 3300005456 | Ga0070678_100094904 | Ga0070678_1000949042 | 259 |
| 290 | 3300005466 | Ga0070685_10001123 | Ga0070685_100011238 | 259 |
| 291 | 3300005548 | Ga0070665_100549426 | Ga0070665_1005494262 | 259 |
| 292 | 3300005563 | Ga0068855_100000921 | Ga0068855_10000092133 | 259 |
| 293 | 3300005563 | Ga0068855_100394070 | Ga0068855_1003940702 | 259 |
| 294 | 3300005719 | Ga0068861_100000074 | Ga0068861_10000007431 | 259 |
| 295 | 3300005834 | Ga0068851_10061951 | Ga0068851_100619511 | 259 |
| 296 | 3300005840 | Ga0068870_10245592 | Ga0068870_102455922 | 259 |
| 297 | 3300005841 | Ga0068863_100000012 | Ga0068863_10000001255 | 259 |
| 298 | 3300005843 | Ga0068860_100000073 | Ga0068860_10000007312 | 259 |
| 299 | 3300005844 | Ga0068862_100160283 | Ga0068862_1001602832 | 259 |
| 300 | 3300006048 | Ga0075363_100000828 | Ga0075363_1000008287 | 259 |
| 301 | 3300006051 | Ga0075364_10010542 | Ga0075364_100105424 | 259 |
| 302 | 3300006177 | Ga0075362_10000001 | Ga0075362_10000001161 | 259 |
| 303 | 3300006186 | Ga0075369_10001326 | Ga0075369_100013265 | 259 |
| 304 | 3300006195 | Ga0075366_10000093 | Ga0075366_100000937 | 259 |
| 305 | 3300006195 | Ga0075366_10095731 | Ga0075366_100957311 | 259 |
| 306 | 3300006237 | Ga0097621_100055655 | Ga0097621_1000556552 | 259 |
| 307 | 3300006353 | Ga0075370_10000028 | Ga0075370_1000002815 | 259 |
| 308 | 3300006353 | Ga0075370_10021194 | Ga0075370_100211944 | 259 |
| 309 | 3300006931 | Ga0097620_100002108 | Ga0097620_1000021082 | 259 |
| 310 | 3300009093 | Ga0105240_10003234 | Ga0105240_1000323419 | 259 |
| 311 | 3300009148 | Ga0105243_10000030 | Ga0105243_10000030145 | 259 |
| 312 | 3300009174 | Ga0105241_10004167 | Ga0105241_100041671 | 259 |
| 313 | 3300009176 | Ga0105242_10202299 | Ga0105242_102022991 | 259 |
| 314 | 3300009177 | Ga0105248_10045340 | Ga0105248_100453402 | 259 |
| 315 | 3300009177 | Ga0105248_10209029 | Ga0105248_102090292 | 259 |
| 316 | 3300009177 | Ga0105248_10477183 | Ga0105248_104771831 | 259 |
| 317 | 3300009545 | Ga0105237_10322615 | Ga0105237_103226152 | 259 |
| 318 | 3300009551 | Ga0105238_10145546 | Ga0105238_101455464 | 259 |
| 319 | 3300009553 | Ga0105249_10019121 | Ga0105249_100191213 | 259 |
| 320 | 3300010375 | Ga0105239_10389935 | Ga0105239_103899352 | 259 |
| 321 | 3300013102 | Ga0157371_10000043 | Ga0157371_10000043142 | 259 |
| 322 | 3300013307 | Ga0157372_10279731 | Ga0157372_102797313 | 259 |
| 323 | 3300017792 | Ga0163161_10106800 | Ga0163161_101068003 | 259 |
| 324 | 3300021388 | Ga0213875_10000597 | Ga0213875_1000059715 | 259 |
| 325 | 3300025230 | Ga0209563_100053 | Ga0209563_100053292 | 259 |
| 326 | 3300025253 | Ga0209677_106945 | Ga0209677_1069452 | 259 |
| 327 | 3300025254 | Ga0209148_1000093 | Ga0209148_1000093126 | 259 |
| 328 | 3300025263 | Ga0209565_1000264 | Ga0209565_10002646 | 259 |
| 329 | 3300025272 | Ga0209455_1000045 | Ga0209455_1000045267 | 259 |
| 330 | 3300025273 | Ga0209673_1025307 | Ga0209673_10253073 | 259 |
| 331 | 3300025292 | Ga0209676_1000288 | Ga0209676_100028851 | 259 |
| 332 | 3300025295 | Ga0209564_1000378 | Ga0209564_100037824 | 259 |
| 333 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001204 | 259 |
| 334 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011580 | 259 |
| 335 | 3300025303 | Ga0209051_1000209 | Ga0209051_100020953 | 259 |
| 336 | 3300025304 | Ga0209257_1000111 | Ga0209257_1000111131 | 259 |
| 337 | 3300025909 | Ga0207705_10000325 | Ga0207705_1000032515 | 259 |
| 338 | 3300025911 | Ga0207654_10001035 | Ga0207654_100010353 | 259 |
| 339 | 3300025913 | Ga0207695_10012304 | Ga0207695_100123048 | 259 |
| 340 | 3300025913 | Ga0207695_10093847 | Ga0207695_100938475 | 259 |
| 341 | 3300025917 | Ga0207660_10211446 | Ga0207660_102114461 | 259 |
| 342 | 3300025919 | Ga0207657_10304910 | Ga0207657_103049102 | 259 |
| 343 | 3300025920 | Ga0207649_10000441 | Ga0207649_1000044119 | 259 |
| 344 | 3300025924 | Ga0207694_10024498 | Ga0207694_100244984 | 259 |
| 345 | 3300025932 | Ga0207690_10076194 | Ga0207690_100761942 | 259 |
| 346 | 3300025935 | Ga0207709_10000018 | Ga0207709_10000018348 | 259 |
| 347 | 3300025937 | Ga0207669_10000051 | Ga0207669_1000005153 | 259 |
| 348 | 3300025941 | Ga0207711_10025856 | Ga0207711_100258562 | 259 |
| 349 | 3300025949 | Ga0207667_10000069 | Ga0207667_1000006922 | 259 |
| 350 | 3300025949 | Ga0207667_10000762 | Ga0207667_1000076230 | 259 |
| 351 | 3300025960 | Ga0207651_10012864 | Ga0207651_100128644 | 259 |
| 352 | 3300025972 | Ga0207668_10000061 | Ga0207668_1000006162 | 259 |
| 353 | 3300025981 | Ga0207640_10001299 | Ga0207640_100012996 | 259 |
| 354 | 3300025986 | Ga0207658_10000025 | Ga0207658_10000025147 | 259 |
| 355 | 3300026041 | Ga0207639_10000879 | Ga0207639_1000087912 | 259 |
| 356 | 3300026067 | Ga0207678_10104819 | Ga0207678_101048192 | 259 |
| 357 | 3300026078 | Ga0207702_10061014 | Ga0207702_100610141 | 259 |
| 358 | 3300026088 | Ga0207641_10000024 | Ga0207641_1000002477 | 259 |
| 359 | 3300026088 | Ga0207641_10002537 | Ga0207641_1000253716 | 259 |
| 360 | 3300026089 | Ga0207648_10094248 | Ga0207648_100942482 | 259 |
| 361 | 3300026118 | Ga0207675_100000244 | Ga0207675_10000024419 | 259 |
| 362 | 3300026121 | Ga0207683_10004084 | Ga0207683_1000408410 | 259 |
| 363 | 3300028380 | Ga0268265_10028451 | Ga0268265_100284512 | 259 |
| 364 | 3300028381 | Ga0268264_10000120 | Ga0268264_1000012028 | 259 |
| 365 | 3300028381 | Ga0268264_10001482 | Ga0268264_100014824 | 259 |
| 366 | 3300028786 | Ga0307517_10024263 | Ga0307517_100242631 | 259 |
| 367 | 3300028786 | Ga0307517_10086720 | Ga0307517_100867202 | 259 |
| 368 | 3300031456 | Ga0307513_10158317 | Ga0307513_101583172 | 259 |
| 369 | 3300031616 | Ga0307508_10012591 | Ga0307508_100125914 | 259 |
| 370 | 3300031730 | Ga0307516_10260692 | Ga0307516_102606922 | 259 |
| 371 | 3300031824 | Ga0307413_10076268 | Ga0307413_100762681 | 259 |
| 372 | 3300031824 | Ga0307413_10236219 | Ga0307413_102362191 | 259 |
| 373 | 3300031852 | Ga0307410_10076071 | Ga0307410_100760712 | 259 |
| 374 | 3300031852 | Ga0307410_10134113 | Ga0307410_101341133 | 259 |
| 375 | 3300031852 | Ga0307410_10297182 | Ga0307410_102971821 | 259 |
| 376 | 3300031911 | Ga0307412_10000269 | Ga0307412_100002696 | 259 |
| 377 | 3300031911 | Ga0307412_10019146 | Ga0307412_100191465 | 259 |
| 378 | 3300031995 | Ga0307409_100239418 | Ga0307409_1002394182 | 259 |
| 379 | 3300032002 | Ga0307416_100533100 | Ga0307416_1005331002 | 259 |
| 380 | 3300032004 | Ga0307414_10431461 | Ga0307414_104314611 | 259 |
| 381 | 3300035121 | Ga0373960_0038895 | Ga0373960_0038895_497_1276 | 259 |
| 382 | 3300038705 | Ga0237819_00887 | Ga0237819_00887_3185_3964 | 259 |
| 383 | 3300041512 | Ga0451853_3609454 | Ga0451853_3609454_90_869 | 259 |
| 384 | 3300045051 | Ga0451576_0000024 | Ga0451576_0000024_467120_467899 | 259 |
| 385 | 3300046452 | Ga0495617_051980 | Ga0495617_051980_33_812 | 259 |
| 386 | 3300046471 | Ga0495650_0001337 | Ga0495650_0001337_139_918 | 259 |
| 387 | 3300046492 | Ga0495585_0002664 | Ga0495585_0002664_8453_9232 | 259 |
| 388 | 3300046500 | Ga0495596_0000267 | Ga0495596_0000267_8469_9248 | 259 |
| 389 | 3300046506 | Ga0495583_0001301 | Ga0495583_0001301_15421_16200 | 259 |
| 390 | 3300046507 | Ga0495606_0000372 | Ga0495606_0000372_54218_54997 | 259 |
| 391 | 3300046507 | Ga0495606_0065335 | Ga0495606_0065335_335_1114 | 259 |
| 392 | 3300046507 | Ga0495606_0092317 | Ga0495606_0092317_771_1721 | 259 |
| 393 | 3300046522 | Ga0495643_0010634 | Ga0495643_0010634_1199_1978 | 259 |
| 394 | 3300046522 | Ga0495643_0067257 | Ga0495643_0067257_89_868 | 259 |
| 395 | 3300046524 | Ga0495648_0000024 | Ga0495648_0000024_180982_181761 | 259 |
| 396 | 3300046558 | Ga0495633_0002928 | Ga0495633_0002928_1477_2256 | 259 |
| 397 | 3300046558 | Ga0495633_0070823 | Ga0495633_0070823_523_1302 | 259 |
| 398 | 3300046616 | Ga0495668_0000084 | Ga0495668_0000084_42659_43438 | 259 |
| 399 | 3300046660 | Ga0495625_0000632 | Ga0495625_0000632_20636_21415 | 259 |
| 400 | 3300046684 | Ga0495669_0000186 | Ga0495669_0000186_20669_21448 | 259 |
| 401 | 3300046694 | Ga0495649_0043693 | Ga0495649_0043693_502_1281 | 259 |
| 402 | 3300046809 | Ga0495600_0174973 | Ga0495600_0174973_89_868 | 259 |
| 403 | 3300047323 | Ga0495683_0013138 | Ga0495683_0013138_2270_3049 | 259 |
| 404 | 3300047443 | Ga0495687_000971 | Ga0495687_000971_1119_1898 | 259 |
| 405 | 3300047443 | Ga0495687_001338 | Ga0495687_001338_21280_22059 | 259 |
| 406 | 3300047472 | Ga0495686_0007055 | Ga0495686_0007055_6373_7170 | 259 |
| 407 | 3300047472 | Ga0495686_0013971 | Ga0495686_0013971_546_1325 | 259 |
| 408 | 3300047472 | Ga0495686_0116259 | Ga0495686_0116259_133_912 | 259 |
| 409 | 3300047472 | Ga0495686_0145387 | Ga0495686_0145387_386_1183 | 259 |
| 410 | 3300048090 | Ga0495615_0000110 | Ga0495615_0000110_8340_9119 | 259 |
| 411 | 3300048091 | Ga0495626_0000808 | Ga0495626_0000808_14426_15205 | 259 |
| 412 | 3300048905 | Ga0496102_0000355 | Ga0496102_0000355_28119_28898 | 259 |
| 413 | 3300048906 | Ga0496103_0000600 | Ga0496103_0000600_6340_7119 | 259 |
| 414 | 3300048908 | Ga0496105_0003182 | Ga0496105_0003182_10157_10936 | 259 |
| 415 | 3300048917 | Ga0496114_0011207 | Ga0496114_0011207_4463_5242 | 259 |
| 416 | 3300048918 | Ga0496115_0000220 | Ga0496115_0000220_23665_24444 | 259 |
| 417 | 3300048919 | Ga0496116_0000153 | Ga0496116_0000153_60035_60820 | 259 |
| 418 | 3300048919 | Ga0496116_0003279 | Ga0496116_0003279_25_804 | 259 |
| 419 | 3300048920 | Ga0496117_0000715 | Ga0496117_0000715_23586_24365 | 259 |
| 420 | 3300048921 | Ga0496118_0000130 | Ga0496118_0000130_108828_109607 | 259 |
| 421 | 3300048921 | Ga0496118_0177961 | Ga0496118_0177961_312_1097 | 259 |
| 422 | 3300048922 | Ga0496119_0011789 | Ga0496119_0011789_787_1566 | 259 |
| 423 | 3300048923 | Ga0496120_0099949 | Ga0496120_0099949_217_996 | 259 |
| 424 | 3300048924 | Ga0496121_0000163 | Ga0496121_0000163_98650_99432 | 259 |
| 425 | 3300048924 | Ga0496121_0000375 | Ga0496121_0000375_13466_14245 | 259 |
| 426 | 3300048925 | Ga0496122_0000094 | Ga0496122_0000094_60035_60820 | 259 |
| 427 | 3300048925 | Ga0496122_0011330 | Ga0496122_0011330_1785_2564 | 259 |
| 428 | 3300048926 | Ga0496123_0001954 | Ga0496123_0001954_25038_25823 | 259 |
| 429 | 3300048927 | Ga0496124_0000129 | Ga0496124_0000129_93871_94650 | 259 |
| 430 | 3300048927 | Ga0496124_0000163 | Ga0496124_0000163_23479_24258 | 259 |
| 431 | 3300048927 | Ga0496124_0001695 | Ga0496124_0001695_24743_25528 | 259 |
| 432 | 3300048928 | Ga0496125_0001699 | Ga0496125_0001699_27089_27868 | 259 |
| 433 | 3300048928 | Ga0496125_0018631 | Ga0496125_0018631_5034_5819 | 259 |
| 434 | 3300048929 | Ga0496126_0000361 | Ga0496126_0000361_13212_13991 | 259 |
| 435 | 3300048929 | Ga0496126_0000517 | Ga0496126_0000517_51847_52632 | 259 |
| 436 | 3300049570 | Ga0501033_0152463 | Ga0501033_0152463_178_1020 | 259 |
| 437 | 3300049766 | Ga0501269_020829 | Ga0501269_020829_14_793 | 259 |
| 438 | 3300050489 | nmdc:mga03683_6_c1 | nmdc:mga03683_6_c1_113717_114496 | 259 |
| 439 | 3300050490 | nmdc:mga03n38_648_c1 | nmdc:mga03n38_648_c1_7271_8050 | 259 |
| 440 | 3300050491 | nmdc:mga00v17_10848_c1 | nmdc:mga00v17_10848_c1_3634_4413 | 259 |
| 441 | 3300050493 | nmdc:mga0k408_25027_c1 | nmdc:mga0k408_25027_c1_2491_3270 | 259 |
| 442 | 3300050493 | nmdc:mga0k408_6_c1 | nmdc:mga0k408_6_c1_85553_86332 | 259 |
| 443 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_322677_323456 | 259 |
| 444 | 3300050496 | nmdc:mga07m45_9729_c1 | nmdc:mga07m45_9729_c1_3352_4146 | 259 |
| 445 | 3300050509 | nmdc:mga0qj67_13182_c1 | nmdc:mga0qj67_13182_c1_4056_4835 | 259 |
| 446 | 3300050516 | nmdc:mga0sz30_405_c2 | nmdc:mga0sz30_405_c2_4168_4947 | 259 |
| 447 | 3300053079 | Ga0500610_0000240 | Ga0500610_0000240_1097_1876 | 259 |
| 448 | 3300053087 | Ga0500643_000170 | Ga0500643_000170_51096_51884 | 259 |
| 449 | 3300053087 | Ga0500643_003016 | Ga0500643_003016_5124_5960 | 259 |
| 450 | 3300053087 | Ga0500643_038037 | Ga0500643_038037_148_927 | 259 |
| 451 | 3300053104 | Ga0500556_0000197 | Ga0500556_0000197_37758_38537 | 259 |
| 452 | 3300053119 | Ga0500595_000771 | Ga0500595_000771_9979_10758 | 259 |
| 453 | 3300053119 | Ga0500595_002186 | Ga0500595_002186_40_819 | 259 |
| 454 | 3300053122 | Ga0500608_002121 | Ga0500608_002121_1664_2443 | 259 |
| 455 | 3300053122 | Ga0500608_102298 | Ga0500608_102298_212_991 | 259 |
| 456 | 3300053130 | Ga0500642_0000011 | Ga0500642_0000011_155709_156488 | 259 |
| 457 | 3300053130 | Ga0500642_0005700 | Ga0500642_0005700_3234_4013 | 259 |
| 458 | 3300053136 | Ga0500559_0002171 | Ga0500559_0002171_4034_4822 | 259 |
| 459 | 3300053148 | Ga0500590_012706 | Ga0500590_012706_3495_4274 | 259 |
| 460 | 3300053153 | Ga0500616_0004901 | Ga0500616_0004901_2552_3331 | 259 |
| 461 | 3300053177 | Ga0500636_0000688 | Ga0500636_0000688_14794_15573 | 259 |
| 462 | 3300053730 | Ga0500645_000005 | Ga0500645_000005_213980_214759 | 259 |
| 463 | 3300053730 | Ga0500645_000623 | Ga0500645_000623_926_1705 | 259 |
| 464 | 3300053730 | Ga0500645_004752 | Ga0500645_004752_1452_2231 | 259 |
| 465 | 3300053730 | Ga0500645_058390 | Ga0500645_058390_33_812 | 259 |
| 466 | 3300053735 | Ga0500596_001793 | Ga0500596_001793_914_1693 | 259 |
| 467 | 3300055283 | Ga0500661_000121 | Ga0500661_000121_5761_6549 | 259 |
| 468 | 3300005289 | Ga0065704_10073345 | Ga0065704_100733459 | 260 |
| 469 | 3300005328 | Ga0070676_10253407 | Ga0070676_102534072 | 260 |
| 470 | 3300005331 | Ga0070670_100066087 | Ga0070670_1000660873 | 260 |
| 471 | 3300005339 | Ga0070660_100036682 | Ga0070660_1000366824 | 260 |
| 472 | 3300005347 | Ga0070668_100010521 | Ga0070668_1000105218 | 260 |
| 473 | 3300005353 | Ga0070669_100002467 | Ga0070669_10000246710 | 260 |
| 474 | 3300005354 | Ga0070675_100006637 | Ga0070675_1000066372 | 260 |
| 475 | 3300005355 | Ga0070671_100004503 | Ga0070671_10000450310 | 260 |
| 476 | 3300005355 | Ga0070671_100166863 | Ga0070671_1001668632 | 260 |
| 477 | 3300005366 | Ga0070659_100071834 | Ga0070659_1000718342 | 260 |
| 478 | 3300005367 | Ga0070667_100026707 | Ga0070667_1000267072 | 260 |
| 479 | 3300005548 | Ga0070665_100000541 | Ga0070665_1000005412 | 260 |
| 480 | 3300005548 | Ga0070665_100003938 | Ga0070665_10000393810 | 260 |
| 481 | 3300005563 | Ga0068855_100437857 | Ga0068855_1004378572 | 260 |
| 482 | 3300005841 | Ga0068863_100056547 | Ga0068863_1000565472 | 260 |
| 483 | 3300005842 | Ga0068858_100016988 | Ga0068858_1000169884 | 260 |
| 484 | 3300005843 | Ga0068860_100030305 | Ga0068860_1000303051 | 260 |
| 485 | 3300005844 | Ga0068862_100006298 | Ga0068862_10000629811 | 260 |
| 486 | 3300005844 | Ga0068862_100031066 | Ga0068862_1000310664 | 260 |
| 487 | 3300006051 | Ga0075364_10215639 | Ga0075364_102156392 | 260 |
| 488 | 3300006195 | Ga0075366_10198712 | Ga0075366_101987122 | 260 |
| 489 | 3300009011 | Ga0105251_10000276 | Ga0105251_1000027629 | 260 |
| 490 | 3300009093 | Ga0105240_10000352 | Ga0105240_1000035250 | 260 |
| 491 | 3300009093 | Ga0105240_10075423 | Ga0105240_100754232 | 260 |
| 492 | 3300009101 | Ga0105247_10042730 | Ga0105247_100427303 | 260 |
| 493 | 3300009148 | Ga0105243_10490852 | Ga0105243_104908522 | 260 |
| 494 | 3300009177 | Ga0105248_10026581 | Ga0105248_100265812 | 260 |
| 495 | 3300009545 | Ga0105237_10019944 | Ga0105237_100199443 | 260 |
| 496 | 3300010375 | Ga0105239_10000207 | Ga0105239_1000020721 | 260 |
| 497 | 3300025735 | Ga0207713_1002506 | Ga0207713_10025064 | 260 |
| 498 | 3300025900 | Ga0207710_10088541 | Ga0207710_100885412 | 260 |
| 499 | 3300025901 | Ga0207688_10290873 | Ga0207688_102908731 | 260 |
| 500 | 3300025907 | Ga0207645_10362905 | Ga0207645_103629051 | 260 |
| 501 | 3300025913 | Ga0207695_10000434 | Ga0207695_1000043430 | 260 |
| 502 | 3300025913 | Ga0207695_10139251 | Ga0207695_101392512 | 260 |
| 503 | 3300025914 | Ga0207671_10000955 | Ga0207671_100009553 | 260 |
| 504 | 3300025919 | Ga0207657_10050512 | Ga0207657_100505122 | 260 |
| 505 | 3300025923 | Ga0207681_10003059 | Ga0207681_100030594 | 260 |
| 506 | 3300025931 | Ga0207644_10000367 | Ga0207644_1000036728 | 260 |
| 507 | 3300025931 | Ga0207644_10032521 | Ga0207644_100325212 | 260 |
| 508 | 3300025931 | Ga0207644_10116967 | Ga0207644_101169672 | 260 |
| 509 | 3300025933 | Ga0207706_10061908 | Ga0207706_100619083 | 260 |
| 510 | 3300025935 | Ga0207709_10289951 | Ga0207709_102899512 | 260 |
| 511 | 3300025941 | Ga0207711_10021765 | Ga0207711_100217656 | 260 |
| 512 | 3300025986 | Ga0207658_10019407 | Ga0207658_100194074 | 260 |
| 513 | 3300026035 | Ga0207703_10088800 | Ga0207703_100888004 | 260 |
| 514 | 3300026041 | Ga0207639_10114152 | Ga0207639_101141522 | 260 |
| 515 | 3300026088 | Ga0207641_10004669 | Ga0207641_100046698 | 260 |
| 516 | 3300028379 | Ga0268266_10001691 | Ga0268266_1000169119 | 260 |
| 517 | 3300028379 | Ga0268266_10018808 | Ga0268266_100188082 | 260 |
| 518 | 3300028380 | Ga0268265_10151490 | Ga0268265_101514903 | 260 |
| 519 | 3300032004 | Ga0307414_10001099 | Ga0307414_1000109913 | 260 |
| 520 | 3300046525 | Ga0495663_0000001 | Ga0495663_0000001_557884_558666 | 260 |
| 521 | 3300046558 | Ga0495633_0000179 | Ga0495633_0000179_55339_56121 | 260 |
| 522 | 3300047472 | Ga0495686_0000293 | Ga0495686_0000293_27810_28592 | 260 |
| 523 | 3300048905 | Ga0496102_0487663 | Ga0496102_0487663_252_1034 | 260 |
| 524 | 3300048906 | Ga0496103_0001474 | Ga0496103_0001474_7861_8643 | 260 |
| 525 | 3300048919 | Ga0496116_0021122 | Ga0496116_0021122_452_1234 | 260 |
| 526 | 3300048920 | Ga0496117_0034667 | Ga0496117_0034667_1659_2441 | 260 |
| 527 | 3300048920 | Ga0496117_0098213 | Ga0496117_0098213_333_1115 | 260 |
| 528 | 3300048921 | Ga0496118_0188933 | Ga0496118_0188933_131_913 | 260 |
| 529 | 3300048921 | Ga0496118_0248400 | Ga0496118_0248400_128_910 | 260 |
| 530 | 3300048922 | Ga0496119_0025914 | Ga0496119_0025914_900_1682 | 260 |
| 531 | 3300048922 | Ga0496119_0049394 | Ga0496119_0049394_223_1005 | 260 |
| 532 | 3300048923 | Ga0496120_0188536 | Ga0496120_0188536_75_857 | 260 |
| 533 | 3300048924 | Ga0496121_0001839 | Ga0496121_0001839_21055_21837 | 260 |
| 534 | 3300048924 | Ga0496121_0014109 | Ga0496121_0014109_2668_3450 | 260 |
| 535 | 3300048926 | Ga0496123_0033133 | Ga0496123_0033133_1274_2056 | 260 |
| 536 | 3300048927 | Ga0496124_0276592 | Ga0496124_0276592_306_1088 | 260 |
| 537 | 3300048929 | Ga0496126_0005027 | Ga0496126_0005027_13739_14521 | 260 |
| 538 | 3300048929 | Ga0496126_0089546 | Ga0496126_0089546_1368_2150 | 260 |
| 539 | 3300048929 | Ga0496126_0266045 | Ga0496126_0266045_435_1217 | 260 |
| 540 | 2162886007 | SwRhRL2b_contig_3948926 | SwRhRL2b_0218.00005250 | 261 |
| 541 | 3300005289 | Ga0065704_10070184 | Ga0065704_1007018469 | 261 |
| 542 | 3300005295 | Ga0065707_10106588 | Ga0065707_101065884 | 261 |
| 543 | 3300005355 | Ga0070671_100059782 | Ga0070671_1000597823 | 261 |
| 544 | 3300005367 | Ga0070667_100008960 | Ga0070667_1000089602 | 261 |
| 545 | 3300005455 | Ga0070663_100624669 | Ga0070663_1006246691 | 261 |
| 546 | 3300005457 | Ga0070662_100037104 | Ga0070662_1000371044 | 261 |
| 547 | 3300005841 | Ga0068863_100001079 | Ga0068863_10000107929 | 261 |
| 548 | 3300005843 | Ga0068860_100024116 | Ga0068860_1000241162 | 261 |
| 549 | 3300005843 | Ga0068860_100107503 | Ga0068860_1001075033 | 261 |
| 550 | 3300006058 | Ga0075432_10026257 | Ga0075432_100262572 | 261 |
| 551 | 3300006353 | Ga0075370_10089537 | Ga0075370_100895372 | 261 |
| 552 | 3300006946 | Ga0079104_1018747 | Ga0079104_10187473 | 261 |
| 553 | 3300025298 | Ga0209050_1000685 | Ga0209050_100068541 | 261 |
| 554 | 3300025904 | Ga0207647_10053387 | Ga0207647_100533874 | 261 |
| 555 | 3300025907 | Ga0207645_10036051 | Ga0207645_100360512 | 261 |
| 556 | 3300025986 | Ga0207658_10002737 | Ga0207658_100027379 | 261 |
| 557 | 3300026088 | Ga0207641_10002412 | Ga0207641_100024122 | 261 |
| 558 | 3300027111 | Ga0209281_1012494 | Ga0209281_10124943 | 261 |
| 559 | 3300028381 | Ga0268264_10017221 | Ga0268264_100172213 | 261 |
| 560 | 3300028381 | Ga0268264_10081902 | Ga0268264_100819023 | 261 |
| 561 | 3300046453 | Ga0495627_001091 | Ga0495627_001091_15084_15869 | 261 |
| 562 | 3300046471 | Ga0495650_0001028 | Ga0495650_0001028_11679_12464 | 261 |
| 563 | 3300046500 | Ga0495596_0000437 | Ga0495596_0000437_18492_19289 | 261 |
| 564 | 3300046501 | Ga0495607_0006033 | Ga0495607_0006033_7106_7903 | 261 |
| 565 | 3300046506 | Ga0495583_0037970 | Ga0495583_0037970_1389_2186 | 261 |
| 566 | 3300046507 | Ga0495606_0007211 | Ga0495606_0007211_8407_9204 | 261 |
| 567 | 3300046512 | Ga0495610_0000015 | Ga0495610_0000015_173703_174488 | 261 |
| 568 | 3300046512 | Ga0495610_0000136 | Ga0495610_0000136_6419_7204 | 261 |
| 569 | 3300046515 | Ga0495620_0035031 | Ga0495620_0035031_826_1611 | 261 |
| 570 | 3300046518 | Ga0495631_0090143 | Ga0495631_0090143_126_911 | 261 |
| 571 | 3300046519 | Ga0495632_0000351 | Ga0495632_0000351_26459_27244 | 261 |
| 572 | 3300046519 | Ga0495632_0032070 | Ga0495632_0032070_1343_2140 | 261 |
| 573 | 3300046522 | Ga0495643_0000048 | Ga0495643_0000048_211714_212499 | 261 |
| 574 | 3300046522 | Ga0495643_0061031 | Ga0495643_0061031_485_1282 | 261 |
| 575 | 3300046530 | Ga0495654_0026433 | Ga0495654_0026433_546_1331 | 261 |
| 576 | 3300046538 | Ga0495609_0004502 | Ga0495609_0004502_3929_4726 | 261 |
| 577 | 3300047470 | Ga0495681_0000445 | Ga0495681_0000445_18990_19775 | 261 |
| 578 | 3300048924 | Ga0496121_0004929 | Ga0496121_0004929_3029_3847 | 261 |
| 579 | 3300048929 | Ga0496126_0183536 | Ga0496126_0183536_335_1126 | 261 |
| 580 | 3300053087 | Ga0500643_007836 | Ga0500643_007836_3331_4122 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.9401 | 1 | 261 |
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.9366 | 1 | 261 |
| 8tid-assembly1.cif.gz_H | combined linker domain of n-drc and associated proteins tetrahymena | 0.833 | 131 | 191 |
| 5lq7-assembly1.cif.gz_A | salmonella effector spvd - g161 variant | 0.7367 | 184 | 218 |
| 8j07-assembly1.cif.gz_7 | 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes | 0.7193 | 131 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3isrC01 | Alpha Beta;Roll;C8orf32 fold; | 0.8851 | 79 | 249 | 3.10.620.30 |
| af_P71734_77_269_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8334 | 76 | 238 | 3.10.620.30 |
| af_P9WL93_122_301_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8295 | 95 | 238 | 3.10.620.30 |
| 3isrD02 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8281 | 3 | 78 | 2.60.40.2250 |
| 3isrC01 | Alpha Beta;Roll;C8orf32 fold; | 0.82 | 79 | 249 | 3.10.620.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G2IKF2-F1-model_v4 | Transglutaminase-like domain-containing protein | 0.9962 | 1 | 258 |
|
| AF-A0A6I4SXY9-F1-model_v4 | Transglutaminase family protein | 0.9962 | 1 | 258 |
|
| AF-A0A4Q2Z976-F1-model_v4 | Transglutaminase family protein | 0.9956 | 147 | 258 |
|
| AF-A0A5B9EHM9-F1-model_v4 | Transglutaminase family protein | 0.9952 | 1 | 258 |
|
| AF-A4ADC0-F1-model_v4 | Transglutaminase-like enzyme, putative cysteine protease | 0.9942 | 1 | 259 |
GO:0006508
GO:0008233 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar