F465997

General Info

Members Datasets Scaffolds Average Seq Length
580 285 572 260

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0055188|Ga0495686_0055188_1296_2222
Length 308
Sequence LVLADTAPDADYGPSVRTDSAPCGSIFQNISLARRSNGALDPPVRQRKCQPMKISIEAWLDYEFDHPTDVLLQVEAAMIPEQIVNGYIDITQGEHFARVPAHDSIGDRLWVRIQGRLVVDYRATVIVDRVLADVRTLPAVPPHQLPGETVQYLMPSRYCPSDQFQTFVDAEFGSLQGGARVAALRDWVEQSFAYVPGSSSGDTTALDTFVKRQGVCRDYAHVIITLVRASGIPARIASVYALGVEPQDFHAVAEVFLHGAWHLVDATGMATQGGMAKIGVGRDAADVAFLTAYGAARMNAQAVSVWPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
7 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
8 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
280 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
282 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
283 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
284 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
285 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.38
Nodule 0.52
Rhizoplane 1.9
Rhizosphere 63.79
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3948926 2162886007 Bacteria 15742
2 JGI24740J21852_10054649 3300001979 Bacteria 1126
3 JGI24737J22298_10029377 3300001990 Bacteria 1724
4 JGI24743J22301_10008524 3300001991 Bacteria 1799
5 JGI25153J46596_10000005 3300003215 Bacteria 492839
6 rootL2_10085789 3300003322 Bacteria 4954
7 rootL2_10156435 3300003322 Bacteria 2712
8 rootL2_10275880 3300003322 Bacteria 1029
9 Ga0055525_1000037 3300003759 Bacteria 297990
10 Ga0055542_1000293 3300003762 Bacteria 55815
11 Ga0055529_1000034 3300003763 Bacteria 244657
12 Ga0055526_1007131 3300003771 Bacteria 5892
13 Ga0055537_1000848 3300003773 Bacteria 14862
14 Ga0055530_10008155 3300003791 Bacteria 4248
15 Ga0055540_1000185 3300003792 Bacteria 60356
16 Ga0055531_10000088 3300003794 Bacteria 100973
17 Ga0065704_10003847 3300005289 Bacteria 5648
18 Ga0065704_10070184 3300005289 Bacteria 119655
19 Ga0065704_10073345 3300005289 Bacteria 7273
20 Ga0065707_10094490 3300005295 Bacteria 3491
21 Ga0065707_10106588 3300005295 Bacteria 2590
22 Ga0070658_10001641 3300005327 Bacteria 18905
23 Ga0070658_10007930 3300005327 Bacteria 8550
24 Ga0070658_10125667 3300005327 Bacteria 2134
25 Ga0070676_10000161 3300005328 Bacteria 27014
26 Ga0070676_10253407 3300005328 Bacteria 1175
27 Ga0070670_100066087 3300005331 Bacteria 3102
28 Ga0070670_100291266 3300005331 Unclassified 1427
29 Ga0068869_100001393 3300005334 Bacteria 14279
30 Ga0068869_100428710 3300005334 Bacteria 1092
31 Ga0070666_10025030 3300005335 Bacteria 3890
32 Ga0070666_10037896 3300005335 Unclassified 3207
33 Ga0070682_100109043 3300005337 Bacteria 1842
34 Ga0068868_100000057 3300005338 Bacteria 62946
35 Ga0070660_100036682 3300005339 Bacteria 3714
36 Ga0070660_100493562 3300005339 Unclassified 1018
37 Ga0070661_100073444 3300005344 Bacteria 2518
38 Ga0070668_100000045 3300005347 Bacteria 77362
39 Ga0070668_100000058 3300005347 Bacteria 69744
40 Ga0070668_100000249 3300005347 Bacteria 35701
41 Ga0070668_100010521 3300005347 Bacteria 6878
42 Ga0070668_100012728 3300005347 Bacteria 6261
43 Ga0070669_100002467 3300005353 Bacteria 13394
44 Ga0070669_100060051 3300005353 Bacteria 2792
45 Ga0070669_100110160 3300005353 Unclassified 2088
46 Ga0070675_100006637 3300005354 Bacteria 8896
47 Ga0070671_100002659 3300005355 Bacteria 13844
48 Ga0070671_100002701 3300005355 Bacteria 13763
49 Ga0070671_100004503 3300005355 Bacteria 11032
50 Ga0070671_100043304 3300005355 Bacteria 3741
51 Ga0070671_100059782 3300005355 Bacteria 3172
52 Ga0070671_100140177 3300005355 Bacteria 2040
53 Ga0070671_100166863 3300005355 Bacteria 1862
54 Ga0070673_100000005 3300005364 Bacteria 193513
55 Ga0070659_100071834 3300005366 Bacteria 2753
56 Ga0070667_100000045 3300005367 Bacteria 164821
57 Ga0070667_100000104 3300005367 Bacteria 106938
58 Ga0070667_100000193 3300005367 Bacteria 72859
59 Ga0070667_100008960 3300005367 Bacteria 8284
60 Ga0070667_100026707 3300005367 Bacteria 4803
61 Ga0070667_100094786 3300005367 Bacteria 2572
62 Ga0070705_100075444 3300005440 Bacteria 2053
63 Ga0070663_100624669 3300005455 Bacteria 908
64 Ga0070678_100094904 3300005456 Bacteria 2297
65 Ga0070662_100037104 3300005457 Bacteria 3453
66 Ga0070662_100072728 3300005457 Bacteria 2539
67 Ga0070662_100151415 3300005457 Bacteria 1806
68 Ga0068867_100000071 3300005459 Bacteria 61808
69 Ga0070685_10001123 3300005466 Bacteria 14320
70 Ga0068853_100001233 3300005539 Bacteria 18261
71 Ga0068853_100032792 3300005539 Bacteria 4403
72 Ga0068853_100161259 3300005539 Bacteria 2024
73 Ga0070672_100065513 3300005543 Bacteria 2874
74 Ga0070686_100066195 3300005544 Bacteria 2349
75 Ga0070665_100000541 3300005548 Bacteria 53057
76 Ga0070665_100003938 3300005548 Bacteria 15667
77 Ga0070665_100549426 3300005548 Bacteria 1167
78 Ga0068855_100000921 3300005563 Bacteria 36597
79 Ga0068855_100138187 3300005563 Bacteria 2779
80 Ga0068855_100394070 3300005563 Bacteria 1518
81 Ga0068855_100437857 3300005563 Bacteria 1428
82 Ga0070664_100402209 3300005564 Bacteria 1252
83 Ga0068857_100013403 3300005577 Bacteria 7141
84 Ga0068854_100022638 3300005578 Bacteria 4286
85 Ga0068856_100305906 3300005614 Bacteria 1608
86 Ga0068852_100303535 3300005616 Bacteria 1546
87 Ga0068852_100532285 3300005616 Bacteria 1173
88 Ga0068859_100022780 3300005617 Bacteria 6280
89 Ga0068859_100112991 3300005617 Plasmid 2780
90 Ga0068864_100035448 3300005618 Plasmid 4248
91 Ga0068861_100000074 3300005719 Bacteria 48480
92 Ga0068851_10061951 3300005834 Bacteria 1918
93 Ga0068870_10245592 3300005840 Bacteria 1107
94 Ga0068863_100000012 3300005841 Bacteria 229774
95 Ga0068863_100000625 3300005841 Bacteria 35818
96 Ga0068863_100001079 3300005841 Bacteria 27286
97 Ga0068863_100022543 3300005841 Bacteria 6013
98 Ga0068863_100038067 3300005841 Bacteria 4577
99 Ga0068863_100056547 3300005841 Bacteria 3714
100 Ga0068858_100013007 3300005842 Bacteria 7848
101 Ga0068858_100016988 3300005842 Bacteria 6832
102 Ga0068860_100000073 3300005843 Bacteria 173235
103 Ga0068860_100000197 3300005843 Bacteria 96240
104 Ga0068860_100003204 3300005843 Bacteria 16891
105 Ga0068860_100006651 3300005843 Bacteria 11609
106 Ga0068860_100007022 3300005843 Bacteria 11276
107 Ga0068860_100024116 3300005843 Bacteria 5881
108 Ga0068860_100030305 3300005843 Bacteria 5204
109 Ga0068860_100107503 3300005843 Bacteria 2666
110 Ga0068862_100000031 3300005844 Bacteria 180203
111 Ga0068862_100000201 3300005844 Bacteria 66112
112 Ga0068862_100002137 3300005844 Bacteria 17805
113 Ga0068862_100006298 3300005844 Bacteria 9872
114 Ga0068862_100020190 3300005844 Bacteria 5564
115 Ga0068862_100031066 3300005844 Bacteria 4505
116 Ga0068862_100160283 3300005844 Bacteria 2007
117 Ga0081539_10007629 3300005985 Bacteria 9762
118 Ga0075365_10045743 3300006038 Bacteria 2872
119 Ga0075368_10000038 3300006042 Bacteria 30456
120 Ga0075363_100000828 3300006048 Bacteria 10734
121 Ga0075363_100018683 3300006048 Bacteria 3458
122 Ga0075364_10010542 3300006051 Bacteria 5587
123 Ga0075364_10010580 3300006051 Bacteria 5580
124 Ga0075364_10125446 3300006051 Bacteria 1721
125 Ga0075364_10215639 3300006051 Bacteria 1302
126 Ga0075432_10026257 3300006058 Bacteria 2000
127 Ga0075362_10000001 3300006177 Bacteria 215983
128 Ga0075362_10002493 3300006177 Bacteria 6195
129 Ga0075362_10010974 3300006177 Bacteria 3557
130 Ga0075367_10022284 3300006178 Bacteria 3551
131 Ga0075367_10162715 3300006178 Unclassified 1388
132 Ga0075369_10001326 3300006186 Bacteria 8417
133 Ga0075369_10002761 3300006186 Bacteria 6303
134 Ga0075366_10000093 3300006195 Bacteria 35940
135 Ga0075366_10001944 3300006195 Bacteria 10448
136 Ga0075366_10016071 3300006195 Bacteria 4297
137 Ga0075366_10023184 3300006195 Bacteria 3616
138 Ga0075366_10095731 3300006195 Bacteria 1780
139 Ga0075366_10159815 3300006195 Bacteria 1365
140 Ga0075366_10198712 3300006195 Bacteria 1219
141 Ga0097621_100055655 3300006237 Bacteria 3231
142 Ga0075370_10000028 3300006353 Bacteria 50628
143 Ga0075370_10021194 3300006353 Bacteria 3561
144 Ga0075370_10089537 3300006353 Bacteria 1774
145 Ga0075370_10122614 3300006353 Bacteria 1514
146 Ga0075370_10169533 3300006353 Bacteria 1283
147 Ga0068865_100000032 3300006881 Bacteria 88205
148 Ga0097620_100002108 3300006931 Bacteria 20252
149 Ga0097620_100022780 3300006931 Bacteria 6280
150 Ga0097620_100112995 3300006931 Plasmid 2780
151 Ga0079104_1018747 3300006946 Bacteria 1952
152 Ga0079104_1034512 3300006946 Bacteria 1228
153 Ga0105251_10000276 3300009011 Bacteria 51560
154 Ga0105240_10000352 3300009093 Bacteria 86113
155 Ga0105240_10003234 3300009093 Bacteria 25501
156 Ga0105240_10075423 3300009093 Bacteria 4160
157 Ga0105245_10005496 3300009098 Bacteria 11132
158 Ga0105247_10008163 3300009101 Bacteria 6393
159 Ga0105247_10042730 3300009101 Bacteria 2776
160 Ga0105243_10000030 3300009148 Bacteria 190342
161 Ga0105243_10002022 3300009148 Bacteria 17230
162 Ga0105243_10490852 3300009148 Bacteria 1161
163 Ga0105241_10004167 3300009174 Bacteria 10674
164 Ga0105242_10002453 3300009176 Bacteria 14548
165 Ga0105242_10202299 3300009176 Bacteria 1765
166 Ga0105248_10026581 3300009177 Bacteria 6437
167 Ga0105248_10045340 3300009177 Bacteria 4931
168 Ga0105248_10049647 3300009177 Bacteria 4706
169 Ga0105248_10209029 3300009177 Bacteria 2199
170 Ga0105248_10289435 3300009177 Bacteria 1845
171 Ga0105248_10477183 3300009177 Bacteria 1406
172 Ga0105248_11005998 3300009177 Bacteria 942
173 Ga0105237_10019944 3300009545 Bacteria 6921
174 Ga0105237_10322615 3300009545 Unclassified 1548
175 Ga0105238_10145546 3300009551 Unclassified 2346
176 Ga0105249_10000043 3300009553 Bacteria 192155
177 Ga0105249_10000350 3300009553 Bacteria 46331
178 Ga0105249_10019121 3300009553 Bacteria 6109
179 Ga0105239_10000207 3300010375 Bacteria 86761
180 Ga0105239_10069640 3300010375 Bacteria 3865
181 Ga0105239_10389935 3300010375 Unclassified 1575
182 Ga0105246_10001784 3300011119 Bacteria 12867
183 Ga0157371_10000043 3300013102 Bacteria 197887
184 Ga0157374_10001126 3300013296 Bacteria 22949
185 Ga0157378_10002231 3300013297 Bacteria 17188
186 Ga0163162_10229848 3300013306 Bacteria 1985
187 Ga0157372_10279731 3300013307 Bacteria 1940
188 Ga0157375_10003871 3300013308 Bacteria 12989
189 Ga0157380_10419457 3300014326 Bacteria 1276
190 Ga0157376_10000450 3300014969 Bacteria 26578
191 Ga0163161_10106800 3300017792 Bacteria 2089
192 Ga0213875_10000597 3300021388 Bacteria 29183
193 Ga0209147_100631 3300025229 Bacteria 18914
194 Ga0209563_100053 3300025230 Bacteria 332370
195 Ga0209677_106945 3300025253 Bacteria 2543
196 Ga0209148_1000093 3300025254 Bacteria 245339
197 Ga0209565_1000264 3300025263 Bacteria 54985
198 Ga0209455_1000045 3300025272 Bacteria 383329
199 Ga0209673_1025307 3300025273 Bacteria 1976
200 Ga0209676_1000288 3300025292 Bacteria 103217
201 Ga0209564_1000378 3300025295 Bacteria 81676
202 Ga0209758_1000001 3300025297 Bacteria 1981790
203 Ga0209050_1000001 3300025298 Bacteria 3563507
204 Ga0209050_1000685 3300025298 Bacteria 50959
205 Ga0209051_1000209 3300025303 Bacteria 102832
206 Ga0209257_1000111 3300025304 Bacteria 234809
207 Ga0207713_1002506 3300025735 Bacteria 13305
208 Ga0207710_10008636 3300025900 Bacteria 4295
209 Ga0207710_10088541 3300025900 Bacteria 1446
210 Ga0207688_10290873 3300025901 Bacteria 997
211 Ga0207680_10002301 3300025903 Bacteria 8902
212 Ga0207680_10069791 3300025903 Unclassified 2172
213 Ga0207647_10053387 3300025904 Bacteria 2491
214 Ga0207645_10000752 3300025907 Bacteria 26968
215 Ga0207645_10036051 3300025907 Bacteria 3175
216 Ga0207645_10362905 3300025907 Bacteria 970
217 Ga0207705_10000022 3300025909 Bacteria 302232
218 Ga0207705_10000325 3300025909 Bacteria 43398
219 Ga0207654_10001035 3300025911 Bacteria 15216
220 Ga0207695_10000434 3300025913 Bacteria 91902
221 Ga0207695_10012304 3300025913 Bacteria 10280
222 Ga0207695_10093847 3300025913 Bacteria 3009
223 Ga0207695_10139251 3300025913 Bacteria 2377
224 Ga0207671_10000955 3300025914 Bacteria 35890
225 Ga0207660_10211446 3300025917 Unclassified 1519
226 Ga0207657_10050512 3300025919 Bacteria 3619
227 Ga0207657_10304910 3300025919 Bacteria 1261
228 Ga0207649_10000441 3300025920 Bacteria 30004
229 Ga0207681_10003059 3300025923 Bacteria 10513
230 Ga0207681_10007162 3300025923 Bacteria 6842
231 Ga0207681_10083914 3300025923 Unclassified 2256
232 Ga0207681_10247204 3300025923 Bacteria 1391
233 Ga0207694_10024498 3300025924 Unclassified 4584
234 Ga0207650_10122177 3300025925 Bacteria 2029
235 Ga0207650_10353055 3300025925 Unclassified 1210
236 Ga0207687_10002234 3300025927 Bacteria 13189
237 Ga0207644_10000070 3300025931 Bacteria 74994
238 Ga0207644_10000367 3300025931 Bacteria 29435
239 Ga0207644_10003667 3300025931 Bacteria 9957
240 Ga0207644_10032521 3300025931 Bacteria 3640
241 Ga0207644_10109353 3300025931 Bacteria 2088
242 Ga0207644_10116967 3300025931 Bacteria 2024
243 Ga0207690_10076194 3300025932 Bacteria 2328
244 Ga0207706_10061908 3300025933 Unclassified 3296
245 Ga0207686_10000786 3300025934 Bacteria 19463
246 Ga0207709_10000018 3300025935 Bacteria 431545
247 Ga0207709_10000276 3300025935 Bacteria 59937
248 Ga0207709_10289951 3300025935 Bacteria 1212
249 Ga0207669_10000051 3300025937 Bacteria 58489
250 Ga0207704_10000034 3300025938 Bacteria 98810
251 Ga0207691_10126982 3300025940 Bacteria 2256
252 Ga0207711_10021765 3300025941 Bacteria 5354
253 Ga0207711_10025856 3300025941 Bacteria 4923
254 Ga0207711_10105106 3300025941 Bacteria 2503
255 Ga0207711_10213331 3300025941 Bacteria 1764
256 Ga0207689_10005357 3300025942 Bacteria 11487
257 Ga0207679_10490815 3300025945 Bacteria 1095
258 Ga0207667_10000069 3300025949 Bacteria 180683
259 Ga0207667_10000762 3300025949 Bacteria 41863
260 Ga0207667_10295899 3300025949 Bacteria 1654
261 Ga0207651_10000010 3300025960 Bacteria 193754
262 Ga0207651_10012864 3300025960 Bacteria 4758
263 Ga0207712_10000095 3300025961 Bacteria 102251
264 Ga0207712_10000299 3300025961 Bacteria 46419
265 Ga0207712_10237546 3300025961 Bacteria 1466
266 Ga0207668_10000061 3300025972 Bacteria 89620
267 Ga0207668_10000103 3300025972 Bacteria 60096
268 Ga0207668_10000224 3300025972 Bacteria 38508
269 Ga0207668_10043335 3300025972 Bacteria 3053
270 Ga0207640_10001299 3300025981 Bacteria 13555
271 Ga0207658_10000025 3300025986 Bacteria 182470
272 Ga0207658_10000042 3300025986 Bacteria 134223
273 Ga0207658_10001305 3300025986 Bacteria 19652
274 Ga0207658_10002737 3300025986 Bacteria 12730
275 Ga0207658_10019407 3300025986 Bacteria 4702
276 Ga0207677_10000296 3300026023 Bacteria 37224
277 Ga0207703_10088800 3300026035 Bacteria 2595
278 Ga0207639_10000879 3300026041 Bacteria 20389
279 Ga0207639_10114152 3300026041 Bacteria 2207
280 Ga0207639_10182313 3300026041 Bacteria 1787
281 Ga0207678_10104819 3300026067 Bacteria 2413
282 Ga0207702_10061014 3300026078 Bacteria 3215
283 Ga0207641_10000024 3300026088 Bacteria 250751
284 Ga0207641_10000046 3300026088 Bacteria 180836
285 Ga0207641_10002412 3300026088 Bacteria 17264
286 Ga0207641_10002537 3300026088 Bacteria 16800
287 Ga0207641_10002760 3300026088 Bacteria 16013
288 Ga0207641_10004669 3300026088 Bacteria 11816
289 Ga0207641_10019262 3300026088 Bacteria 5600
290 Ga0207641_10557979 3300026088 Bacteria 1117
291 Ga0207648_10000219 3300026089 Bacteria 61792
292 Ga0207648_10094248 3300026089 Bacteria 2618
293 Ga0207676_10013562 3300026095 Bacteria 5850
294 Ga0207674_10000811 3300026116 Bacteria 40585
295 Ga0207675_100000244 3300026118 Bacteria 51844
296 Ga0207683_10004084 3300026121 Bacteria 12604
297 Ga0207698_10148081 3300026142 Bacteria 2033
298 Ga0209281_1012494 3300027111 Bacteria 1863
299 Ga0209813_10000097 3300027866 Bacteria 32642
300 Ga0268266_10001691 3300028379 Bacteria 25327
301 Ga0268266_10018808 3300028379 Bacteria 5887
302 Ga0268265_10000189 3300028380 Bacteria 73017
303 Ga0268265_10000219 3300028380 Bacteria 66148
304 Ga0268265_10001219 3300028380 Bacteria 22338
305 Ga0268265_10028451 3300028380 Bacteria 4001
306 Ga0268265_10083120 3300028380 Bacteria 2534
307 Ga0268265_10151490 3300028380 Bacteria 1956
308 Ga0268264_10000120 3300028381 Bacteria 191138
309 Ga0268264_10000190 3300028381 Bacteria 127747
310 Ga0268264_10000906 3300028381 Bacteria 31144
311 Ga0268264_10001482 3300028381 Bacteria 21904
312 Ga0268264_10002998 3300028381 Bacteria 14650
313 Ga0268264_10013675 3300028381 Bacteria 6681
314 Ga0268264_10017221 3300028381 Bacteria 5919
315 Ga0268264_10081902 3300028381 Bacteria 2760
316 Ga0307517_10024263 3300028786 Bacteria 7487
317 Ga0307517_10086720 3300028786 Bacteria 2609
318 Ga0307513_10055632 3300031456 Bacteria 4232
319 Ga0307513_10158317 3300031456 Bacteria 2161
320 Ga0307508_10012591 3300031616 Bacteria 7737
321 Ga0307516_10260692 3300031730 Bacteria 1424
322 Ga0307405_10065008 3300031731 Bacteria 2320
323 Ga0307405_10073789 3300031731 Bacteria 2204
324 Ga0307405_10126652 3300031731 Bacteria 1757
325 Ga0307413_10076268 3300031824 Bacteria 2130
326 Ga0307413_10236219 3300031824 Bacteria 1346
327 Ga0307410_10043240 3300031852 Bacteria 2984
328 Ga0307410_10076071 3300031852 Bacteria 2342
329 Ga0307410_10134113 3300031852 Bacteria 1823
330 Ga0307410_10297182 3300031852 Bacteria 1273
331 Ga0307407_10168405 3300031903 Bacteria 1440
332 Ga0307412_10000269 3300031911 Bacteria 33304
333 Ga0307412_10019146 3300031911 Bacteria 4137
334 Ga0307412_10053673 3300031911 Bacteria 2672
335 Ga0307412_10225870 3300031911 Bacteria 1438
336 Ga0307409_100006293 3300031995 Bacteria 6957
337 Ga0307409_100239418 3300031995 Bacteria 1651
338 Ga0307416_100135793 3300032002 Bacteria 2224
339 Ga0307416_100533100 3300032002 Bacteria 1244
340 Ga0307414_10001099 3300032004 Bacteria 13830
341 Ga0307414_10019084 3300032004 Bacteria 4242
342 Ga0307414_10431461 3300032004 Bacteria 1151
343 Ga0307411_10006123 3300032005 Bacteria 5984
344 Ga0307411_10405463 3300032005 Bacteria 1128
345 Ga0307415_100039053 3300032126 Bacteria 3133
346 Ga0307415_100436402 3300032126 Bacteria 1128
347 Ga0373960_0038895 3300035121 Bacteria 1366
348 Ga0316584_0146641 3300036712 Bacteria 1758
349 Ga0237819_00887 3300038705 Bacteria 9342
350 Ga0451793_0281662 3300041452 Bacteria 1582
351 Ga0451802_0164837 3300041460 Bacteria 4076
352 Ga0451806_084591 3300041462 Bacteria 1317
353 Ga0451807_1856970 3300041486 Bacteria 1282
354 Ga0451841_0113193 3300041498 Bacteria 1021
355 Ga0451841_0820137 3300041498 Bacteria 1190
356 Ga0451845_0938299 3300041501 Bacteria 929
357 Ga0451853_3609454 3300041512 Bacteria 984
358 Ga0451576_0000024 3300045051 Bacteria 470499
359 Ga0495617_051980 3300046452 Bacteria 1362
360 Ga0495627_000632 3300046453 Bacteria 27766
361 Ga0495627_001091 3300046453 Bacteria 17754
362 Ga0495638_0030364 3300046460 Bacteria 3480
363 Ga0495650_0001028 3300046471 Bacteria 31367
364 Ga0495650_0001055 3300046471 Bacteria 30638
365 Ga0495650_0001337 3300046471 Bacteria 24602
366 Ga0495585_0002664 3300046492 Bacteria 12507
367 Ga0495596_0000267 3300046500 Bacteria 34545
368 Ga0495596_0000437 3300046500 Bacteria 26720
369 Ga0495607_0006033 3300046501 Bacteria 8583
370 Ga0495583_0000175 3300046506 Bacteria 108912
371 Ga0495583_0001301 3300046506 Bacteria 25981
372 Ga0495583_0037970 3300046506 Bacteria 2279
373 Ga0495606_0000372 3300046507 Bacteria 76478
374 Ga0495606_0007211 3300046507 Bacteria 10022
375 Ga0495606_0049115 3300046507 Bacteria 2770
376 Ga0495606_0065335 3300046507 Bacteria 2312
377 Ga0495606_0092317 3300046507 Bacteria 1859
378 Ga0495610_0000015 3300046512 Bacteria 391489
379 Ga0495610_0000136 3300046512 Bacteria 82060
380 Ga0495620_0035031 3300046515 Bacteria 2262
381 Ga0495631_0090143 3300046518 Bacteria 1320
382 Ga0495632_0000096 3300046519 Bacteria 89284
383 Ga0495632_0000351 3300046519 Bacteria 43708
384 Ga0495632_0032070 3300046519 Bacteria 2710
385 Ga0495637_0000516 3300046520 Bacteria 28045
386 Ga0495643_0000048 3300046522 Bacteria 212788
387 Ga0495643_0000068 3300046522 Bacteria 172115
388 Ga0495643_0010634 3300046522 Bacteria 5653
389 Ga0495643_0061031 3300046522 Bacteria 2000
390 Ga0495643_0067257 3300046522 Bacteria 1888
391 Ga0495648_0000024 3300046524 Bacteria 235605
392 Ga0495648_0015439 3300046524 Bacteria 5546
393 Ga0495663_0000001 3300046525 Bacteria 595264
394 Ga0495663_0000088 3300046525 Bacteria 40383
395 Ga0495654_0026433 3300046530 Bacteria 2983
396 Ga0495654_0053625 3300046530 Bacteria 1959
397 Ga0495609_0004502 3300046538 Bacteria 7601
398 Ga0495622_0067448 3300046557 Bacteria 1653
399 Ga0495633_0000179 3300046558 Bacteria 82201
400 Ga0495633_0000420 3300046558 Bacteria 44087
401 Ga0495633_0000816 3300046558 Bacteria 27602
402 Ga0495633_0002928 3300046558 Bacteria 11698
403 Ga0495633_0070823 3300046558 Bacteria 1627
404 Ga0495668_0000084 3300046616 Bacteria 153179
405 Ga0495625_0000632 3300046660 Bacteria 50727
406 Ga0495625_0096909 3300046660 Bacteria 2031
407 Ga0495625_0115019 3300046660 Bacteria 1836
408 Ga0495669_0000186 3300046684 Bacteria 38626
409 Ga0495670_0006398 3300046691 Bacteria 5786
410 Ga0495671_0000040 3300046692 Bacteria 167933
411 Ga0495671_0036360 3300046692 Bacteria 2495
412 Ga0495649_0043693 3300046694 Bacteria 2446
413 Ga0495600_0174973 3300046809 Bacteria 1384
414 Ga0495683_0013138 3300047323 Bacteria 4335
415 Ga0495687_000971 3300047443 Bacteria 29198
416 Ga0495687_001338 3300047443 Bacteria 22958
417 Ga0495687_137966 3300047443 Bacteria 853
418 Ga0495681_0000445 3300047470 Bacteria 31682
419 Ga0495681_0013978 3300047470 Bacteria 4629
420 Ga0495686_0000293 3300047472 Bacteria 87130
421 Ga0495686_0000361 3300047472 Bacteria 73548
422 Ga0495686_0001049 3300047472 Bacteria 33132
423 Ga0495686_0001471 3300047472 Bacteria 25626
424 Ga0495686_0007055 3300047472 Bacteria 8473
425 Ga0495686_0013971 3300047472 Bacteria 5551
426 Ga0495686_0022857 3300047472 Bacteria 4132
427 Ga0495686_0029441 3300047472 Bacteria 3572
428 Ga0495686_0047500 3300047472 Bacteria 2710
429 Ga0495686_0055188 3300047472 Bacteria 2486
430 Ga0495686_0116259 3300047472 Bacteria 1599
431 Ga0495686_0145387 3300047472 Bacteria 1396
432 Ga0495615_0000110 3300048090 Bacteria 22096
433 Ga0495626_0000808 3300048091 Bacteria 28273
434 Ga0496102_0000355 3300048905 Bacteria 55552
435 Ga0496102_0487663 3300048905 Bacteria 1154
436 Ga0496103_0000600 3300048906 Bacteria 28303
437 Ga0496103_0001474 3300048906 Bacteria 15742
438 Ga0496105_0003182 3300048908 Bacteria 12095
439 Ga0496114_0011207 3300048917 Bacteria 7159
440 Ga0496115_0000220 3300048918 Bacteria 52439
441 Ga0496116_0000153 3300048919 Bacteria 141137
442 Ga0496116_0003279 3300048919 Bacteria 16096
443 Ga0496116_0021122 3300048919 Bacteria 4918
444 Ga0496117_0000715 3300048920 Bacteria 52465
445 Ga0496117_0009149 3300048920 Bacteria 9285
446 Ga0496117_0034667 3300048920 Bacteria 3800
447 Ga0496117_0098213 3300048920 Bacteria 1862
448 Ga0496118_0000130 3300048921 Bacteria 133250
449 Ga0496118_0005916 3300048921 Bacteria 13682
450 Ga0496118_0008931 3300048921 Bacteria 10231
451 Ga0496118_0177961 3300048921 Bacteria 1289
452 Ga0496118_0188933 3300048921 Unclassified 1234
453 Ga0496118_0248400 3300048921 Bacteria 1012
454 Ga0496119_0011789 3300048922 Bacteria 7181
455 Ga0496119_0018757 3300048922 Bacteria 5131
456 Ga0496119_0025914 3300048922 Bacteria 4081
457 Ga0496119_0049394 3300048922 Bacteria 2601
458 Ga0496120_0019923 3300048923 Bacteria 4278
459 Ga0496120_0099949 3300048923 Bacteria 1535
460 Ga0496120_0188536 3300048923 Bacteria 1007
461 Ga0496121_0000163 3300048924 Bacteria 145648
462 Ga0496121_0000375 3300048924 Bacteria 91802
463 Ga0496121_0001411 3300048924 Bacteria 40702
464 Ga0496121_0001839 3300048924 Bacteria 34202
465 Ga0496121_0004929 3300048924 Bacteria 17507
466 Ga0496121_0014109 3300048924 Bacteria 8516
467 Ga0496121_0043784 3300048924 Bacteria 3871
468 Ga0496122_0000083 3300048925 Bacteria 208744
469 Ga0496122_0000094 3300048925 Bacteria 202047
470 Ga0496122_0002618 3300048925 Bacteria 25206
471 Ga0496122_0011330 3300048925 Bacteria 9048
472 Ga0496123_0000356 3300048926 Bacteria 85832
473 Ga0496123_0001077 3300048926 Bacteria 41258
474 Ga0496123_0001954 3300048926 Bacteria 26794
475 Ga0496123_0033133 3300048926 Bacteria 3724
476 Ga0496124_0000129 3300048927 Bacteria 156648
477 Ga0496124_0000163 3300048927 Bacteria 135337
478 Ga0496124_0000316 3300048927 Bacteria 89321
479 Ga0496124_0000579 3300048927 Bacteria 61788
480 Ga0496124_0001695 3300048927 Bacteria 31188
481 Ga0496124_0276592 3300048927 Bacteria 1226
482 Ga0496125_0000587 3300048928 Bacteria 62037
483 Ga0496125_0001699 3300048928 Bacteria 30720
484 Ga0496125_0012186 3300048928 Bacteria 8555
485 Ga0496125_0018631 3300048928 Bacteria 6588
486 Ga0496125_0225314 3300048928 Unclassified 1204
487 Ga0496126_0000361 3300048929 Bacteria 94834
488 Ga0496126_0000517 3300048929 Bacteria 75042
489 Ga0496126_0005027 3300048929 Bacteria 15387
490 Ga0496126_0009537 3300048929 Bacteria 10297
491 Ga0496126_0089546 3300048929 Bacteria 2708
492 Ga0496126_0183536 3300048929 Bacteria 1776
493 Ga0496126_0266045 3300048929 Bacteria 1424
494 Ga0495682_0089140 3300049460 Bacteria 1108
495 Ga0501033_0152463 3300049570 Bacteria 1667
496 Ga0501223_001198 3300049663 Bacteria 6077
497 Ga0501225_0000600 3300049705 Bacteria 11214
498 Ga0501269_020829 3300049766 Bacteria 818
499 nmdc:mga03683_6392_c1 3300050489 Bacteria 4030
500 nmdc:mga03683_6_c1 3300050489 Bacteria 141493
501 nmdc:mga03n38_18436_c1 3300050490 Bacteria 2756
502 nmdc:mga03n38_648_c1 3300050490 Bacteria 8935
503 nmdc:mga00v17_10848_c1 3300050491 Bacteria 4992
504 nmdc:mga00v17_180716_c1 3300050491 Bacteria 1361
505 nmdc:mga00v17_8099_c1 3300050491 Bacteria 5642
506 nmdc:mga0yw44_68141_c1 3300050492 Bacteria 2201
507 nmdc:mga0k408_183838_c1 3300050493 Bacteria 1247
508 nmdc:mga0k408_25027_c1 3300050493 Unclassified 3378
509 nmdc:mga0k408_6_c1 3300050493 Bacteria 200443
510 nmdc:mga0k408_75963_c1 3300050493 Bacteria 1964
511 nmdc:mga0k408_7675_c1 3300050493 Bacteria 5763
512 nmdc:mga06z11_6832_c1 3300050494 Bacteria 4665
513 nmdc:mga04h51_657_c1 3300050495 Bacteria 8064
514 nmdc:mga07m45_110_c1 3300050496 Bacteria 32792
515 nmdc:mga07m45_39329_c2 3300050496 Bacteria 2129
516 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
517 nmdc:mga07m45_9729_c1 3300050496 Bacteria 4997
518 nmdc:mga0qj67_13182_c1 3300050509 Bacteria 6240
519 nmdc:mga0sz30_291_c1 3300050516 Bacteria 16101
520 nmdc:mga0sz30_33743_c1 3300050516 Bacteria 2128
521 nmdc:mga0sz30_405_c2 3300050516 Bacteria 8662
522 Ga0500610_0000240 3300053079 Bacteria 16589
523 Ga0500643_000170 3300053087 Bacteria 63864
524 Ga0500643_003016 3300053087 Bacteria 8333
525 Ga0500643_007836 3300053087 Bacteria 4255
526 Ga0500643_038037 3300053087 Bacteria 1429
527 Ga0500643_043462 3300053087 Bacteria 1310
528 Ga0500643_047001 3300053087 Bacteria 1245
529 Ga0500647_0006216 3300053091 Bacteria 5029
530 Ga0500566_0035948 3300053094 Bacteria 2876
531 Ga0500641_0003365 3300053096 Bacteria 5655
532 Ga0500555_000120 3300053103 Bacteria 37499
533 Ga0500555_035927 3300053103 Bacteria 1390
534 Ga0500556_0000197 3300053104 Bacteria 49633
535 Ga0500592_040670 3300053116 Bacteria 752
536 Ga0500594_0008205 3300053118 Bacteria 2376
537 Ga0500595_000771 3300053119 Bacteria 18779
538 Ga0500595_002186 3300053119 Bacteria 9933
539 Ga0500607_000293 3300053121 Bacteria 47399
540 Ga0500607_000691 3300053121 Bacteria 32562
541 Ga0500608_000266 3300053122 Bacteria 20190
542 Ga0500608_002121 3300053122 Bacteria 7122
543 Ga0500608_102298 3300053122 Unclassified 1326
544 Ga0500618_000430 3300053125 Bacteria 27901
545 Ga0500618_027655 3300053125 Bacteria 1348
546 Ga0500642_0000011 3300053130 Bacteria 215963
547 Ga0500642_0005700 3300053130 Bacteria 4043
548 Ga0500559_0002171 3300053136 Bacteria 10381
549 Ga0500559_0007085 3300053136 Bacteria 5001
550 Ga0500559_0008373 3300053136 Bacteria 4535
551 Ga0500559_0022043 3300053136 Bacteria 2702
552 Ga0500559_0041753 3300053136 Bacteria 1999
553 Ga0500564_010345 3300053138 Bacteria 4089
554 Ga0500577_0127660 3300053142 Bacteria 1063
555 Ga0500590_012706 3300053148 Bacteria 4299
556 Ga0500616_0004901 3300053153 Bacteria 9313
557 Ga0500616_0005799 3300053153 Bacteria 8293
558 Ga0500624_000008 3300053157 Bacteria 181801
559 Ga0500636_0000688 3300053177 Bacteria 18135
560 Ga0500636_0028084 3300053177 Unclassified 3324
561 Ga0500637_0000037 3300053178 Bacteria 47475
562 Ga0500637_0005337 3300053178 Bacteria 6211
563 Ga0500567_005049 3300053723 Bacteria 6065
564 Ga0500625_000009 3300053729 Bacteria 159296
565 Ga0500645_000005 3300053730 Bacteria 284466
566 Ga0500645_000623 3300053730 Bacteria 22693
567 Ga0500645_004752 3300053730 Bacteria 5144
568 Ga0500645_013644 3300053730 Bacteria 2604
569 Ga0500645_058390 3300053730 Bacteria 1118
570 Ga0500596_001793 3300053735 Bacteria 4314
571 Ga0500587_002217 3300053739 Bacteria 2767
572 Ga0500661_000121 3300055283 Bacteria 12926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100493562 Ga0070660_1004935622 232
2 3300005457 Ga0070662_100151415 Ga0070662_1001514154 232
3 3300053116 Ga0500592_040670 Ga0500592_040670_13_711 232
4 3300005355 Ga0070671_100043304 Ga0070671_1000433042 233
5 3300005457 Ga0070662_100072728 Ga0070662_1000727281 233
6 3300005539 Ga0068853_100161259 Ga0068853_1001612591 233
7 3300048925 Ga0496122_0000083 Ga0496122_0000083_69239_70015 237
8 3300048926 Ga0496123_0000356 Ga0496123_0000356_15809_16585 237
9 3300048929 Ga0496126_0009537 Ga0496126_0009537_7012_7788 237
10 3300006178 Ga0075367_10162715 Ga0075367_101627152 238
11 3300048924 Ga0496121_0001411 Ga0496121_0001411_15501_16241 242
12 3300048927 Ga0496124_0000316 Ga0496124_0000316_22676_23416 242
13 3300047472 Ga0495686_0047500 Ga0495686_0047500_1295_2092 244
14 3300048924 Ga0496121_0043784 Ga0496121_0043784_2610_3392 248
15 3300053739 Ga0500587_002217 Ga0500587_002217_1531_2316 248
16 3300048925 Ga0496122_0002618 Ga0496122_0002618_13851_14609 252
17 3300048926 Ga0496123_0001077 Ga0496123_0001077_29811_30569 252
18 iso_pu_bacteria 2739367664 2739649317 254
19 iso_pu_bacteria 2739367865 2740027790 254
20 iso_pu_bacteria 2848297114 2848298839 255
21 iso_pu_bacteria 2512564014 2512645869 256
22 iso_pu_bacteria 2830075706 2830075844 256
23 3300005327 Ga0070658_10125667 Ga0070658_101256672 257
24 3300005564 Ga0070664_100402209 Ga0070664_1004022092 257
25 3300005578 Ga0068854_100022638 Ga0068854_1000226383 257
26 3300025925 Ga0207650_10122177 Ga0207650_101221772 257
27 3300025945 Ga0207679_10490815 Ga0207679_104908152 257
28 3300031731 Ga0307405_10126652 Ga0307405_101266522 257
29 3300032005 Ga0307411_10405463 Ga0307411_104054632 257
30 3300041452 Ga0451793_0281662 Ga0451793_0281662_233_1006 257
31 3300041460 Ga0451802_0164837 Ga0451802_0164837_890_1663 257
32 3300041462 Ga0451806_084591 Ga0451806_084591_414_1187 257
33 3300041486 Ga0451807_1856970 Ga0451807_1856970_256_1029 257
34 3300041501 Ga0451845_0938299 Ga0451845_0938299_107_880 257
35 3300046460 Ga0495638_0030364 Ga0495638_0030364_1982_2755 257
36 3300046506 Ga0495583_0000175 Ga0495583_0000175_23593_24366 257
37 3300046507 Ga0495606_0049115 Ga0495606_0049115_1581_2354 257
38 3300046691 Ga0495670_0006398 Ga0495670_0006398_4838_5611 257
39 3300047472 Ga0495686_0000361 Ga0495686_0000361_3201_3974 257
40 3300047472 Ga0495686_0001049 Ga0495686_0001049_26003_26776 257
41 3300047472 Ga0495686_0055188 Ga0495686_0055188_1296_2222 257
42 3300048921 Ga0496118_0005916 Ga0496118_0005916_12459_13232 257
43 3300048922 Ga0496119_0018757 Ga0496119_0018757_498_1271 257
44 3300048923 Ga0496120_0019923 Ga0496120_0019923_2558_3331 257
45 3300048928 Ga0496125_0012186 Ga0496125_0012186_735_1508 257
46 3300049460 Ga0495682_0089140 Ga0495682_0089140_77_850 257
47 3300053103 Ga0500555_000120 Ga0500555_000120_19777_20550 257
48 3300053153 Ga0500616_0005799 Ga0500616_0005799_4967_5740 257
49 iso_pu_bacteria 2510917021 2511128134 257
50 iso_pu_bacteria 2818991438 2819554468 257
51 iso_pu_bacteria 8054302542 8054305259 257
52 3300001991 JGI24743J22301_10008524 JGI24743J22301_100085243 258
53 3300005289 Ga0065704_10003847 Ga0065704_100038473 258
54 3300005295 Ga0065707_10094490 Ga0065707_100944901 258
55 3300005327 Ga0070658_10007930 Ga0070658_100079306 258
56 3300005328 Ga0070676_10000161 Ga0070676_1000016119 258
57 3300005331 Ga0070670_100291266 Ga0070670_1002912662 258
58 3300005334 Ga0068869_100001393 Ga0068869_1000013932 258
59 3300005334 Ga0068869_100428710 Ga0068869_1004287102 258
60 3300005335 Ga0070666_10025030 Ga0070666_100250302 258
61 3300005335 Ga0070666_10037896 Ga0070666_100378964 258
62 3300005338 Ga0068868_100000057 Ga0068868_10000005712 258
63 3300005347 Ga0070668_100000045 Ga0070668_100000045101 258
64 3300005347 Ga0070668_100000249 Ga0070668_10000024919 258
65 3300005347 Ga0070668_100012728 Ga0070668_1000127286 258
66 3300005353 Ga0070669_100060051 Ga0070669_1000600513 258
67 3300005353 Ga0070669_100110160 Ga0070669_1001101603 258
68 3300005355 Ga0070671_100002659 Ga0070671_10000265913 258
69 3300005355 Ga0070671_100002701 Ga0070671_10000270114 258
70 3300005355 Ga0070671_100140177 Ga0070671_1001401773 258
71 3300005364 Ga0070673_100000005 Ga0070673_10000000512 258
72 3300005367 Ga0070667_100000104 Ga0070667_100000104120 258
73 3300005367 Ga0070667_100000193 Ga0070667_10000019356 258
74 3300005367 Ga0070667_100094786 Ga0070667_1000947863 258
75 3300005440 Ga0070705_100075444 Ga0070705_1000754441 258
76 3300005459 Ga0068867_100000071 Ga0068867_10000007158 258
77 3300005539 Ga0068853_100001233 Ga0068853_1000012332 258
78 3300005539 Ga0068853_100032792 Ga0068853_1000327925 258
79 3300005543 Ga0070672_100065513 Ga0070672_1000655133 258
80 3300005544 Ga0070686_100066195 Ga0070686_1000661953 258
81 3300005563 Ga0068855_100138187 Ga0068855_1001381872 258
82 3300005577 Ga0068857_100013403 Ga0068857_1000134033 258
83 3300005614 Ga0068856_100305906 Ga0068856_1003059062 258
84 3300005616 Ga0068852_100303535 Ga0068852_1003035352 258
85 3300005616 Ga0068852_100532285 Ga0068852_1005322851 258
86 3300005617 Ga0068859_100022780 Ga0068859_1000227808 258
87 3300005617 Ga0068859_100112991 Ga0068859_1001129914 258
88 3300005618 Ga0068864_100035448 Ga0068864_1000354485 258
89 3300005841 Ga0068863_100000625 Ga0068863_10000062518 258
90 3300005841 Ga0068863_100022543 Ga0068863_1000225437 258
91 3300005841 Ga0068863_100038067 Ga0068863_1000380673 258
92 3300005842 Ga0068858_100013007 Ga0068858_10001300710 258
93 3300005843 Ga0068860_100000197 Ga0068860_100000197111 258
94 3300005843 Ga0068860_100003204 Ga0068860_1000032043 258
95 3300005843 Ga0068860_100006651 Ga0068860_10000665111 258
96 3300005843 Ga0068860_100007022 Ga0068860_10000702211 258
97 3300005844 Ga0068862_100000031 Ga0068862_1000000316 258
98 3300005844 Ga0068862_100000201 Ga0068862_10000020161 258
99 3300005844 Ga0068862_100002137 Ga0068862_10000213718 258
100 3300005844 Ga0068862_100020190 Ga0068862_1000201904 258
101 3300005985 Ga0081539_10007629 Ga0081539_1000762913 258
102 3300006038 Ga0075365_10045743 Ga0075365_100457433 258
103 3300006042 Ga0075368_10000038 Ga0075368_100000383 258
104 3300006048 Ga0075363_100018683 Ga0075363_1000186834 258
105 3300006051 Ga0075364_10010580 Ga0075364_100105803 258
106 3300006051 Ga0075364_10125446 Ga0075364_101254462 258
107 3300006177 Ga0075362_10002493 Ga0075362_100024933 258
108 3300006177 Ga0075362_10010974 Ga0075362_100109745 258
109 3300006178 Ga0075367_10022284 Ga0075367_100222844 258
110 3300006186 Ga0075369_10002761 Ga0075369_100027613 258
111 3300006195 Ga0075366_10001944 Ga0075366_100019446 258
112 3300006195 Ga0075366_10016071 Ga0075366_100160715 258
113 3300006195 Ga0075366_10023184 Ga0075366_100231846 258
114 3300006195 Ga0075366_10159815 Ga0075366_101598152 258
115 3300006353 Ga0075370_10122614 Ga0075370_101226142 258
116 3300006353 Ga0075370_10169533 Ga0075370_101695332 258
117 3300006881 Ga0068865_100000032 Ga0068865_10000003287 258
118 3300006931 Ga0097620_100022780 Ga0097620_1000227808 258
119 3300006931 Ga0097620_100112995 Ga0097620_1001129954 258
120 3300006946 Ga0079104_1034512 Ga0079104_10345121 258
121 3300009098 Ga0105245_10005496 Ga0105245_100054968 258
122 3300009101 Ga0105247_10008163 Ga0105247_100081634 258
123 3300009148 Ga0105243_10002022 Ga0105243_100020228 258
124 3300009176 Ga0105242_10002453 Ga0105242_1000245313 258
125 3300009177 Ga0105248_10049647 Ga0105248_100496474 258
126 3300009177 Ga0105248_10289435 Ga0105248_102894352 258
127 3300009177 Ga0105248_11005998 Ga0105248_110059982 258
128 3300009553 Ga0105249_10000043 Ga0105249_1000004384 258
129 3300009553 Ga0105249_10000350 Ga0105249_1000035042 258
130 3300010375 Ga0105239_10069640 Ga0105239_100696402 258
131 3300011119 Ga0105246_10001784 Ga0105246_100017848 258
132 3300013296 Ga0157374_10001126 Ga0157374_1000112615 258
133 3300013297 Ga0157378_10002231 Ga0157378_100022318 258
134 3300013306 Ga0163162_10229848 Ga0163162_102298482 258
135 3300013308 Ga0157375_10003871 Ga0157375_1000387111 258
136 3300014326 Ga0157380_10419457 Ga0157380_104194572 258
137 3300014969 Ga0157376_10000450 Ga0157376_1000045011 258
138 3300025229 Ga0209147_100631 Ga0209147_10063111 258
139 3300025900 Ga0207710_10008636 Ga0207710_100086363 258
140 3300025903 Ga0207680_10002301 Ga0207680_100023018 258
141 3300025903 Ga0207680_10069791 Ga0207680_100697912 258
142 3300025907 Ga0207645_10000752 Ga0207645_1000075211 258
143 3300025909 Ga0207705_10000022 Ga0207705_10000022281 258
144 3300025923 Ga0207681_10007162 Ga0207681_100071622 258
145 3300025923 Ga0207681_10083914 Ga0207681_100839142 258
146 3300025923 Ga0207681_10247204 Ga0207681_102472042 258
147 3300025925 Ga0207650_10353055 Ga0207650_103530552 258
148 3300025927 Ga0207687_10002234 Ga0207687_100022348 258
149 3300025931 Ga0207644_10000070 Ga0207644_1000007012 258
150 3300025931 Ga0207644_10003667 Ga0207644_100036677 258
151 3300025931 Ga0207644_10109353 Ga0207644_101093533 258
152 3300025934 Ga0207686_10000786 Ga0207686_100007869 258
153 3300025935 Ga0207709_10000276 Ga0207709_1000027660 258
154 3300025938 Ga0207704_10000034 Ga0207704_1000003411 258
155 3300025940 Ga0207691_10126982 Ga0207691_101269823 258
156 3300025941 Ga0207711_10105106 Ga0207711_101051063 258
157 3300025941 Ga0207711_10213331 Ga0207711_102133312 258
158 3300025942 Ga0207689_10005357 Ga0207689_100053572 258
159 3300025949 Ga0207667_10295899 Ga0207667_102958992 258
160 3300025960 Ga0207651_10000010 Ga0207651_1000001011 258
161 3300025961 Ga0207712_10000095 Ga0207712_1000009583 258
162 3300025961 Ga0207712_10000299 Ga0207712_1000029941 258
163 3300025961 Ga0207712_10237546 Ga0207712_102375461 258
164 3300025972 Ga0207668_10000103 Ga0207668_1000010368 258
165 3300025972 Ga0207668_10000224 Ga0207668_1000022427 258
166 3300025972 Ga0207668_10043335 Ga0207668_100433353 258
167 3300025986 Ga0207658_10000042 Ga0207658_10000042113 258
168 3300025986 Ga0207658_10001305 Ga0207658_1000130529 258
169 3300026023 Ga0207677_10000296 Ga0207677_1000029611 258
170 3300026041 Ga0207639_10182313 Ga0207639_101823132 258
171 3300026088 Ga0207641_10000046 Ga0207641_10000046156 258
172 3300026088 Ga0207641_10002760 Ga0207641_1000276010 258
173 3300026088 Ga0207641_10019262 Ga0207641_100192625 258
174 3300026088 Ga0207641_10557979 Ga0207641_105579791 258
175 3300026089 Ga0207648_10000219 Ga0207648_1000021958 258
176 3300026095 Ga0207676_10013562 Ga0207676_100135625 258
177 3300026116 Ga0207674_10000811 Ga0207674_1000081126 258
178 3300026142 Ga0207698_10148081 Ga0207698_101480811 258
179 3300027866 Ga0209813_10000097 Ga0209813_1000009729 258
180 3300028380 Ga0268265_10000189 Ga0268265_1000018950 258
181 3300028380 Ga0268265_10000219 Ga0268265_1000021911 258
182 3300028380 Ga0268265_10001219 Ga0268265_1000121936 258
183 3300028380 Ga0268265_10083120 Ga0268265_100831203 258
184 3300028381 Ga0268264_10000190 Ga0268264_100001904 258
185 3300028381 Ga0268264_10000906 Ga0268264_1000090626 258
186 3300028381 Ga0268264_10002998 Ga0268264_1000299816 258
187 3300028381 Ga0268264_10013675 Ga0268264_100136756 258
188 3300031456 Ga0307513_10055632 Ga0307513_100556324 258
189 3300031731 Ga0307405_10065008 Ga0307405_100650082 258
190 3300031731 Ga0307405_10073789 Ga0307405_100737893 258
191 3300031852 Ga0307410_10043240 Ga0307410_100432402 258
192 3300031903 Ga0307407_10168405 Ga0307407_101684052 258
193 3300031911 Ga0307412_10053673 Ga0307412_100536732 258
194 3300031911 Ga0307412_10225870 Ga0307412_102258702 258
195 3300031995 Ga0307409_100006293 Ga0307409_1000062932 258
196 3300032002 Ga0307416_100135793 Ga0307416_1001357933 258
197 3300032004 Ga0307414_10019084 Ga0307414_100190842 258
198 3300032005 Ga0307411_10006123 Ga0307411_100061234 258
199 3300032126 Ga0307415_100039053 Ga0307415_1000390533 258
200 3300032126 Ga0307415_100436402 Ga0307415_1004364021 258
201 3300036712 Ga0316584_0146641 Ga0316584_0146641_442_1239 258
202 3300041498 Ga0451841_0113193 Ga0451841_0113193_96_872 258
203 3300041498 Ga0451841_0820137 Ga0451841_0820137_151_927 258
204 3300046453 Ga0495627_000632 Ga0495627_000632_23733_24509 258
205 3300046471 Ga0495650_0001055 Ga0495650_0001055_3160_3936 258
206 3300046519 Ga0495632_0000096 Ga0495632_0000096_71765_72541 258
207 3300046520 Ga0495637_0000516 Ga0495637_0000516_6812_7588 258
208 3300046522 Ga0495643_0000068 Ga0495643_0000068_66265_67041 258
209 3300046524 Ga0495648_0015439 Ga0495648_0015439_3340_4116 258
210 3300046525 Ga0495663_0000088 Ga0495663_0000088_16744_17520 258
211 3300046530 Ga0495654_0053625 Ga0495654_0053625_467_1258 258
212 3300046557 Ga0495622_0067448 Ga0495622_0067448_591_1367 258
213 3300046558 Ga0495633_0000420 Ga0495633_0000420_37039_37815 258
214 3300046558 Ga0495633_0000816 Ga0495633_0000816_16744_17520 258
215 3300046660 Ga0495625_0096909 Ga0495625_0096909_780_1571 258
216 3300046660 Ga0495625_0115019 Ga0495625_0115019_804_1595 258
217 3300046692 Ga0495671_0000040 Ga0495671_0000040_62083_62859 258
218 3300046692 Ga0495671_0036360 Ga0495671_0036360_792_1568 258
219 3300047443 Ga0495687_137966 Ga0495687_137966_34_810 258
220 3300047470 Ga0495681_0013978 Ga0495681_0013978_2414_3190 258
221 3300047472 Ga0495686_0001471 Ga0495686_0001471_7168_7944 258
222 3300047472 Ga0495686_0022857 Ga0495686_0022857_415_1191 258
223 3300047472 Ga0495686_0029441 Ga0495686_0029441_732_1508 258
224 3300048920 Ga0496117_0009149 Ga0496117_0009149_4387_5163 258
225 3300048921 Ga0496118_0008931 Ga0496118_0008931_397_1173 258
226 3300048927 Ga0496124_0000579 Ga0496124_0000579_10071_10847 258
227 3300048928 Ga0496125_0000587 Ga0496125_0000587_51191_51967 258
228 3300048928 Ga0496125_0225314 Ga0496125_0225314_344_1120 258
229 3300049663 Ga0501223_001198 Ga0501223_001198_5110_5886 258
230 3300049705 Ga0501225_0000600 Ga0501225_0000600_1569_2345 258
231 3300050489 nmdc:mga03683_6392_c1 nmdc:mga03683_6392_c1_534_1310 258
232 3300050490 nmdc:mga03n38_18436_c1 nmdc:mga03n38_18436_c1_1792_2568 258
233 3300050491 nmdc:mga00v17_180716_c1 nmdc:mga00v17_180716_c1_414_1190 258
234 3300050491 nmdc:mga00v17_8099_c1 nmdc:mga00v17_8099_c1_3100_3876 258
235 3300050492 nmdc:mga0yw44_68141_c1 nmdc:mga0yw44_68141_c1_1330_2106 258
236 3300050493 nmdc:mga0k408_183838_c1 nmdc:mga0k408_183838_c1_262_1116 258
237 3300050493 nmdc:mga0k408_75963_c1 nmdc:mga0k408_75963_c1_407_1183 258
238 3300050493 nmdc:mga0k408_7675_c1 nmdc:mga0k408_7675_c1_2306_3082 258
239 3300050494 nmdc:mga06z11_6832_c1 nmdc:mga06z11_6832_c1_3329_4105 258
240 3300050495 nmdc:mga04h51_657_c1 nmdc:mga04h51_657_c1_3226_4002 258
241 3300050496 nmdc:mga07m45_110_c1 nmdc:mga07m45_110_c1_28688_29464 258
242 3300050496 nmdc:mga07m45_39329_c2 nmdc:mga07m45_39329_c2_144_935 258
243 3300050516 nmdc:mga0sz30_291_c1 nmdc:mga0sz30_291_c1_8306_9082 258
244 3300050516 nmdc:mga0sz30_33743_c1 nmdc:mga0sz30_33743_c1_128_904 258
245 3300053087 Ga0500643_043462 Ga0500643_043462_485_1261 258
246 3300053087 Ga0500643_047001 Ga0500643_047001_400_1191 258
247 3300053091 Ga0500647_0006216 Ga0500647_0006216_418_1194 258
248 3300053094 Ga0500566_0035948 Ga0500566_0035948_1118_1894 258
249 3300053096 Ga0500641_0003365 Ga0500641_0003365_3295_4071 258
250 3300053103 Ga0500555_035927 Ga0500555_035927_233_1009 258
251 3300053118 Ga0500594_0008205 Ga0500594_0008205_119_934 258
252 3300053121 Ga0500607_000293 Ga0500607_000293_39690_40466 258
253 3300053121 Ga0500607_000691 Ga0500607_000691_4783_5559 258
254 3300053122 Ga0500608_000266 Ga0500608_000266_8980_9795 258
255 3300053125 Ga0500618_000430 Ga0500618_000430_6684_7460 258
256 3300053125 Ga0500618_027655 Ga0500618_027655_182_958 258
257 3300053136 Ga0500559_0007085 Ga0500559_0007085_3822_4598 258
258 3300053136 Ga0500559_0008373 Ga0500559_0008373_2194_2970 258
259 3300053136 Ga0500559_0022043 Ga0500559_0022043_329_1144 258
260 3300053136 Ga0500559_0041753 Ga0500559_0041753_359_1135 258
261 3300053138 Ga0500564_010345 Ga0500564_010345_2414_3229 258
262 3300053142 Ga0500577_0127660 Ga0500577_0127660_239_1015 258
263 3300053157 Ga0500624_000008 Ga0500624_000008_109631_110407 258
264 3300053177 Ga0500636_0028084 Ga0500636_0028084_1916_2692 258
265 3300053178 Ga0500637_0000037 Ga0500637_0000037_32794_33570 258
266 3300053178 Ga0500637_0005337 Ga0500637_0005337_5206_5982 258
267 3300053723 Ga0500567_005049 Ga0500567_005049_4937_5752 258
268 3300053729 Ga0500625_000009 Ga0500625_000009_100266_101081 258
269 3300053730 Ga0500645_013644 Ga0500645_013644_1423_2199 258
270 3300001979 JGI24740J21852_10054649 JGI24740J21852_100546491 259
271 3300001990 JGI24737J22298_10029377 JGI24737J22298_100293771 259
272 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005201 259
273 3300003322 rootL2_10085789 rootL2_100857894 259
274 3300003322 rootL2_10156435 rootL2_101564352 259
275 3300003322 rootL2_10275880 rootL2_102758801 259
276 3300003759 Ga0055525_1000037 Ga0055525_1000037180 259
277 3300003762 Ga0055542_1000293 Ga0055542_100029324 259
278 3300003763 Ga0055529_1000034 Ga0055529_1000034121 259
279 3300003771 Ga0055526_1007131 Ga0055526_10071316 259
280 3300003773 Ga0055537_1000848 Ga0055537_10008488 259
281 3300003791 Ga0055530_10008155 Ga0055530_100081552 259
282 3300003792 Ga0055540_1000185 Ga0055540_100018552 259
283 3300003794 Ga0055531_10000088 Ga0055531_1000008853 259
284 3300005327 Ga0070658_10001641 Ga0070658_100016418 259
285 3300005337 Ga0070682_100109043 Ga0070682_1001090432 259
286 3300005344 Ga0070661_100073444 Ga0070661_1000734443 259
287 3300005347 Ga0070668_100000058 Ga0070668_10000005837 259
288 3300005367 Ga0070667_100000045 Ga0070667_10000004513 259
289 3300005456 Ga0070678_100094904 Ga0070678_1000949042 259
290 3300005466 Ga0070685_10001123 Ga0070685_100011238 259
291 3300005548 Ga0070665_100549426 Ga0070665_1005494262 259
292 3300005563 Ga0068855_100000921 Ga0068855_10000092133 259
293 3300005563 Ga0068855_100394070 Ga0068855_1003940702 259
294 3300005719 Ga0068861_100000074 Ga0068861_10000007431 259
295 3300005834 Ga0068851_10061951 Ga0068851_100619511 259
296 3300005840 Ga0068870_10245592 Ga0068870_102455922 259
297 3300005841 Ga0068863_100000012 Ga0068863_10000001255 259
298 3300005843 Ga0068860_100000073 Ga0068860_10000007312 259
299 3300005844 Ga0068862_100160283 Ga0068862_1001602832 259
300 3300006048 Ga0075363_100000828 Ga0075363_1000008287 259
301 3300006051 Ga0075364_10010542 Ga0075364_100105424 259
302 3300006177 Ga0075362_10000001 Ga0075362_10000001161 259
303 3300006186 Ga0075369_10001326 Ga0075369_100013265 259
304 3300006195 Ga0075366_10000093 Ga0075366_100000937 259
305 3300006195 Ga0075366_10095731 Ga0075366_100957311 259
306 3300006237 Ga0097621_100055655 Ga0097621_1000556552 259
307 3300006353 Ga0075370_10000028 Ga0075370_1000002815 259
308 3300006353 Ga0075370_10021194 Ga0075370_100211944 259
309 3300006931 Ga0097620_100002108 Ga0097620_1000021082 259
310 3300009093 Ga0105240_10003234 Ga0105240_1000323419 259
311 3300009148 Ga0105243_10000030 Ga0105243_10000030145 259
312 3300009174 Ga0105241_10004167 Ga0105241_100041671 259
313 3300009176 Ga0105242_10202299 Ga0105242_102022991 259
314 3300009177 Ga0105248_10045340 Ga0105248_100453402 259
315 3300009177 Ga0105248_10209029 Ga0105248_102090292 259
316 3300009177 Ga0105248_10477183 Ga0105248_104771831 259
317 3300009545 Ga0105237_10322615 Ga0105237_103226152 259
318 3300009551 Ga0105238_10145546 Ga0105238_101455464 259
319 3300009553 Ga0105249_10019121 Ga0105249_100191213 259
320 3300010375 Ga0105239_10389935 Ga0105239_103899352 259
321 3300013102 Ga0157371_10000043 Ga0157371_10000043142 259
322 3300013307 Ga0157372_10279731 Ga0157372_102797313 259
323 3300017792 Ga0163161_10106800 Ga0163161_101068003 259
324 3300021388 Ga0213875_10000597 Ga0213875_1000059715 259
325 3300025230 Ga0209563_100053 Ga0209563_100053292 259
326 3300025253 Ga0209677_106945 Ga0209677_1069452 259
327 3300025254 Ga0209148_1000093 Ga0209148_1000093126 259
328 3300025263 Ga0209565_1000264 Ga0209565_10002646 259
329 3300025272 Ga0209455_1000045 Ga0209455_1000045267 259
330 3300025273 Ga0209673_1025307 Ga0209673_10253073 259
331 3300025292 Ga0209676_1000288 Ga0209676_100028851 259
332 3300025295 Ga0209564_1000378 Ga0209564_100037824 259
333 3300025297 Ga0209758_1000001 Ga0209758_1000001204 259
334 3300025298 Ga0209050_1000001 Ga0209050_10000011580 259
335 3300025303 Ga0209051_1000209 Ga0209051_100020953 259
336 3300025304 Ga0209257_1000111 Ga0209257_1000111131 259
337 3300025909 Ga0207705_10000325 Ga0207705_1000032515 259
338 3300025911 Ga0207654_10001035 Ga0207654_100010353 259
339 3300025913 Ga0207695_10012304 Ga0207695_100123048 259
340 3300025913 Ga0207695_10093847 Ga0207695_100938475 259
341 3300025917 Ga0207660_10211446 Ga0207660_102114461 259
342 3300025919 Ga0207657_10304910 Ga0207657_103049102 259
343 3300025920 Ga0207649_10000441 Ga0207649_1000044119 259
344 3300025924 Ga0207694_10024498 Ga0207694_100244984 259
345 3300025932 Ga0207690_10076194 Ga0207690_100761942 259
346 3300025935 Ga0207709_10000018 Ga0207709_10000018348 259
347 3300025937 Ga0207669_10000051 Ga0207669_1000005153 259
348 3300025941 Ga0207711_10025856 Ga0207711_100258562 259
349 3300025949 Ga0207667_10000069 Ga0207667_1000006922 259
350 3300025949 Ga0207667_10000762 Ga0207667_1000076230 259
351 3300025960 Ga0207651_10012864 Ga0207651_100128644 259
352 3300025972 Ga0207668_10000061 Ga0207668_1000006162 259
353 3300025981 Ga0207640_10001299 Ga0207640_100012996 259
354 3300025986 Ga0207658_10000025 Ga0207658_10000025147 259
355 3300026041 Ga0207639_10000879 Ga0207639_1000087912 259
356 3300026067 Ga0207678_10104819 Ga0207678_101048192 259
357 3300026078 Ga0207702_10061014 Ga0207702_100610141 259
358 3300026088 Ga0207641_10000024 Ga0207641_1000002477 259
359 3300026088 Ga0207641_10002537 Ga0207641_1000253716 259
360 3300026089 Ga0207648_10094248 Ga0207648_100942482 259
361 3300026118 Ga0207675_100000244 Ga0207675_10000024419 259
362 3300026121 Ga0207683_10004084 Ga0207683_1000408410 259
363 3300028380 Ga0268265_10028451 Ga0268265_100284512 259
364 3300028381 Ga0268264_10000120 Ga0268264_1000012028 259
365 3300028381 Ga0268264_10001482 Ga0268264_100014824 259
366 3300028786 Ga0307517_10024263 Ga0307517_100242631 259
367 3300028786 Ga0307517_10086720 Ga0307517_100867202 259
368 3300031456 Ga0307513_10158317 Ga0307513_101583172 259
369 3300031616 Ga0307508_10012591 Ga0307508_100125914 259
370 3300031730 Ga0307516_10260692 Ga0307516_102606922 259
371 3300031824 Ga0307413_10076268 Ga0307413_100762681 259
372 3300031824 Ga0307413_10236219 Ga0307413_102362191 259
373 3300031852 Ga0307410_10076071 Ga0307410_100760712 259
374 3300031852 Ga0307410_10134113 Ga0307410_101341133 259
375 3300031852 Ga0307410_10297182 Ga0307410_102971821 259
376 3300031911 Ga0307412_10000269 Ga0307412_100002696 259
377 3300031911 Ga0307412_10019146 Ga0307412_100191465 259
378 3300031995 Ga0307409_100239418 Ga0307409_1002394182 259
379 3300032002 Ga0307416_100533100 Ga0307416_1005331002 259
380 3300032004 Ga0307414_10431461 Ga0307414_104314611 259
381 3300035121 Ga0373960_0038895 Ga0373960_0038895_497_1276 259
382 3300038705 Ga0237819_00887 Ga0237819_00887_3185_3964 259
383 3300041512 Ga0451853_3609454 Ga0451853_3609454_90_869 259
384 3300045051 Ga0451576_0000024 Ga0451576_0000024_467120_467899 259
385 3300046452 Ga0495617_051980 Ga0495617_051980_33_812 259
386 3300046471 Ga0495650_0001337 Ga0495650_0001337_139_918 259
387 3300046492 Ga0495585_0002664 Ga0495585_0002664_8453_9232 259
388 3300046500 Ga0495596_0000267 Ga0495596_0000267_8469_9248 259
389 3300046506 Ga0495583_0001301 Ga0495583_0001301_15421_16200 259
390 3300046507 Ga0495606_0000372 Ga0495606_0000372_54218_54997 259
391 3300046507 Ga0495606_0065335 Ga0495606_0065335_335_1114 259
392 3300046507 Ga0495606_0092317 Ga0495606_0092317_771_1721 259
393 3300046522 Ga0495643_0010634 Ga0495643_0010634_1199_1978 259
394 3300046522 Ga0495643_0067257 Ga0495643_0067257_89_868 259
395 3300046524 Ga0495648_0000024 Ga0495648_0000024_180982_181761 259
396 3300046558 Ga0495633_0002928 Ga0495633_0002928_1477_2256 259
397 3300046558 Ga0495633_0070823 Ga0495633_0070823_523_1302 259
398 3300046616 Ga0495668_0000084 Ga0495668_0000084_42659_43438 259
399 3300046660 Ga0495625_0000632 Ga0495625_0000632_20636_21415 259
400 3300046684 Ga0495669_0000186 Ga0495669_0000186_20669_21448 259
401 3300046694 Ga0495649_0043693 Ga0495649_0043693_502_1281 259
402 3300046809 Ga0495600_0174973 Ga0495600_0174973_89_868 259
403 3300047323 Ga0495683_0013138 Ga0495683_0013138_2270_3049 259
404 3300047443 Ga0495687_000971 Ga0495687_000971_1119_1898 259
405 3300047443 Ga0495687_001338 Ga0495687_001338_21280_22059 259
406 3300047472 Ga0495686_0007055 Ga0495686_0007055_6373_7170 259
407 3300047472 Ga0495686_0013971 Ga0495686_0013971_546_1325 259
408 3300047472 Ga0495686_0116259 Ga0495686_0116259_133_912 259
409 3300047472 Ga0495686_0145387 Ga0495686_0145387_386_1183 259
410 3300048090 Ga0495615_0000110 Ga0495615_0000110_8340_9119 259
411 3300048091 Ga0495626_0000808 Ga0495626_0000808_14426_15205 259
412 3300048905 Ga0496102_0000355 Ga0496102_0000355_28119_28898 259
413 3300048906 Ga0496103_0000600 Ga0496103_0000600_6340_7119 259
414 3300048908 Ga0496105_0003182 Ga0496105_0003182_10157_10936 259
415 3300048917 Ga0496114_0011207 Ga0496114_0011207_4463_5242 259
416 3300048918 Ga0496115_0000220 Ga0496115_0000220_23665_24444 259
417 3300048919 Ga0496116_0000153 Ga0496116_0000153_60035_60820 259
418 3300048919 Ga0496116_0003279 Ga0496116_0003279_25_804 259
419 3300048920 Ga0496117_0000715 Ga0496117_0000715_23586_24365 259
420 3300048921 Ga0496118_0000130 Ga0496118_0000130_108828_109607 259
421 3300048921 Ga0496118_0177961 Ga0496118_0177961_312_1097 259
422 3300048922 Ga0496119_0011789 Ga0496119_0011789_787_1566 259
423 3300048923 Ga0496120_0099949 Ga0496120_0099949_217_996 259
424 3300048924 Ga0496121_0000163 Ga0496121_0000163_98650_99432 259
425 3300048924 Ga0496121_0000375 Ga0496121_0000375_13466_14245 259
426 3300048925 Ga0496122_0000094 Ga0496122_0000094_60035_60820 259
427 3300048925 Ga0496122_0011330 Ga0496122_0011330_1785_2564 259
428 3300048926 Ga0496123_0001954 Ga0496123_0001954_25038_25823 259
429 3300048927 Ga0496124_0000129 Ga0496124_0000129_93871_94650 259
430 3300048927 Ga0496124_0000163 Ga0496124_0000163_23479_24258 259
431 3300048927 Ga0496124_0001695 Ga0496124_0001695_24743_25528 259
432 3300048928 Ga0496125_0001699 Ga0496125_0001699_27089_27868 259
433 3300048928 Ga0496125_0018631 Ga0496125_0018631_5034_5819 259
434 3300048929 Ga0496126_0000361 Ga0496126_0000361_13212_13991 259
435 3300048929 Ga0496126_0000517 Ga0496126_0000517_51847_52632 259
436 3300049570 Ga0501033_0152463 Ga0501033_0152463_178_1020 259
437 3300049766 Ga0501269_020829 Ga0501269_020829_14_793 259
438 3300050489 nmdc:mga03683_6_c1 nmdc:mga03683_6_c1_113717_114496 259
439 3300050490 nmdc:mga03n38_648_c1 nmdc:mga03n38_648_c1_7271_8050 259
440 3300050491 nmdc:mga00v17_10848_c1 nmdc:mga00v17_10848_c1_3634_4413 259
441 3300050493 nmdc:mga0k408_25027_c1 nmdc:mga0k408_25027_c1_2491_3270 259
442 3300050493 nmdc:mga0k408_6_c1 nmdc:mga0k408_6_c1_85553_86332 259
443 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_322677_323456 259
444 3300050496 nmdc:mga07m45_9729_c1 nmdc:mga07m45_9729_c1_3352_4146 259
445 3300050509 nmdc:mga0qj67_13182_c1 nmdc:mga0qj67_13182_c1_4056_4835 259
446 3300050516 nmdc:mga0sz30_405_c2 nmdc:mga0sz30_405_c2_4168_4947 259
447 3300053079 Ga0500610_0000240 Ga0500610_0000240_1097_1876 259
448 3300053087 Ga0500643_000170 Ga0500643_000170_51096_51884 259
449 3300053087 Ga0500643_003016 Ga0500643_003016_5124_5960 259
450 3300053087 Ga0500643_038037 Ga0500643_038037_148_927 259
451 3300053104 Ga0500556_0000197 Ga0500556_0000197_37758_38537 259
452 3300053119 Ga0500595_000771 Ga0500595_000771_9979_10758 259
453 3300053119 Ga0500595_002186 Ga0500595_002186_40_819 259
454 3300053122 Ga0500608_002121 Ga0500608_002121_1664_2443 259
455 3300053122 Ga0500608_102298 Ga0500608_102298_212_991 259
456 3300053130 Ga0500642_0000011 Ga0500642_0000011_155709_156488 259
457 3300053130 Ga0500642_0005700 Ga0500642_0005700_3234_4013 259
458 3300053136 Ga0500559_0002171 Ga0500559_0002171_4034_4822 259
459 3300053148 Ga0500590_012706 Ga0500590_012706_3495_4274 259
460 3300053153 Ga0500616_0004901 Ga0500616_0004901_2552_3331 259
461 3300053177 Ga0500636_0000688 Ga0500636_0000688_14794_15573 259
462 3300053730 Ga0500645_000005 Ga0500645_000005_213980_214759 259
463 3300053730 Ga0500645_000623 Ga0500645_000623_926_1705 259
464 3300053730 Ga0500645_004752 Ga0500645_004752_1452_2231 259
465 3300053730 Ga0500645_058390 Ga0500645_058390_33_812 259
466 3300053735 Ga0500596_001793 Ga0500596_001793_914_1693 259
467 3300055283 Ga0500661_000121 Ga0500661_000121_5761_6549 259
468 3300005289 Ga0065704_10073345 Ga0065704_100733459 260
469 3300005328 Ga0070676_10253407 Ga0070676_102534072 260
470 3300005331 Ga0070670_100066087 Ga0070670_1000660873 260
471 3300005339 Ga0070660_100036682 Ga0070660_1000366824 260
472 3300005347 Ga0070668_100010521 Ga0070668_1000105218 260
473 3300005353 Ga0070669_100002467 Ga0070669_10000246710 260
474 3300005354 Ga0070675_100006637 Ga0070675_1000066372 260
475 3300005355 Ga0070671_100004503 Ga0070671_10000450310 260
476 3300005355 Ga0070671_100166863 Ga0070671_1001668632 260
477 3300005366 Ga0070659_100071834 Ga0070659_1000718342 260
478 3300005367 Ga0070667_100026707 Ga0070667_1000267072 260
479 3300005548 Ga0070665_100000541 Ga0070665_1000005412 260
480 3300005548 Ga0070665_100003938 Ga0070665_10000393810 260
481 3300005563 Ga0068855_100437857 Ga0068855_1004378572 260
482 3300005841 Ga0068863_100056547 Ga0068863_1000565472 260
483 3300005842 Ga0068858_100016988 Ga0068858_1000169884 260
484 3300005843 Ga0068860_100030305 Ga0068860_1000303051 260
485 3300005844 Ga0068862_100006298 Ga0068862_10000629811 260
486 3300005844 Ga0068862_100031066 Ga0068862_1000310664 260
487 3300006051 Ga0075364_10215639 Ga0075364_102156392 260
488 3300006195 Ga0075366_10198712 Ga0075366_101987122 260
489 3300009011 Ga0105251_10000276 Ga0105251_1000027629 260
490 3300009093 Ga0105240_10000352 Ga0105240_1000035250 260
491 3300009093 Ga0105240_10075423 Ga0105240_100754232 260
492 3300009101 Ga0105247_10042730 Ga0105247_100427303 260
493 3300009148 Ga0105243_10490852 Ga0105243_104908522 260
494 3300009177 Ga0105248_10026581 Ga0105248_100265812 260
495 3300009545 Ga0105237_10019944 Ga0105237_100199443 260
496 3300010375 Ga0105239_10000207 Ga0105239_1000020721 260
497 3300025735 Ga0207713_1002506 Ga0207713_10025064 260
498 3300025900 Ga0207710_10088541 Ga0207710_100885412 260
499 3300025901 Ga0207688_10290873 Ga0207688_102908731 260
500 3300025907 Ga0207645_10362905 Ga0207645_103629051 260
501 3300025913 Ga0207695_10000434 Ga0207695_1000043430 260
502 3300025913 Ga0207695_10139251 Ga0207695_101392512 260
503 3300025914 Ga0207671_10000955 Ga0207671_100009553 260
504 3300025919 Ga0207657_10050512 Ga0207657_100505122 260
505 3300025923 Ga0207681_10003059 Ga0207681_100030594 260
506 3300025931 Ga0207644_10000367 Ga0207644_1000036728 260
507 3300025931 Ga0207644_10032521 Ga0207644_100325212 260
508 3300025931 Ga0207644_10116967 Ga0207644_101169672 260
509 3300025933 Ga0207706_10061908 Ga0207706_100619083 260
510 3300025935 Ga0207709_10289951 Ga0207709_102899512 260
511 3300025941 Ga0207711_10021765 Ga0207711_100217656 260
512 3300025986 Ga0207658_10019407 Ga0207658_100194074 260
513 3300026035 Ga0207703_10088800 Ga0207703_100888004 260
514 3300026041 Ga0207639_10114152 Ga0207639_101141522 260
515 3300026088 Ga0207641_10004669 Ga0207641_100046698 260
516 3300028379 Ga0268266_10001691 Ga0268266_1000169119 260
517 3300028379 Ga0268266_10018808 Ga0268266_100188082 260
518 3300028380 Ga0268265_10151490 Ga0268265_101514903 260
519 3300032004 Ga0307414_10001099 Ga0307414_1000109913 260
520 3300046525 Ga0495663_0000001 Ga0495663_0000001_557884_558666 260
521 3300046558 Ga0495633_0000179 Ga0495633_0000179_55339_56121 260
522 3300047472 Ga0495686_0000293 Ga0495686_0000293_27810_28592 260
523 3300048905 Ga0496102_0487663 Ga0496102_0487663_252_1034 260
524 3300048906 Ga0496103_0001474 Ga0496103_0001474_7861_8643 260
525 3300048919 Ga0496116_0021122 Ga0496116_0021122_452_1234 260
526 3300048920 Ga0496117_0034667 Ga0496117_0034667_1659_2441 260
527 3300048920 Ga0496117_0098213 Ga0496117_0098213_333_1115 260
528 3300048921 Ga0496118_0188933 Ga0496118_0188933_131_913 260
529 3300048921 Ga0496118_0248400 Ga0496118_0248400_128_910 260
530 3300048922 Ga0496119_0025914 Ga0496119_0025914_900_1682 260
531 3300048922 Ga0496119_0049394 Ga0496119_0049394_223_1005 260
532 3300048923 Ga0496120_0188536 Ga0496120_0188536_75_857 260
533 3300048924 Ga0496121_0001839 Ga0496121_0001839_21055_21837 260
534 3300048924 Ga0496121_0014109 Ga0496121_0014109_2668_3450 260
535 3300048926 Ga0496123_0033133 Ga0496123_0033133_1274_2056 260
536 3300048927 Ga0496124_0276592 Ga0496124_0276592_306_1088 260
537 3300048929 Ga0496126_0005027 Ga0496126_0005027_13739_14521 260
538 3300048929 Ga0496126_0089546 Ga0496126_0089546_1368_2150 260
539 3300048929 Ga0496126_0266045 Ga0496126_0266045_435_1217 260
540 2162886007 SwRhRL2b_contig_3948926 SwRhRL2b_0218.00005250 261
541 3300005289 Ga0065704_10070184 Ga0065704_1007018469 261
542 3300005295 Ga0065707_10106588 Ga0065707_101065884 261
543 3300005355 Ga0070671_100059782 Ga0070671_1000597823 261
544 3300005367 Ga0070667_100008960 Ga0070667_1000089602 261
545 3300005455 Ga0070663_100624669 Ga0070663_1006246691 261
546 3300005457 Ga0070662_100037104 Ga0070662_1000371044 261
547 3300005841 Ga0068863_100001079 Ga0068863_10000107929 261
548 3300005843 Ga0068860_100024116 Ga0068860_1000241162 261
549 3300005843 Ga0068860_100107503 Ga0068860_1001075033 261
550 3300006058 Ga0075432_10026257 Ga0075432_100262572 261
551 3300006353 Ga0075370_10089537 Ga0075370_100895372 261
552 3300006946 Ga0079104_1018747 Ga0079104_10187473 261
553 3300025298 Ga0209050_1000685 Ga0209050_100068541 261
554 3300025904 Ga0207647_10053387 Ga0207647_100533874 261
555 3300025907 Ga0207645_10036051 Ga0207645_100360512 261
556 3300025986 Ga0207658_10002737 Ga0207658_100027379 261
557 3300026088 Ga0207641_10002412 Ga0207641_100024122 261
558 3300027111 Ga0209281_1012494 Ga0209281_10124943 261
559 3300028381 Ga0268264_10017221 Ga0268264_100172213 261
560 3300028381 Ga0268264_10081902 Ga0268264_100819023 261
561 3300046453 Ga0495627_001091 Ga0495627_001091_15084_15869 261
562 3300046471 Ga0495650_0001028 Ga0495650_0001028_11679_12464 261
563 3300046500 Ga0495596_0000437 Ga0495596_0000437_18492_19289 261
564 3300046501 Ga0495607_0006033 Ga0495607_0006033_7106_7903 261
565 3300046506 Ga0495583_0037970 Ga0495583_0037970_1389_2186 261
566 3300046507 Ga0495606_0007211 Ga0495606_0007211_8407_9204 261
567 3300046512 Ga0495610_0000015 Ga0495610_0000015_173703_174488 261
568 3300046512 Ga0495610_0000136 Ga0495610_0000136_6419_7204 261
569 3300046515 Ga0495620_0035031 Ga0495620_0035031_826_1611 261
570 3300046518 Ga0495631_0090143 Ga0495631_0090143_126_911 261
571 3300046519 Ga0495632_0000351 Ga0495632_0000351_26459_27244 261
572 3300046519 Ga0495632_0032070 Ga0495632_0032070_1343_2140 261
573 3300046522 Ga0495643_0000048 Ga0495643_0000048_211714_212499 261
574 3300046522 Ga0495643_0061031 Ga0495643_0061031_485_1282 261
575 3300046530 Ga0495654_0026433 Ga0495654_0026433_546_1331 261
576 3300046538 Ga0495609_0004502 Ga0495609_0004502_3929_4726 261
577 3300047470 Ga0495681_0000445 Ga0495681_0000445_18990_19775 261
578 3300048924 Ga0496121_0004929 Ga0496121_0004929_3029_3847 261
579 3300048929 Ga0496126_0183536 Ga0496126_0183536_335_1126 261
580 3300053087 Ga0500643_007836 Ga0500643_007836_3331_4122 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

169

266

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.9401 1 261
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.9366 1 261
8tid-assembly1.cif.gz_H combined linker domain of n-drc and associated proteins tetrahymena 0.833 131 191
5lq7-assembly1.cif.gz_A salmonella effector spvd - g161 variant 0.7367 184 218
8j07-assembly1.cif.gz_7 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.7193 131 225
ID Description Score Start End Superfamily
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.8851 79 249 3.10.620.30
af_P71734_77_269_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8334 76 238 3.10.620.30
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8295 95 238 3.10.620.30
3isrD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8281 3 78 2.60.40.2250
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.82 79 249 3.10.620.30
ID Description Score Start End GO Terms
AF-G2IKF2-F1-model_v4 Transglutaminase-like domain-containing protein 0.9962 1 258
AF-A0A6I4SXY9-F1-model_v4 Transglutaminase family protein 0.9962 1 258
AF-A0A4Q2Z976-F1-model_v4 Transglutaminase family protein 0.9956 147 258
AF-A0A5B9EHM9-F1-model_v4 Transglutaminase family protein 0.9952 1 258
AF-A4ADC0-F1-model_v4 Transglutaminase-like enzyme, putative cysteine protease 0.9942 1 259 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
96.73 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map